SMV Manual - Lectrosonics.com
Contents
1. E 11 1 EG On E 12 Installing the Connector ac asenanerassbenacmenstunacneeqsaeeneenaseinedimnbasunasvencsmecurtetasmaaaiastiunsiea0aceatamecd wleaaeqiensaeetaaebnesasacutatwecaniatutntinecnseusesneees 12 WIE TOM MOMG Hale E N T E S 12 Microphone Cable Termination Tor NON LECIFOSONICS MICFO PNONGS sasssa Raa a Raa Aaaa 13 Wiring Hookups for Different 14 Compatible Wiring for Both Servo Bias Inputs and Earlier Transmitters 14 Simple Wiring Can ONLY be used with Servo Bias INDUtS ccccccseeeceeceeeeeeeceeeeecauceeeeseaseeeeaeaeeeseaaeeeeesaaeeeesaeeeeessseeeeseaeeesssnees 14 Silver Paste on SM Series Transmitter 15 RM Remote Contolera Eaa Eaa AERE ERE REEE a EAEEREN E Oa REEE 162. iaai a diaaa daas isaha 21 ssir 22 RM Troubleshooting 2s ccctenaccunnnsssahinessaceoesecccascttemnisqaswacasehsespsvenesanecatdrsomeneaseneeeeauadcunnenoeapebedetsnossadmechnsbsaesunee siuencandeas mnetinneseecansedcusseneceee 23 FCAT CS ooien aa E Eaa S a Aaaa 24 ANG R D ll snn AEA a E 25 RENNO UNIS Ol RODA I E E REEE TE E EEE E 25 Rio Rancho NM 3 SMV Series General Technical Description Servo Bias Input No Pre Emphasis De Emphasis The voltage and current requirements of the wide vari ety of electret microphones used in professional appli cations has caused confusion and compromises in the wiring needed for wireless transmitters To address this problem the unique Servo Bias input circuit provides an automatically regulated voltage over a very wide range of current for compatibility with all microphones Digital Hybrid Wireless Technology All wireless links suffer from channel noise to some de gree and all wireless microphone systems seek to
3. LECTROSONICS INC Battery and Battery Eliminator Installation Note Standard zinc carbon batteries marked heavy duty or long lasting are not adequate The battery status circuitry is designed for the voltage drop over the life of lithium batteries To install new batteries 1 Turn the Battery Cover Plate Thumbscrew counter clockwise a few turns until the door will rotate 2 Insert the new batteries into the housing The posi tive battery terminal goes into the transmit ter first 3 Align the Battery Cover Plate and tighten the Bat tery Cover Plate Thumbscrew Gore Tex covered vent Two battery compartments Polarity SMQV engraved into housing NOTE Refer to the previous section entitled Configuring for Power Restore To install the battery eliminator loosen the thumbscrew completely and remove the battery door Insert the battery eliminator and tighten the thumbscrew Install plastic cap A on dual battery model to cover the open battery compartment Gore Tex Registered trademark of W L Gore and Associates Rio Rancho NM Super Minature Belt Pack Transmitter Attaching and Removing the Microphone The flexible sleeve over the 5 pin plug on the micro phone helps prevent dust and moisture from getting into the input jack The flange around the rim of the connec tor on the transmitter helps retain the sleeve after it is installed and The following procedu
4. 20 k resistor in series with pin 5 Put this resistor inside the TA5F con nector to minimize noise pickup SHIELD GND As a O Line Level 4 49 1 Normal Hookup O ADO 5 PLUG SHIELD GND ip Line Level 2 More Headroom a 20 dB 20k AUDIO 04 8 PLUG TA5F Backshell with Strain Relief Remove strain relief if using dust boot Dust Boot P N 35510 TASF Latchlock Note If you use the dust boot remove the rubber Strain relief that is attached to the TA5F cap or the boot will not fit over the assembly Microphone RF Bypassing When used on a wireless transmitter the microphone element is in the proximity of the RF coming from the transmitter The nature of electret microphones makes them sensitive to RF which can cause problems with the microphone transmitter compatibility If the electret microphone is not designed properly for use with wire less transmitters it may be necessary to install a chip Capacitor in the mic capsule or connector to block the RF from entering the electret capsule Some mics require RF protection to keep the radio signal from affecting the capsule even though the transmitter input circuitry is already RF bypassed see schematic diagram the mic is wired as directed and you are having dif ficulty with squealing high noise or poor frequency response is likely to be the caus
5. E E A E E E E 8 E AA P E EE E N E T A E E T E EA A A E E E A E E wen 9 PRO CUIGTAGY 9 9 Remote Control 9 Contiguring Ttor Power REStOTO 2 E aa SA e eda REONE EEA anadi addi 10 Setting Transmitter Operating Frequency cccccssseccccesseecceeseeecceeuseeceeauceceseueeeeeseaeececsaseeeecsaaeeesauaeeesseaeeeeesaseeessaeeesseuseeessaseesssaags 10 Adjusting Audio Level GAN asic E EE 10 Set Up in 100 kHz 10 UD IN 25 KAZ MOGE scceim NEE E EE E AER EEA E EEE RESE 10 Locking or Unlocking the Controls 2 Erd a aroi O 11 OAPI IN DUE WACK VV INNING
6. Power LED The PWR LED glows green when the battery is good The color changes to red when there is about 30 min utes of operation left with the recommended lithium bat tery When the LED begins to blink red there are only a few minutes of life AUDIO Button FREQ Button The exact point at which the LED turns red will vary with battery brand and condition temperature and cur rent drain The LED is intended to simply catch your attention not to be an exact indicator of remaining time Varies Blink Green Red Hours 2 4 6 8 A weak battery will sometimes cause the PWR LED to glow green immediately after the transmitter is turned on but will soon discharge to the point where the LED will turn red or the unit will turn off completely Power LED Off Feature In normal operating mode the DOWN and UP Arrow buttons may be used to turn the PWR LED indica tors off and on This setting does not persist through a power cycle nor does it affect the LCD backlight Audio Input Jack The Servo Bias input circuitry accommodates virtually every lavaliere handheld or shotgun microphone avail able plus line level signals Battery Compartment and Thumb Screw The large knurled thumbscrew is used to release or secure the Battery Compartment Cover Plate Modulation LEDs Proper input gain adjustment is critical to ensure the best audio quality Two bicolor LEDs will glow either red or green to accurately indicate modulation
7. the RM ORANG OM vests cccenceicinesatccedaseads de Saneapttccnconssamecbecedasmelinsad E EEA aaide aAa EA oiid 16 RMFUNCIONS and EE E EE 16 eS Gertie E E E 17 ON vss sss ses ce ete E A 17 810 cccncic sec nsocserecseaaeie thee cteusswatsavieiexdleceesvee seg hcunnveus 18 WHIP aa 19 Tor SINGIE a a 20 Accessories for dual Battery Models sarson i 20 0
8. 616 625 Add New Tx ACTIVATE The Android version keeps all settings on the same page and allows the user to toggle between the activa tion buttons for each setting The activation button must be long pressed to activate The Android version also allows users to keep a configurable list of full sets of settings Activation For a transmitter to respond to remote control audio tones the transmitter must meet certain requirements The transmitter must not be turned off it can however be in sleep mode The transmitter must have firmware version 1 5 or later for Audio Frequency Sleep and Lock changes The transmitter microphone must be within range The transmitter must be configured to enable remote control activation Please be aware this app is not a Lectrosonics product It is privately owned and operated by New Endian LLC www newendian com LECTROSONICS INC Super Minature Belt Pack Transmitter Straight Whip Antennas This is a full size cutting template used to cut the length The supplied caps can be used several different ways of the whip for a particular frequency Lay the uncut antenna on top of this drawing and trim the whip length to the desired frequency 2 A color sleeve next to the connector with a black cap on the end of the whip trim the closed end of the colored cap off with scissors to make a sleeve 1 A color cap on the end of the whip After cutting the antenna to t
9. ibility of digital signal processing the transmitter can also operate in various compatibility modes for use with Lectrosonics 200 Series Lectrosonics 100 Series IFB and certain non Lectrosonics receivers Contact the Lectrosonics sales department for more information about non Lectrosonics receivers Control Panel The control panel includes four membrane switches and an LCD screen to adjust the operational settings Multi color LEDs are used to indicate audio signal levels for accurate gain adjustment and for battery status Wide Band Deviation 75 kHz deviation improves the signal to noise ratio and audio dynamic range of a wireless system dramatically compared to other designs that use 30 kHz to 40 kHz deviation Wide deviation combined with a high powered transmitters makes a significant improvement in signal to noise ratio and operating range Variable Power Output This advanced feature allows the operator to optimize the transmitter for maximum battery life or for maximum operating range Power output is selected using the LCD in a setup mode while the RF output of the trans mitter is turned off Rio Rancho Battery Options and Operating Time Switching power supplies convert regulated battery ages to operate various circuit stages with maximum efficiency The firmware remembers the power status when a battery fails so the transmitter will be turned on auto matically when the battery is rep
10. ONLY be used with Servo Bias Inputs Fig 9 2 VOLT POSITIVE BIAS 2 WIRE ELECTRET SHIELD Simplified wiring for microphones such as Countryman B6 Lavalier and E6 Earset models and others NOTE This servo bias wiring is not compatible with earlier versions of Lectrosonics transmitters Check with the factory to confirm which models can use this wiring Fig 10 2 VOLT NEGATIVE BIAS 2 WIRE ELECTRET SHIELD Simplified wiring for microphones such as negative bias TRAM NOTE This servo bias wiring is not compatible with earlier versions of Lectrosonics transmitters Check with the factory to confirm which models can use this wiring Fig 11 4 VOLT POSITIVE BIAS 3 WIRE ELECTRET SHIELD NOTE This servo bias wiring is not compatible with earlier versions of Lectrosonics transmitters Check with the factory to confirm which models can use this wiring LECTROSONICS INC Super Minature Belt Pack Transmitter Silver Paste on SM Series Transmitter Thumbscrews Silver paste is applied to thumbscrew threads on new Simply hold the cloth around the threads and turn the units at the factory to improve the electrical connection thumbscrew Move to a new spot on the cloth and do it from the battery compartment through the housing on again Do this until the cloth remains clean Now clean any SM Series transmitter This applies to the standard the threads in the case by using a dry cotton swab Q battery door and the battery elim
11. UHF shield insulation transmitters only VHF transmitters with 5 pin jacks require a different termination Lectrosonics lavaliere microphones are terminated for compatibility with VHF and UHF transmitters which is different than what is shown here Rio Rancho 13 SMV Series Wiring Hookups for Different Sources In addition to the microphone and line level wiring hook ups illustrated below Lectrosonics makes a number of cables and adapters for other situations such as con necting musical instruments quitars bass guitars etc to the transmitter Visit and click on Accessories or download the master catalog A lot of information regarding microphone wiring is also available in the FAQ section of the web site at tto www lectrosonics com fag htm Follow the instructions to search by model number or other search options Compatible Wiring for Both Servo Bias Inputs and Earlier Transmitters Fig 1 2 VOLT POSITIVE BIAS 2 WIRE ELECTRET SHIELD Compatible wiring for microphones such as Countryman E6 headworn and B6 lavaliere Fig 2 4 VOLT POSITIVE BIAS 2 WIRE ELECTRET SHIELD Most common type of wiring for lavaliere mics Fully compatible with 5 pin inputs on Lectrosonics transmitters such as the LM and UM Series Fig 3 DPA MICROPHONES Danish Pro Audio miniature models SHIELD This wiring is for DPA lavalier and headset microphones NOTE The resistor value can range from 3k to 4
12. and proximity of microphone are sufficient to engage transmitter Make sure transmitter is not in Sleep mode FREQUENCY CHANGES BUT NOT TO DESIRED FREQUENCY Rio Rancho 1 RM set on different block than transmitter in question RM uses hex code to set frequency set RM to proper frequency block or use hex code method to change frequency aS SMV Series Specifications and Features Operating frequencies Block 470 470 100 495 600 Block 19 486 400 511 900 Block 20 512 000 537 500 Block 21 537 600 563 100 Block 22 563 200 588 700 Block 23 588 800 607 900 614 100 614 300 Frequency usage varies by country Frequency range Channel Spacing Frequency selection RF Power output Compatibility Modes 6 Pilot tone Frequency stability Deviation Spurious radiation Equivalent input noise Input level If set for dynamic mic If set for electret lavaliere mic Line level input Input impedance Dynamic mic Electret lavaliere Line level Input limiter Bias voltages Gain control range Modulation indicators Controls Block 24 614 400 639 900 Block 25 640 000 665 500 Block 26 665 600 691 100 256 frequencies in 100 kHz steps for one 25 5 MHz wide block 100 kHz or 25 kHz Control panel mounted membrane switches Switchable 50 100 or 250 mW Digital Hybrid Wireless 400 Series 200 Series 100 Series Mode 3 Mode 6 IFB 25 to 32 kHz 5 kHz deviati
13. indicate that the transmitter is asleep and not turned off The RM is not included with SM Series transmitters Several Dweedle tones can also be downloaded from the web site at tto www lectrosonics com hybrid rm rm html The dweedle tones can be played back through an player PDA etc and in most cases will even work with walkie talkies The tones will not work through the loud speakers of a sound system because the reflections and reverberation in the room will alter the tones SMV Series Configuring for Power Restore When using external power PIL source through a battery eliminator Power Restore will return your transmitter to 11 settings it had before it was 1 B powered off This eliminates the need to power through the unit itself 1 Press and hold the Down Arrow Button then power on the transmitter by pressing the Audio and Freq buttons simultaneously 2 The LCD will display the status either rc ON or rc OFF Press AUDIO or FREQ key to scroll to the PbAc setup screen Power Restore Screens e PbAc 1 for power restore ON PbAc 0 for power restore OFF 3 When power restore is set to ON the unit will turn on whenever power is present at the battery termi nals until the power is manually turned off with the control panel switches NOTE The firmware remembers the power status when a battery fails so the transmitter w
14. mini mize the impact of that noise on the desired signal Con ventional analog systems use compandors for enhanced dynamic range at the cost of subtle artifacts typically pumping and breathing Wholly digital systems defeat the noise by sending the audio information in digital form at the cost of some combination of power bandwidth and resistance to interference Digital Hybrid systems overcome channel noise in a dramatically new way digitally encoding the audio in the transmitter and decoding it in the receiver yet still send ing the encoded information via an analog FM wireless link This proprietary algorithm is not a digital imple mentation of an analog compandor but a technique that can be accomplished only in the digital domain even though the inputs and outputs are analog Because it uses an analog FM link the Digital Hybrid system enjoys all the benefits of conventional FM wire less systems and it does away with the analog compan The Digital Hybrid design results in a signal to noise ratio high enough to preclude the need for conventional pre emphasis HF boost in the transmitter and de emphasis roll off in the receiver This eliminates the potential for distortion of signals with abundant high frequency information Low Frequency Roll Off The low frequency roll off can be set for a 3 dB down point at 35 50 70 100 120 and 150 Hz to control sub sonic and very low frequency audio content in
15. the command was received but it didn t ee RM2 Remote Control e lf you are having trouble getting the transmitter to respond make sure you aren t covering the speaker with your thumb and or turn up the speaker volume on the Loud page e Ifthe RM is set to a different block number than the transmitter and an attempt is made to set the transmitters frequency in MHz the command will still work The transmitter is simply set to the corresponding channel in the correct block with a matching hexadecimal number e The audio signal from the RM will change the set tings of all transmitters within range Experiment with this to prevent accidental changes to another transmitter during a production A lower cost alternative to the RM this model provides remote control of e Sleep Unsleep e Lock Unlock e Audio Level gain This model operates on a button cell battery with a recessed trim pot screwdriver adjusted for the speaker level control Rio Rancho 12 SMV Series LectroRM By New Endian LLC LectroRM is a mobile application for iOS and Android operating systems Its purpose is to remotely control Lectrosonics Transmitters including SM Series WM Series The app remotely changes settings transmitter through the use of encoded audio tones which when received by the attached microphone will alter the configured setting The app was released by New En dian LLC in September 20
16. two digit hexadecimal number that corresponds to E the equivalent Lectrosonics Frequency Switch Setting The example of the two digit display shown here indicates CH channel and 2C as the frequency Repeatedly pressing the FREQ button toggles between the two displays Press and hold the FREQ button and use the Up and Down arrows to select the frequency Set Up in 25 kHz Mode The hexidecimal display in the 25 kHz mode will appear with a decimal suffix to indicate the 25 kHz steps is 644 400 MHz Lalli JIL IC 644 425 MHz L E L UJ GAC TIE O 644 475 MHz Adjusting the Low Frequency Roll off Repeatedly press the AUDIO button until the LF roll off adjustment screen appears Then press and hold the AUDIO button while selecting the desired roll off frequency with the UP and DOWN arrows EE I IL The roll off frequency can be set to 35 50 70 100 120 and 150 HZ Adjusting Audio Level Gain The control panel Modulation LEDs indicate the audio level and limiter activity Once set the transmitters audio level setting should not be used to control the volume of your sound system or recorder levels This gain adjustment matches the transmitter gain with the microphone s output level the voice level and the position of the microphone The audio input level gain is adjusted with the unit in the Standby Mode or while powered up whi
17. 11 The app is available for download and sells for 20 on the Apple App Store and Google Play Store LectroRM s remote control mechanism is the use of an audio sequence of tones dweedles that are inter preted by the transmitter as a configuration change The settings available in LectroRM are Audio Level e Frequency e Sleep Mode Lock Mode User Interface The user interface involves selecting the audio se quence related to the desired change Each version has an interface for selecting the desired setting and the desired option for that setting Each version also has a mechanism to prevent accidental activation of the tone 105 Carrier 4 1 Lectro 3 48 PM 3 49 PM Lectro Channel LECTROSONICS SM TRANSMITTERS BIk19 3 E 492 600 Siar Activate Activate The iPhone version keeps each available setting on a separate page with the list of options for that setting On iOS the Activate toggle switch must be enabled to show the button which will then activate the audio The iOS version s default orientation is upside down but can be configured to orient right side up The purpose for this is to orient the device s speaker which is at the bot tom of the device closer to the transmitter microphone Android lt LectroRM LectroRM avon LOCK POMA BIk21 00 537 600 Bod 539 100 Arvie 616 000 Cristins
18. D membrane switches and multi color LEDs make input gain adjustments frequency and compatibility mode selection quick and accurate without having to view the receiver The battery compartment accepts AA lithium or rechargeable batteries The housings are machined from solid aluminum blocks to provide an extremely lightweight and rugged package A special non corrosive finish resists salt water exposure and perspiration in extreme environments The DSP based design works with all Digital Hybrid receivers and is backward compatible for use with Lectrosonics 200 Series 100 Series IFB receivers and some other brands of analog wireless receivers LECTROSONICS INC Super Minature Belt Pack Transmitter Table of Contents faligo e Ulete g PAE E E E E E E E 2 General Technical 4 Contos and FUNCIONS cio cet cect eee eee we sa se since cee satire wate AEA 6 EG DS CPCS ID ste sce sera re spend n ESEE r EAE E A EEE 6 FONO rae ceases 6 ON F a NS 6 P
19. EA NIM 6 PODIO eeen e E E E E 6 FREG BUON 6 OTT OVI Sesser ease cease 6 Battery Battery 1 Nanana aana aiaiai 7 Attaching REMOVING Microphone sisisi aA aaa 7 STRUCTION Esar ae EEEE 8 Power Up and BOOT SEQUENCE eaaa aaee Eie oar iesin 8 OW OW e a sven A essen de a E A E E 8 E eususenaiedssbau salen etachadesadielasllbuiedduatenbaiasacendcnedusdewarsensieioien AEE 8 LOD Backlight S ssir iarsin a a a a aiea reae aa eare ieai i 8 Selecting the Compatibility Mode eG OUPO ECP eeso e S
20. Freq Switch po a Y Up Down Switches M 5 ae Bicolor Phase Locked Loop a gt O LED Voltage Final isolator Ss Controlled Amplifier Grn Bicolor Reference Oscillator Le Crystal T D Modulation s LEDs 2 4 LECTROSONICS INC Super Minature Belt Pack Transmitter Signal Encoding and Pilot Tone In addition to controlling the limiter the DSP also en codes the digitized audio from the A D converter and adds an ultrasonic pilot tone to control the squelch in the receiver A pilot tone squelch system provides reli able method of keeping a receiver output muted audio mute even in the presence of significant interference When the system is operating in the hybrid mode a dif ferent pilot tone frequency is generated for each carrier frequency to prevent inadvertent squelch problems in multi channel sytems Microprocessor Control A microprocessor monitors user command inputs from the control panel buttons and numerous other internal signals It works intimately with the DSP to ensure the audio is encoded according to the selected Compatibil ity Mode and that the correct pilot tone is added to the encoded signal Compatibility Modes SM transmitters are designed to operate with Lectro sonics Digital Hybrid receivers and will yield the best performance when doing so however due to the flex
21. INSTRUCTION MANUAL SMV Series Super Miniature Variable Power Transmitters With Digital Hybrid Wireless Technology US Patent 7 225 135 SMQV Dual Battery Model SMV Single Battery Model RM Remote Control RM2 Remote Control Serial Number LECTROSONICS Purchase Date ae iO Rio Rancho NM USA www lectrosonics com SMV Series Introduction The SM Series variable power transmitters are the product of many years of engineering and experience in professional audio markets The unique design provides several distinct features for professional applications e Selectable output power to maximize battery life or operating range as needed e Superb compandor free audio quality e Ultra lightweight corrosion resistant housing e Water resistant seals for use in damp environments e Programmable compatibility modes for use with a wide variety of different receivers The Digital Hybrid Wireless design US Patent 7 225 135 combines 24 bit digital audio with analog FM resulting in a system that has the same operating range as analog systems the same spectral efficiency as analog systems the same long battery life as analog systems plus the excellent audio fidelity typical of pure digital systems The SM Series transmitters feature the unique servo bias input circuitry with a standard TA5M type input jack for use with electret lavaliere mics dynamic mics or line level signals A water resistant control panel with LC
22. antenna missing or improperly positioned 4 Transmitter and receiver not on same frequency Check switches display on transmitter and receiver 5 Transmitter and receiver not on same frequency block 6 Operating range is too great 7 Defective transmitter antenna NO SOUND OR LOW SOUND LEVEL RECEIVER INDICATES PROPER AUDIO MODULATION 1 Receiver output level set too low 2 Receiver output disconnected or cable defective or mis wired 3 Sound system or recorder input is turned down DISTORTED SOUND 1 Transmitter gain audio level is far too high Check audio level LEDs and receiver audio levels during use 2 Receiver output may be mismatched with the sound system or recorder input Adjust output level on receiver to the correct level for the recorder mixer or sound system Use the receivers Tone function to check level 3 Transmitter is not set to same frequency as receiver Check that operating frequency on receiver and transmitter match 4 Receiver Transmitter Compatibility Mode mismatched EXCESSIVE FEEDBACK 1 Transmitter gain audio level too high Check gain adjustment and or reduce receiver output level 2 Talent standing too close to speaker system 3 Mic is too far from user s mouth LECTROSONICS INC SYMPTOM HISS AND NOISE AUDIBLE DROPOUTS Super Minature Belt Pack Transmitter POSSIBLE CAUSE Transmitter gain audio level far too low Receiver antenna missing or obstructed Transm
23. controlled environment This device should be installed and operated so that its antenna s are not co located or operating in conjunction with any other antenna or transmitter 24 Emission Designator 180KF3E Specifications subject to change without notice The FCC requires that the following statement be in cluded in this manual for the RM This device complies with Part 15 of the FCC Rules Operation is subject to the following two conditions 1 This device may not cause harmful interference and 2 this device must accept any interference received including interference that may cause undesired operation This device complies with Industry Canada radiation exposure limits as set forth for a controlled professional use only LECTROSONICS INC Service and Repair If your system malfunctions you should attempt to correct or isolate the trouble before concluding that the equipment needs repair Make sure you have followed the setup procedure and operating instructions Check the interconnecting cables and then go through the Troubleshooting section in this manual We strongly recommend that you do not try to repair the equipment yourself and do not have the local repair shop at tempt anything other than the simplest repair If the repair is more complicated than a broken wire or loose connection send the unit to the factory for repair and service Don t attempt to adjust any controls inside the units Once set at the
24. d FREQ buttons until the Power Boot Sequence is initiated Selecting Step Size mode green and then revert to normal operation The LCD displays a bootup sequence which con sists of four screens Hold the UP arrow in while powering up the unit to enter the setup screen Press the AUDIO button repeatedly to step through the setup items to reach the Step Size Mode screen Use the UP or DOWN arrow button to Company Name Lectro select the desired setting Frequency Block bXX and CLO nM Firmware Version rX X 21 1 1 typ IF FO ILL Power Level Pr 250 Compatibility Mode CP 400 typ LLL JL Audio Aud 12 typ Jt Power Down Selecting the Compatibility Mode and Output Power plinth TTT 200 Series 100 Series and IFB analog receivers plus some other analog wireless receivers in addition to the native digital hybrid mode 1 Simultaneously press and hold the AUDIO and FREQ buttons while observing that the word Off appears in the LCD along with a counter 2 When the counter reaches 0 the unit turns off E 400 Series or Digital Hybrid Wireless compatibility mode i L Note The unit E automatically enters the Power setting Standby Mode when selecting compatibility Note If the AUDIO and FREQ buttons are released before the LCD goes blank at the end of the countdown the unit will not turn off Instead it will stay energiz
25. e The best RF protection is accomplished by installing RF bypass capacitors at the mic capsule If this is not pos sible or if you are still having problems capacitors can be installed on the mic pins inside the TA5F connector housing 2 WIRE MIC 3 WIRE MIC Preferred locations for bypass capacitors z L CAPSULE CONNECTOR Alternate locations for bypass capacitors TASF CONNECTOR Install the capacitors as follows Use 330 pF capaci tors Capacitors are available from Lectrosonics Please specify the part number for the desired lead style Leaded capacitors P N 15117 Leadless capacitors P N SCC330P All Lectrosonics lavaliere mics are already bypassed and do not need any additional capacitors installed for proper operation LECTROSONICS INC Super Minature Belt Pack Transmitter Microphone Cable Termination for Non Lectrosonics Microphones TA5F Connector Assembly afl ol EF 8 Mic Cord Stripping Instructions VIEW FROM SOLDER SIDE OF PINS 0 15 gt Crimping to Shield and Insulation Strip and position the cable so that the clamp can be crimped to contact both the mic cable shield and the insulation The shield contact reduces noise with some microphones and the insulation clamp increases ruggedness Insulation Shield Crimp these Crimp these fingers to fingers to SS contact the clamp the NOTE This termination is intended for
26. e basic wiring necessary for the most common types of microphones and other audio inputs Some micro phones may require extra jumpers or a slight variation on the diagrams shown It is virtually impossible to keep completely up to date on changes that other manufacturers make to their products thus you may encounter a microphone that differs from these instructions this occurs please call our toll free number listed under Service and Repair in this manual or visit our web site at www lectrosonics com 2 BIAS 3 lt o MIC 100 Ohm gt To Virtual Ground Audio Amplifier 4 BIAS SELECT 5 LINE IN H gt To Limiter Control X SM Equivalent Input Circuit Wiring Audio input jack wiring PIN 1 Shield ground for positive biased electret lava liere microphones Shield ground for dynamic microphones and line level inputs PIN2 Bias voltage source for positive biased electret lavaliere microphones PIN3 Low impedance microphone level input for dynamic microphones Also accepts hand held electret microphones provided the microphone has its own built in battery PIN 4 Bias voltage selector for Pin Pin voltage 0 2 or 4 volts depends on Pin 4 connection Pin 4 tied to Pin 1 OV Pin 4 Open 2V Pin 4 to Pin 2 4V PIN5 High impedance line level input for tape decks mixer outputs musical instruments etc 14 SMV Series Installing the Connector 1 If necessary remove old connector f
27. ectrosonics Inc cannot correct the defect in your equipment it will be replaced at no charge with a similar new item Lectrosonics Inc will pay for the cost of returning your equipment to you This warranty applies only to items returned to Lectrosonics Inc or an authorized dealer shipping costs prepaid within one year from the date of purchase This Limited Warranty is governed by the laws of the State of New Mexico It states the entire liablility of Lectrosonics Inc and the entire remedy of the purchaser for any breach of warranty as outlined above NEITHER LECTROSONICS INC NOR ANYONE INVOLVED IN THE PRODUCTION OR DELIVERY OF THE EQUIPMENT SHALL BE LIABLE FOR ANY INDIRECT SPECIAL PUNITIVE CONSEQUENTIAL OR INCIDENTAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THIS EQUIPMENT EVEN IF LECTROSONICS INC HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES IN NO EVENT SHALL THE LIABILITY OF LECTROSONICS INC EXCEED THE PURCHASE PRICE OF ANY DEFECTIVE EQUIPMENT LINKIN This warranty gives you specific legal rights You have additional legal rights which vary from state to state LHW IW LLU LECTROSONICS 581 Laser Road NE Rio Rancho NM 87124 USA www lectrosonics com SMV Series manual 505 892 4501 800 821 1121 fax 505 892 6243 sales lectrosonics com 25 September 2015
28. ed it cannot be unlocked or powered off using the buttons The only ways to unlock a locked transmitter are to remove the battery or unlock it via the RM remote control Remote Control Operation The transmitters can be configured to respond to signals from the RM remote control unit or to ignore _ them This setting is ac La cessed by holding down the Down arrow button while powering the transmitter on Use the arrow keys to tog gle between rc on remote Remote Control Screens Rio Rancho Super Minature Belt Pack Transmitter control on and rc oFF remote control off The default setting is rc on lf a remote control signal is detected but the transmitter is set to rc OFF the message rc OFF will be dis played briefly on the transmitter s LCD to confirm that a valid signal was received but that the transmitter is not configured to respond to it Remote functions available are e Tx Input Gain e Sleep Unsleep Lock Unlock e Frequency e Tuning in 25 kHz steps e Changing the low frequency roll off setting e Turning on off the PWR and Audio LEDs e Gain up down functions In sleep mode the transmitter uses only 20 of the normal amount of battery drain Sleep mode can only be invoked with the remote control and can only be revoked with the remote control or by removing the battery When in the sleep mode the PWR LED blinks green every few seconds to
29. ed and the display will return to the 1 Set the receiver s audio controls to minimum previous screen 2 From a power off condition hold down the Up Standby Mode arrow then simultaneously press the AUDIO and E m C E With the power turned off FREQ buttons EEN pressing the AUDIO 3 Press either AUDIO or FREQ button to select the LI FREQ buttons briefly places compatibility screen and use the Up and Down ar Standby Screen the unit in Standby Mode In rows to select the desired mode this mode the RF output is The following Compatibility Modes are available turned off so all setup adjustments can be made without interfering with other systems operating in the e 100 Series mode CP 100 same location The screen displays rf OFF to remind 200 Series mode CP 200 the user that the unit is not transmitting While the unit is the standby mode access the setup we ee screens using the AUDIO and FREQ buttons and make 400 Series mode CP 400 adjustments using the Up and Down arrows Series mode CP IFB Mode 6 contact the factory for details CP 6 4 Press either AUDIO or FREQ button to select the power setting screen and use the Up and Down LCD Backlight Settings The LCD backlight can be set to turn off after either 5 minutes or 30 seconds or stay on continuously LECTROSONICS INC down arrows to select the desired level of power 5 Simultaneously press
30. erials UPS is usually the best way to ship the units Heavy units should be double boxed for safe transport D We also strongly recommend that you insure the equipment since we cannot be responsible for loss of or dam age to equipment that you ship Of course we insure the equipment when we ship it back to you Lectrosonics USA Mailing address Lectrosonics Inc PO Box 15900 Rio Rancho NM 87174 USA Web www lectrosonics com Lectrosonics Canada Mailing Address 720 Spadina Avenue Suite 600 Toronto Ontario M5S 2T9 Shipping address Lectrosonics Inc 581 Laser Rd Rio Rancho NM 87124 USA E mail sales lectrosonics com Telephone 416 596 2202 877 753 2876 Toll free 877 7LECT RO 416 596 6648 Fax Telephone 505 892 4501 800 821 1121 Toll free 505 892 6243 Fax E mail Sales colinb lectrosonics com Service joeb lectrosonics com 7 N Y LIMITED ONE YEAR WARRANTY The equipment is warranted for one year from date of purchase against defects in materials or workmanship provided it was purchased from an authorized dealer This warranty does not cover equipment which has been abused or damaged by careless handling or shipping This warranty does not apply to used or demonstrator equipment Z Should any defect develop Lectrosonics Inc will at our option repair or replace any defective parts without charge for either parts or labor If L
31. ernal power adapter battery elimina tor for all SM Series transmitters 6 to 36 volt external sources Handles up to 1 amp consumption Protected against shorts and reverse polarity To install the battery eliminator loosen the thumbscrew completely and remove the battery door Insert the bat tery eliminator and tighten the thumbscrew SMKITTAS5 Microphone connector kit with watertight sleeve for all SM Series transmitters SMKITTAS5 Rio Rancho 21 SMV Series Troubleshooting Before going through the following chart be sure that you have a good battery in the transmitter It is important that you follow these steps in the sequence listed SYMPTOM POSSIBLE CAUSE TRANSMITTER PWR LED OFF 1 Battery is inserted backwards or dead 2 Transmitter not powered up See Operating Instructions Power UP and Boot Sequence TRANSMITTER PWR LED BLINKS GREEN EVERY FEW SECONDS TRANSMITTER DOES NOT RESPOND OTHERWISE 1 Transmitter has been put to sleep by the remote control Either use the remote control to wake it up again or remove and reinsert the transmitter s battery AUDIO LEVEL LEDs NOT LIGHTING 1 Gain control set to minimum 2 Battery is dead or installed backwards Check PWR LED 3 Mic capsule is damaged or malfunctioning 4 Mic cable damaged or mis wired h RECEIVER RF INDICATOR OFF Transmitter not turned on or is in Standby Mode 2 Transmitter battery is dead 3 Receiver
32. es Battery Life SMV 50 mW 1 7 25 hrs SMV 100 mW 1 AA 5 5 hrs SMV 250 mW 1 AA 3 hrs 0 2 typical 400 Series mode Switchcraft 5 pin locking TA5F 1 5 Volt AA lithium mW 2AA 14 5 hrs 100 mW 2AA 14 hrs 250 mW 2 AA RM 2 3 oz 65 8 grams with lithium battery SMQV 3 7 oz 105 grams with lithium batteries Overall Dimensions RM RM 2 3 X 1 8 x 0 64 inches not including microphone lanyard 58 x 46 x 16 mm not including microphone lanyard 2 2 125 x 1 25 x 1 125 inches not including microphone lanyard 54 x 32 x 29 mm not including microphone lanyard SMV 2 3 x 1 8 x 0 64 inches not including microphone lanyard 58 x 46 x 16 mm not including microphone lanyard 2 3 x 2 4 x 0 64 inches not including microphone 58 x 60 x 16 mm not including microphone switches The FCC requires that the following statements be included in this manual for the SMV and SMQV For body worn operation this transmitter models has been tested and meets the FCC RF exposure guidelines when used with the Lectrosonics accessories supplied or designated for this product Use of other accessories may not ensure compliance with FCC RF exposure guidelines Contact Lectrosonics if you have any questions or need more information about RF exposure using this product This device complies with FCC radiation exposure limits as set forth for an un
33. factory the various controls and trimmers do not drift with age or vibration and never require readjustment There are no adjustments inside that will make a malfunctioning unit start working LECTROSONICS Service Department is equipped and staffed to quickly repair your equipment In warranty repairs are made at no charge in accordance with the terms of the warranty Out of warranty repairs are charged at a modest flat rate plus parts and shipping Since it takes almost as much time and effort to determine what is wrong as it does to make the repair there is a charge for an exact quotation We will be happy to quote approximate charges by phone for out of warranty repairs Returning Units for Repair For timely service please follow the steps below A DO NOT return equipment to the factory for repair without first contacting us by email or by phone We need to know the nature of the problem the model number and the serial number of the equipment We also need a phone number where you can be reached 8 A M to 4 P M U S Mountain Standard Time B After receiving your request we will issue you a return authorization number R A This number will help speed your repair through our receiving and repair departments The return authorization number must be clearly shown on the outside of the shipping container C Pack the equipment carefully and ship to us shipping costs prepaid If necessary we can provide you with the proper packing mat
34. he desired length mark the antenna by installing a color cap or sleeve to indicate the color listed in the table below 3 A color sleeve and color cap cut the cap in half with scissors Whip Length AANA a m Note Check the scale of your printout This line should be 6 00 inches long 152 4 mm BLOCK FREQUENCY CAP SLEEVE ANTENNA RANGE COLOR WHIP LENGTH 614 400 639 900 Yellow w Label 640 000 665 500 Green w Label 665 600 691 100 w Label TI Ea a a aa a NOTE Not all Lectrosonics products are built on all of the blocks covered in this table Factory supplied antennas precut to length include a label with the frequency range Label is not supplied with this kit Rio Rancho SMV Series Accessories for single Accessories for dual battery models battery models PSM Leather pouch with integrated belt clip PSMD Leather pouch with integrated belt clip SMBCUPSL Spring loaded machined aluminum clip SMDBCSL Spring loaded machined aluminum clip SMBCDN Machined wire belt clip for SMV transmitters SMDBC Machined wire belt clip for SMQV transmitters antenna down SMBCUP Machined wire belt clip for SMV transmitters 35924 Themal insulated pad installed for SMQV antenna up Place thermal insulation pad on back of unit as pictured 20 LECTROSONICS INC Super Minature Belt Pack Transmitter Accessories for Both Models SMBATELIM Ext
35. ill be turned on automatically when the battery is replaced and the previous settings will be enabled Power Up and Boot Sequence Setting Transmitter Operating Frequency The frequency can be E E displayed either in MHz 1 two digit hexadecimal Frequency displayed number and can be set in in MHz the Standby Mode or when the transmitter is powered E up The hexadecimal _ numbering system is unique Frequency displayed as to Lectrosonics where two two digit hexadecimal alphanumeric characters number correspond to the left and right switch settings on earlier analog transmitters that had mechanical rotary switches to adjust frequency 1 Press the FREQ button to select either the MHZ screen or the hexadecimal screen 2 While holding the FREQ use the Up Down arrow buttons to move the operating fre quency up or down in 100 kHz increments from the current setting Note The operating frequency displayed on the LCD wraps as it reaches the upper or lower end of its range Most Lectrosonics receivers with an LCD interface indicate the operating frequency both in MHz and as a two digit hexadecimal number In many cases it is more convenient to use the two character hexadecimal num bers rather than the six character frequency in MHz 10 Set Up in 100 kHz Mode The Frequency Screen 81 displays the operating frequency in MHz or as a
36. in situations where the transmitter is buried deep inside costuming and there are waiting periods between use The transmitter can sleep for several hours and then be awakened and adjusted when the production is about to begin While the transmitter is asleep the power LED will blink green every few seconds 16 Powering the RM on and off To turn the RM on or off press the AUDIO and FREQ buttons together briefly The unit powers up on the page that was displayed when the unit was last powered off RM Functions and Operation To turn the power off and on press the AUDIO and FREQ buttons at the same time To enter the setup screen for the desired function press the Access Button multiple times until the desired screen appears Then use the arrow buttons to set the value or select the screen function Function Access Button Screen Tx Input Gain AUDIO Sleep Unsleep AUDIO SLEEP unSLP Lock Unlock AUDIO AUDIO Tx power output AUDIO FREQ b CH MHz The frequency setup screens are as follows b Sets the frequency block CH Sets the frequency by hex code MHz Sets the frequency Megahertz Hold the speaker on the RM close to the microphone when pressing the send button A dweedle tone will play from the RM speaker into the microphone and the parameter on the transmitter will be set immediately The speaker on the RM remote unit should be uncov ered and held within a few inches of the transmitter s micr
37. inator tip or equivalent Again clean the case threads until a fresh cotton swab comes away clean Open the vial and transfer a pinhead speck of silver paste to the second thread from the end of the thumb screw A easy way to pickup a speck of paste is to partially unfold a paper clip and use the end of the wire to acquire a tiny bit of paste A toothpick will also work Threads wil M provide An amount that covers the end of the wire is sufficient electrical contact Apply paste to second thread from end of thumbscrew The small enclosed vial contains a tiny amount 25 of silver conductive paste A small speck of this paste will improve the conductivity between the battery cover plate thumbscrew and the case of the SM is not necessary to spread the paste more than a little bit on the thread as the paste will spread itself every time the thumbscrew is screwed in and out of the case The tiny vial is about during battery changes V nen tanang Do not apply the paste to any other surfaces The cover plate itself can be cleaned with a clean cloth rubbing l the slightly raised rings on the plate where it contacts the battery terminal All you want to do is to remove any oils or dirt on the rings Do not abrade these surfaces with a harsh material such as a pencil eraser emery paper etc as this will remove the conductive nickel plating and expose the underlying aluminum which is a poor contac
38. itter antenna broken or missing Operating range too great Signal interference Turn off transmitter If receiver s signal strength indicator does not drop to nearly zero this indicates an interfering signal may be the problem Try a different operating frequency Loc APPEARS IN DISPLAY WHEN ANY BUTTON IS PRESSED 1 Control Panel is locked See Operating Instructions Locking and Unlocking the Control Panel Hold APPEARS IN DISPLAY WHEN ARROW BUTTONS ARE PRESSED APPEARS IN DISPLAY 1 Reminder that it is necessary to hold down the AUDIO or FREQ button to make adjustments to the audio gain or frequency settings Indication that the PLL is not locked This is a serious condition that requires factory repair It may be possible to operate on another frequency far removed from the one that was selected when the condition was indicated TRANSMITTER WON T RESPOND TO REMOTE CONTROL RM Troubleshooting 1 If LCD blinks rc OFF transmitter has not been configured to respond to the remote control See Remote Control Operation on page 7 for instructions on how to configure If LCD blinks transmitter is already set as requested by the remote control transmitter does not respond at all try moving the remote control closer to the microphone or increasing the remote control s loudness setting or increasing the audio level on the transmitter Make sure volume of RM
39. kohms Fig 4 2 VOLT NEGATIVE BIAS 2 WIRE ELECTRET 2 7k PIN Compatible wiring for microphones such as negative bias TRAM models NOTE The resistor value can range from 2k to 4k ohms Fig 5 4 VOLT POSITIVE BIAS 3 WIRE ELECTRET WITH EXTERNAL RESISTOR SHIELD Used for 3 wire lavaliere microphones that require an external resistor such as the SOURCE AUDIO Sanken COS 11 This wiring is fully compatible with 5 pin inputs on Lectrosonics transmitters such as the LM and UM Series This is the wiring for the Lectrosonics M152 lavaliere microphone Fig 6 LO Z MICROPHONE LEVEL SIGNALS 7 SHIELD XLR JACK _ For low impedance dynamic mics or electret mics with internal battery or power supply 5 Insert 1k resistor in series with pin 3 if attenuation is needed 14 Fig 7 BALANCED AND FLOATING LINE LEVEL SIGNALS SHIELD XLR JACK NOTE If the output is balanced but center tapped to ground such as on all Lectrosonics receivers do not connect Pin 3 of the XLR jack to Pin 4 of the TA5F connector Fig 8 UNBALANCED LINE LEVEL SIGNALS SLEEVE SHIELD LINE LEVEL RCA or 1 4 PLUG For signal levels up to 3V 12 dBu before limiting Fully compatible with 5 pin inputs on other Lectrosonics transmitters such as the LM and UM Series A 20k ohm resistor can be inserted in series with Pin 5 for an additional 20 dB of attenuation to handle up to 30V 32 dBu Simple Wiring Gan
40. laced and the previous settings will be enabled Frequency Blocks Lectrosonics established a block numbering system years ago to organize the range of frequencies avail able from the low end at 470 MHz band to the upper end at 952 MHz Each block except 944 includes 256 frequencies in 100 kHz steps which is the maximum switching range of the transmitters Block 944 is a spe cial band between 944 and 952 MHz Circulator Isolator The RF output circuit includes a one way circulator iso lator using a magnetically polarized ferrite This device greatly reduces RF intermodulation produced when multiple transmitters are used in close proximity to one another several feet apart The isolator also provides additional RF output stage protection against static shock SMV Series Controls and Functions Modulation LEDs Battery LCD Compartment Cover Plate UP Arrow Antenna Jack Audio A Battery __ Input Jack Compartment Thumb Screw DOWN Arrow PWR LED LCD Screen The LCD is a numeric type Liquid Crystal Display with screens for adjusting power frequency audio level and low frequency audio roll off The transmitter can be powered up with or without the RF output turned on A countdown appears in the LCD when powering on and off allowing the transmitter to be turned on without RF for adjustments and to prevent accidentally turning it off with momentary button presses
41. le observing the LEDs It is desirable to to set the gain so that some limiting occurs on louder peaks The limiter is very transparent and its effect is not audible until the system is close to overload In other words don t be shy about turning up the gain LECTROSONICS INC is actually a good idea to turn the gain up to maxi mum and listen for distortion or compression to get a feel for how much headroom is available Signal Level 20 LED 10 LED Less than 20 dB Off Off 20 dB to 10 dB Green Off 10 dB to 0 dB Green Green 0 dB to 10 dB Red Green Greater than 10 db Red Red Note Different voices will usually require different gain set tings so check this adjustment as each new person uses the system If several different people will be using the transmitter and there is not time to make the adjustment for each indi vidual adjust it for the loudest voice 1 With the transmitter powered off plug in the mi crophone and make sure the connector is firmly seated Warning If the systems 15 powered up while connected to a live sound system be careful to turn the sound system level down first or severe feedback can occur 2 Place the transmitter in Standby Mode or turn it on for normal use 3 Position the microphone in the location where it will be used in actual operation 4 Observe the Modulation LEDs while speaking or singing into the microphone at the same voice level that
42. levels The input circuitry includes a wide range DSP controlled limiter to prevent distortion at high input levels It is important to set the gain audio level high enough to achieve full modulation during louder peaks in the audio The limiter can handle over 30 dB of level above full modulation so with an optimum setting the LEDs will flash red during use If the LEDs never flash red the gain is too low In the table below 0 dB indicates full modulation Signal Level 20 LED 10 LED Less than 20 dB Off 20 dB to 10 dB Green Off 10 dB to 0 dB Green Green 0 dB to 10 dB Red Green Greater than 10 db Red Red AUDIO Button The AUDIO button is used to display the audio level and low frequency roll off settings The UP and DOWN ar rows adjust the values The AUDIO button is also used with the FREQ button to enter standby mode and to power the transmitter on or off FREQ Button The FREQ Buiton displays the selected operating frequency and toggles the LCD between displaying the actual operating frequency in MHz and a two digit hexadecimal number that corresponds to the equivalent Lectrosonics Frequency Switch Setting Up Down Arrows The Up and Down arrow buttons are used to select the values on the various setup screens and to lock out the control panel Antenna The transmitter uses a whip antenna with a flexible wo ven galvanized steel mesh cable and a standard SMA connector
43. on in 400 Series Mode 0 002 75 kHz max in 400 Series Mode 60 dB below carrier 125 dBV A weighted 0 5 mV to 50 mV before limiting Greater than 1 V with limiting 1 7 uA to 170 uA before limiting Greater than 5000 uA 5 mA with limiting 17 mV to 1 7 V before limiting Greater than 50 V with limiting 300 Ohms Input is virtual ground with servo adjusted constant current bias 2 7 k Ohms DSP Controlled Soft limiter 30 dB range Fixed 5 V at up to 5 mA Selectable 2 V or 4 V servo bias for any electret lavaliere 44 dB panel mounted membrane switches Dual bicolor LEDs indicate modulation of 20 10 0 10 dB referenced to full modulation Control panel with LCD and four membrane Low frequency roll off Adjustable from 35 to 150 Hz ic in 011 0 Audio Frequency Response 35 Hz to 20 kHz 1 dB The low frequency roll off is adjustable see graph above Signal to Noise Ratio dB SmartNR No Limiting w Limiting overall system 400 Series mode oer 103 5 108 0 Note the dual envelope soft NORMAL 107 0 111 5 limiter provides exceptionally l good handling of transients FULL 108 518 using variable attack and release time constants The gradual onset of limiting in the design begins below full modulation which reduces the measured figure for SNR without limiting by 4 5 dB Total Harmonic Distortion Audio Input Jack Antenna Flexible unbreakable steel cable Batteri
44. ophone The longest usable range is about 6 feet but the distance varies depending on the microphone transmitter gain and the tone loudness setting 7 1 ee Gs nadn EKANA gt OLEMI Shek 75711 Ta ei ee A single AA Lithium battery will operate the RM for up to several years Unscrew the knurled knob for access to the battery compartment LECTROSONICS INC Super Minature Belt Pack Transmitter Operating Notes The sensitivity to the remote control varies with the transmitters audio level setting and the microphone used but it is always possible to make it work with a sufficiently loud remote signal at close range e lf the transmitter is configured to respond to the remote control it will do so even if the buttons are locked e When the transmitter is asleep it can only be awak ened by the remote control or by removing and reinserting the battery e When the transmitter is asleep the PWR led blinks green every few seconds The RM should be held close enough to the microphone to Taremoleconmmand centinatwouldiesuicin change the settings on the intended transmitter and not be loud enough to affect other transmitters nearby the same display being shown again on the trans mitter for example tuning to the channel already displayed a row of dashes is displayed briefly as a signal that
45. re simplifies the attachment and removal of the microphone to assure the sleeve is seated securely Align the pins on the plug and jack and insert the con nector Pinch and squeeze the sleeve on this end to work it down over the flange Release button If the sleeve is pulled down and covering the connector squeeze the end of the sleeve so you can feel the connector inside and press it into the jack until it latches Pinch and squeeze the sleeve near the flange and work it down with a kneading motion over the flange all the way around until it stays in place flush with the housing Pull on the connector to make sure it is firmly latched To remove the connec _ tor pull the sleeve back to expose the black release button Press the button to unlatch the plug SMV Series Hold the UP arrow in while powering up the unit to enter the setup screen Press the AUDIO button repeatedly to step through the setup items to reach the backlight settings screen Use the UP or DOWN arrow button to select the desired setting z The count will progress from 1 M through 3 and the unit will then power up with the RF output turned on During this turn on sequence the modulation and power LEDs all glow red then Operating Instructions Power Up and Boot Sequence 1 Ensure that good batteries are installed in the unit 2 Simultaneously press and hold the AUDIO an
46. rom microphone cable 2 Slide Rubber Boot onto microphone cable with the large end facing away from the microphone See illus tration above 3 If necessary slide the 1 8 inch black shrink tubing onto the mircrophone cable This tubing is needed for some cables to ensure the cable fits snugly in the rubber boot 4 Use the resistors and connector included with this kit to configure the TA5F to your particular microphone See Wiring Diagrams below A length of 065 OD clear tubing is included if insulating the resistor leads or shield wire is necessary Remove rubber strain relief from connector backshell by pulling it out of the backshell 5 Slide the Strain Relief over the TA5F Insert and crimp as shown to the right Then insert the TA5F Insert and Strain Relief in the TA5F Latchlock Screw the TA5F Flex Relief onto the TA5F Latchlock 6 If needed position and shrink the 1 8 inch shrink tub ing on the microphone cable then slide the Rubber Boot down over the TA5F connector SMKITTAS5 Connector kit for SMV series transmitters 5 pin TA5F plug with sleeve Strain Relief Insulator Insert 5 pee pe Backshell Strain Relief removed Line Level Signals The normal hookup for line level signals is Signal Hot to pin 5 Signal Gnd to pin 1 and pin 4 jumped to pin 1 This allows signal levels up to 3V RMS to be applied without limiting If more headroom is needed insert
47. t conductor With improved conductivity lower resistance more of the battery voltage can get to the internal power sup plies causing reduced current drain and longer battery life Though the amount seems very small it is enough for years of use It is in fact 25 times the amount that we use on the thumbscrews at the factory To apply the silver paste first completely remove the cover plate from the SM housing by backing the thumb screw completely out of the case Use a clean soft cloth to clean the threads of the thumbscrew NOTE Do NOT use alcohol or a liquid cleaner Rio Rancho 15 SMV Series RM Remote Control The RM unit gives you remote control of select Lectro sonics transmitters using an audible tone delivered to the microphone Simply set the desired value or mode on the LCD then press the send button to set the trans mitter to the same setting or mode ETD LECTROSONICS lt lt 1 RM 1408 28 3 PWR 97 OCK 3 FREQ 3 LOUD Only the specific function displayed is altered For ex ample if the remote control is on the Aud audio level gain screen pressing the send button will set the gain on the transmitter but will not affect any other setting Speaker Send Button When the transmitter is in the power saving sleep mode it uses only 20 of the normal battery drain so battery life with be 5 times longer This is especially useful
48. the AUDIO and FREQ but tons to exit this mode and turn off the power Audio Screen The Audio screen is used to C adjust input gain from 0 to 44 dB and the low frequency roll off from 35 to 150 Hz L Repeatedly pressing the AUDIO button toggles back and forth between the two displays Press and hold the AUDIO button and use the Up and Down arrows to make adjustments Frequency Screen The Frequency Screen displays the operating frequency in MHz orasa two digit hexadecimal number that corresponds to the equivalent Lectrosonics Frequency Switch Setting Repeatedly pressing the FREQ button toggles between the two displays Press and hold the FREQ button and use the Up and Down arrows to select the frequency L U Lock Unlock Screen Simultaneously pressing and holding both the Up and Down arrow buttons during normal operation starts the Lock timer The timer starts i three and counts down to zero When the timer reaches zero the transmitter s controls are locked With the controls locked the AUDIO and FREQ buttons can still be used to display current settings Any attempt to change a setting by pressing either the Up or Down arrow button will result in an on screen Loc reminder that the controls are locked Remove the batteries to unlock the control panel Important Once the transmitter is lock
49. the au dio The actual roll off frequency will vary slightly depend ing upon the low frequency response of the microphone Excessive low frequency content can drive the transmit ter into limiting or in the case of high level sound sys tems can even cause damage to loudspeaker systems The roll off is normally adjusted by ear while listening as the system is operating Input Limiter A DSP controlled analog audio limiter is employed be fore the A D converter The limiter has a range of more than 30 dB for excellent overload protection A dual re lease envelope makes the limiter acoustically transpar ent while maintaining low distortion It can be thought of as two limiters in series a fast attack and release limiter followed by a slow attack and release limiter The limiter recovers quickly from brief transients with no audible side effects and also recovers slowly from sustained dor and its artifacts high levels to keep audio distortion low while preserving short term dynamics Bias Voltage OV 2V or 4V Servo Bias Supply 5V Regulator 6V Mic Jack l A D D A ncode e Audio Converter Converter Audio and Pilot Tone 4 Filter 5 lt 0 11001001 11001001 evel Switching Power Variable 1 8 4v Suppl Digital Signal Processor Shunt a Limiter lt Switching Power 3 2 1 5V supply 1 8v LCD Audio Switch 7 E3 E
50. will be used during operation While holding the AUDIO button press the UP or DOWN arrow buttons until the both the 20 and 10 LEDs glow green with the 20 LED occasionally flickering red This will maximize the signal to noise ratio of the system with full modulation and provide subtle limit ing to prevent overload and audible compression 5 If the unit was set up in Standby Mode it will be necessary to turn the transmitter off then power it up again in normal operation so the RF output will be on Then the other components in the sound or recording system can be adjusted Locking or Unlocking the Controls The Lock mode protects the transmitter from accidental changes to its settings Control Panel Locked Simultaneously press both the Up and Down arrow buttons to start the countdown timer When the timer reaches zero Loc is displayed and the controls are locked Settings can be reviewed but not changed Once the transmitter is locked it cannot be unlocked or powered off using the buttons The only ways to unlock a locked transmitter are to remove the battery or unlock it using the remote control The remote control will work only if the transmitter was previously configured to respond to the remote control The unit will always power up in unlocked mode Rio Rancho Super Minature Belt Pack Transmitter 5 Pin Input Jack Wiring The wiring diagrams included in this section represent th
Download Pdf Manuals
Related Search