Home
configuration guide
Contents
1. LINK L600N Dual Band Wireless Router User Manual L600N Dual Band Wireless Router EE CONTENTS INTRODUCTION os seicspics coctesedeses cece vareredssscececncesicswasiasercenssexssevecnasugeaccenstace 4 PRODUCT OVERVIEW sesccccsssesececcenscnevocesscuce anapara aaia 5 Packa nE C ONT M ae nE E Ei A E i 5 LED INAC OT gospa e E E E A 6 Back Panel Indicator esssnssssssseesesesssenssseseseesssrsssreessrsesreessressreesseeesseeese 7 Side PanelindicatOr sssrensessranaicniceis rionn aeneoceeeans 8 Quick Setup Guide esseeseeseecsecossoossossossoeeseesseeseeoeeoseooseessoesoessesoesseesseeee 9 COOGEE GUE a EA 9 Wireless Connecting Guide ssssssesssesseresesssreeseseresesrerseseereseeressereesee 13 Configuration Guide ssssssossoeesesseeseeeseeseecseosecossooscossoeoeesseeseeoseoseosseeee 16 Web Management Guide cccssssccecesessssecesessseceecseeeceecesseeeeeeeseess 16 RUNNIN ITUS a E 17 POULO CICUS ane E E E 18 cent O Teea tanec ese shes seacetsseeecoaspeetebesce cacce ace 22 Network Setup scsccccsstasnsscnsandesateanansaneennietoasts lt outsasoasesasansdeantiavehdassussbdeutass 23 LAN Interlace Setan teas eaeannoons 24 WAN Interface Setup ccccssssssssescesssnenecessssseesessssseesescesseneeseess 26 Wireles e SETUD essai caeapaae ute veasaoeeanductonsaeseaivensononeaneasudsnaesansieudeamnaeeriecaniaers 27 See SS UO e E E EEE E E E E E 28 Guest Network esssssessssssesssess
2. Add Edit Delete Apply Cancel L600N Dual Band Wireless Router I CONFIGURATION GUIDE Network Setup LAN Interface Setup 1 LAN Interface Setup Setting up your internal network environment Network Setup e LAN TCP IP Setup LAN Interface Setup WAN Interface Setup e IP Address Set the IP address that an LAN user uses to access the router The default IP is 192 168 1 1 You can change it if WS ce LAN Interface Settings e IP Subnet Mask Subnet mask of the LAN port You can enter a WAN Interface Settings different subnet mask according to the actual network status Does your Internet Connection Require ALogin dyes No P RIP Direction The modes in which the router sends and Account Name If Required Internet IP Address receives RIP packets Get Dynamically From ISP iine ciiin i e Recommend settin g Both IP Address LALALA e RIP supports Small to Mid size Network Environment IP Subnet Mask C JE IE IE eae Sc If no special requirement please keep default setting Domain Name Server DNS Address e RIP Version The format of the RIP packets and broadcast Get Automatically From ISP Use These DNS Servers mode that the router sends them Primary DNS e Use Router as DHCP Server The router serves as the DHCP server and automatically assigns IP addresses for all connected clients L600N Dual Band Wireless Router I CONFIGURATION GUIDE Net
3. Max of rules 32 Server Name Start Port End Port Server IP Address including the service name start port end port and server IP address Add Custom Serice e Add Custom Service If the list does not contain your desired service click the button to add a service Ports Custom Service Service Name Protocol Starting Port Ending Port Server IP Address Cancel L600N Dual Band Wireless Router I CONFIGURATION GUIDE Forwarding Port Triggering Port Triggering Cl Enable Port Triggering Port Triggering Timeout in minutes 20 Max of rules 32 Server Name Service Type Required Inbound Connection Service User Port Triggering Services Service Name Service User Service Type Triggering Starting Port Triggering Ending Port Required Inbound Connection Connection Type Starting Port 1 65535 Ending Port 1 65535 3 Port Triggering Port Triggering is similar to Port Forwarding but it can turn on off by the time you set which provides more security than port forwarding e Enable Port Triggering Enable or disable port triggering e Port Triggering Timeout in minutes Enter a value not greater than 9999 The timeout value controls the inactive timer at the specified ingress port Upon timeout of the inactive timer the ingress port is disabled e Service List Display the table of configured for Port Triggering services including the service name service user servic
4. TOUDI NOONE senssa EEE EEEE ESEE A EAA EA 64 L600N Dual Band Wireless Router ia INTRODUCTION Thank you for purchasing this Rosewill Networking product At Rosewill we believe that excellence is a standard Our customers deserve nothing less than the best By purchasing a Rosewill product you are choosing exceptional value unrivaled customer service and top quality hardware If you have any questions please feel free to contact us We d love to hear from you and thank you for your support Support techsupport rosewill com Call Center 800 575 9885 FAX 626 271 9504 L600N Dual Band Wireless Router ia PRODUCT OVERVIEW Package Content LEOON Dual Band Wireless N Router Power Adapter for L600N Quick Installation Guide Resource CD User Manual Quick Installation Guide Mounting Stand Note Make sure that the package contains the above items If any of the listed items are damaged or missing please contact with your distributor Using a power supply with a different voltage rating than the one included with the L600N will cause damage and void the warranty for this product L600N Dual Band Wireless Router 7 PRODUCT OVERVIEW LED Indicator Dual Band Wireless Router From Left to Right USB Indicates when a USB device is connected to the USB port on the right side of the Router The LED blinks rapidly when data is transmitted or received Power Indicates w
5. If you enable e mail notification you will receive log information in an e mail If you disable e mail notification you can view logs in the Logs page e SNTP you can set time information of your router It is strongly recommended to set the correct time on the router first This ensures proper functioning of log site blocking and schedule because their time settings are based on time information in this page L600N Dual Band Wireless Router I CONFIGURATION GUIDE System Tools e Schedules Here works the same as the Time of Day to Block you can set a schedule to specify the time and mode of restricting Internet access e Backup Setup Samba Server setup allows you set up to access the USB drive within the network e Set Password You can reset the password for the login It is recommended to set a high level security password write it down and keep it store safely e Reset to Factory Default You can reset the router to factory default e Router Upgrade Here you can update the firmware e Router Reboot Here you can reboot the wireless router L600N Dual Band Wireless Router ia PHYSICAL SPECIFICATION Chipset BCM5358U BCM43236 Flash SDRAM 8M 32M IEEE 802 3 u IEEE 802 11a b g n Standards UDP TCP IP PPPoE DHCP ICMP NAT SNTP ARP ALG 1x 10 100M WAN port Ports 4x 10 100M LAN ports USB PWR 2 4GHz WLAN WPS WAN Modem 4x LAN WPS 5GHz WLAN Safety amp Emiss
6. None you can Day L600N Dual Band Wireless Router I CONFIGURATION GUIDE Security Options Security Options Security options are provided with two main functions Remote Management and WAN Security Setup They are Security Options here because these two can affect or help your internet security Por Management WAN Security Setup from outside e Remote Management This function once enable will allow login from outside to your wireless router and is disable by Remote Management Hi WAN Security Setup default Because there are people might try to break in to your i a iene eee router if it is enabled It is best to turn remote management off era dasa lansasccil after use so the router cannot be controlled from outside Default DMZ Server 192 168 255 MTU Size 616 1500 bytes 1500 When enabling this function please make sure to the password NAT Filtering under System Tools Secured 3 Open e WAN Security Setup This setup here will allow you to configure features that helps your router from outside hack attempts L600N Dual Band Wireless Router I CONFIGURATION GUIDE Security Options Remote Management Turn Remote Management On Remote Management ddress http 0 0 0 0 8080 Port Number anap Allow Remote Access By Only This Computer IP Address Range Everyone Apply Cancel 1 Remote Management This function will allow login from outsi
7. WPA2 PSK Wireless Network V Enable Wireless Router Radio AES WPA PSK TKIP WPA2 PSK AES We V Enable SSID Broa TT recommend selecting WPA PSK TKIP WPA2 PSK Wireless Network Name RW 2 4G 001 AES unless otherwise desired Mode 802 11b a n v Channel Auto w Band Width 40M v Max Transmission Rate Auto w Mbps e Complete Setting Security Options Security Options None e Once finish setting click Apply to save and complete Apply Cancel your setting L600N Dual Band Wireless Router I CONFIGURATION GUIDE Wireless Setup Guest Network Guest Network Adapter 2465 Network Profiles Profile SSID Security Enable Guest Network Enable SSID Broadcast 1 RVV 2 46 002 None NO YES 2 RW 2 46 003 None NO YES 3 RW 2 46 004 None NO YES F 4 RW 2 46 005 None NO YES Wireless Settings Profile 1 Enable Guest Network V Enable SSID Broadcast Enable Wireless Isolation Guest Wireless Network Name SsiD RW 2 4G 002 Security Options Profile 1 security Options Mone Apply Cancel Guest Network Adapter 2 4G 5G Network Profiles A brief information status of your Guest Network Enable Guest Network Enable or disable Guest Network per Profile Enable SSID Broadcast Enable or disable SSID Broadcast per Profile If disable you will need to manually enter the SSID to connect Enable Wireless Isolation Enable or disable Wireless Isolation per Profile If enable the co
8. E e Enable IGMP Snooping IGMP Snooping is used to Multicast Control iii pone multicast management and control When the Ethernet switch of the second layer receives the IGMP packets transmitted between the host and AP IGMP Snooping will analyze the packets to establish and maintain the IGMP address table of the MAC multicast and then the IGMP SETUP routing multicast packets will be transmitted accordin Enable IGMP Snooping 8 p g C Enable IGMP Proxying to the address table of the MAC multicast e Enable IGMP Proxying allows an LAN PC to receive desired multicast traffic from the Internet You can disable the function if you do not need it L600N Dual Band Wireless Router I CONFIGURATION GUIDE Storage Setup Storage Setup This router offers USB storage function with built in Storage Setup FTP server and Samba Server without additional computer and software You will be able to access the USB storage device at home or away from home e FTP Setup Enable FTP Server setup which allows you set up to access the USB drive from outside e FTP Account You can setup FTP management here Fip Server Setting e USB Browse Browse and manage the files in the USB drive e Samba Setup Samba Server setup allows you set up to access the USB drive within the network L600N Dual Band Wireless Router I CONFIGURATION GUIDE Storage Setup FTP Server Setup 1 FTP Server Setup FTP s
9. L600N Dual Band Wireless Router I Quick SETUP GUIDE Connecting Guide 7 Setup Wizard Guide e Click on Setup Wizard e Select Yes then Next e L60ON will Auto Detect your Network and guide you through a step by step setting If your connection was not detected here you will need to setup manually under Network Setup s WAN Interface Setup on page 23 Setting up your internet 7 Yes No IWant To Configure The Router Myself Detecting Connection Type on Internet Port Please wait a moment L600N Dual Band Wireless Router I Quick SETUP GUIDE Connecting Guide Setup Wizard PPPoE detected Successfully detected the type of Internet connection you have Setup Wizard Dynamic IP DHCP detected Successfully detected the type of Internet connection you have Setup Wizard Static IP Fixed detected Successfully detected the type of Internet connection you have lf you believe you have received this message in error please power cycle your modem unplug the modem and plug it back in Then close this screen and reopen a new Web browser e g Internet Explorer Setup Wizard Guide Depending on your Internet Service Provider ISP Type you should see one of the 3 types being detected PPPoE PPPoE requires you having the User Name and Password provided by your ISP Normally happens when using DSL connection Dynamic IP DHCP DHCP does not require
10. Setup then select Yes for Does your Internet Connection Require A Login Then select PPPoE to enter the connection information provided by your ISP LAN Interface Setup WAN Interface Setup Problem The Setup Wizard does not detect or configure my network Solutions 1 Reset your modem and power off your L600N by unplug the power adapter then plug back in 2 Allow the wizard to detect your Internet connection one more time 3 Static IP You need to provide a fixed IP setting Please check with ISP for IP information 4 DSL Connection Your internet connection needs login information Please check with ISP if you do not have on hand 5 Cable Modem Connection Cable modem connection may require you to clone MAC address click WAN Interface Setup under Network Setup then under Router MAC Address select Use Computer MAC Address or manually enter the MAC address by selecting Use This MAC Address Problem My IP address show up as 169 254 x x and my computer tells me that I have Limited or no Connectivity Solutions Check if your computer is set as DHCP setting Restart you computer and try again If same thing occur please try using another computer or the wireless connection Problem am not getting maximum signal strength when right next to my router Solutions The client may be too close to the router You may want to step 5 10 feet away from the router You can also change the wireless channel to avoid wireless interf
11. address e Gateway IP Address IP address of the router or host to which packets are sent e Metric This represents the number of other routers on your network It ranges from 2 to 15 Usually the value of 2 or 3 leads to the best performance If the route is direction connection set the Metric to 2 L600N Dual Band Wireless Router I CONFIGURATION GUIDE E mail Setup E Mail Setup Email alerts and logs can set to mail your email address Alerts contains when someone in your Network tries to Eos n visit a blocked site while logs are the lists of all the URLs that this router have been visited e Turn E mail Notification On Enable or disable E mail notification E mail e Send Alerts and Logs Via E mail You will need to enter your e C Turn E mail Notification On _ mail server and e mail address here Send Alerts and Logs Via E mail Your Outgoing Mail Server e Your Mail Server requires authentication If your mail server send To This E mail Address fo Your E mail Address SE When Someone Attempts To VisitA Blocked Site Send Alert Immediately requires authentication Select this and enter the user name and the password of your E mail Your Mail Server requires authentication e Send Logs According to this Schedule You can Select a Password Sa Send Logs According to this Schedule always review the Logs in the Log page under System tools schedule from the drop down list When select
12. does not work on wireless guest Network Wireless Card Access Setup Available Wireless Cards Device Name Mac Address unknown 00 1D 0F 19 72 F0 Wireless Card Entry Max of terms 16 Device Name Mac Address L600N Dual Band Wireless Router I CONFIGURATION GUIDE Forwarding Forwarding This function allows you to tell the router that which Forwarding IP within your network can communicate with outside Network e UPnP Setup UPnP can allow your UPnP Enabled devices automatically discover the services from other registered UPnP devices on the network e Port Forwarding Port Forwarding will allow your router knowing what network data to the assigned port Or you can utilize the preloaded service such as FTP to your FTP server UPnP Port Triggering Port Triggering is similar to Port Forwarding but E Turn UPnP On it can turn on off by the time you set which provides more Broadcast Period in minutes 30 security than port forwarding Broadcast Time To Livetin hops 4 UPnP Portable Table Active Protocol Int Port Ext Port IP Address Description Apply Cancel Retresh L600N Dual Band Wireless Router I CONFIGURATION GUIDE Forwarding UPnP 1 UPnP Setup UPnP can allow your UPnP Enabled devices Forwarding automatically discover the services from other registered UPnP devices on the network e Turn UPnP On Enable or disable UPnP e Broadcast Pe
13. to use a DDNS service you need to register for it Use a Dynamic DNS Service enable disable Service Provider You can manually enter the Service provider s web address Please check with your Dynamic DNS provider Host Name This is for entering the host name that your Dynamic DNS provider give to you User Name This is for entering the user name that you registered with the Dynamic DNS provider Password This is for entering the password that your Dynamic DNS provider gives to you L600N Dual Band Wireless Router I CONFIGURATION GUIDE Static Route Static Routes Static Routes Max of rules 32 fas Active Name Destination Edit Delete Static Routes Active Route Name Destination IP Address IP Subnet Mask Gateway IP Address Metric Gateway Static Routes Static routing is a special type of routing that can be applied in a network to reduce the problem of routing selection and overload of data flow and improve the forwarding speed of packets You can set the destination IP address subnet mask and gateway to specify a routing rule The destination IP address and subnet mask are used to determine a destination network or host Then the router sends packets to the specified destination network or host through the gateway e Active Enable it to apply the routing rule e Router Name Enter the name of the static route e IP Subnet Mask Subnet mask of the destination IP
14. E Select this If your ISP provides dialup for user name and Secondary DNS ey ee password DSL connection usually falls under here Use Default Address e PPTP This is a method for implementing virtual private networks You Use Computer MAC Address Use This MAC Address o0 16 63 A0 66 20 will also need User Name and Password for this mode Most VPN connection falls here e L2TP This is a method for implementing virtual private networks You will also need User Name and Password for this mode Most VPN connection falls here L600N Dual Band Wireless Router I CONFIGURATION GUIDE Wireless Setup Wireless Setup e Adapter Region Ad WPS Setup Mode Channel Band Wid Enable Broadcom XPress Techn ology Wireless Advanced Settings Adapter Enable Broadcom ACS Enable Broadcom WMF Enable Broadcom PHY Watchdog Fragmentation Length 256 2346 CTSIRTS Threshold 1 2347 Security O Preamble Mode Wireless Setup You can set wireless configuration here Basic Setup You can set basic wireless configurations here Guest Network You can enable or disable the 4x Guest Network for 2 4GHz and 3x Guest Network for 5GHz here while setting encryption for each of the guest network WPS Setup You can use the WPS setup function to add a wireless client to a network without setting SSID security mode and password To use this function a wireless client must sup
15. ETUP GUIDE Wireless Connecting Guide Wireless Basic Settings Region Selection Adapter 24G v Region United States w Wireless Network J Enable Wireless Router Radio V Enable SSID Broadcast Enable Wireless Isolation Wireless Network Name RW 2 4G 001 Mode 802 11b a n v Channel Auto w Band Width 40M v Max Transmission Rate Auto w Mbps Security Options Security Options None Apply Cancel Security Options Security Options L60ON supports 4 wireless security encryption modes WEP WPA PSK TKIP WPA2 PSK AES WPA PSK TKIP WPA2 PSK AES We recommend selecting WPA PSK TKIP WPA2 PSK AES unless otherwise desired Complete Setting Once finish setting click Apply to save and complete your setting L600N Dual Band Wireless Router ia CONFIGURATION GUIDE Web Management Guide Web Management Detail 14 main functions on the left of the Web based utility Setup Wizard e Setup Wizard A step by step setup on L600N Running Status e Running Status Detail router status and client list i Network Setup e Network Setup Allows you to set up LAN WAN details i Wireless Setup e Wireless Setup Wireless Setup SSID WPS Guest Network and Advance management Forwarding e Forwarding UPnP Port Forwarding and Port Triggering a7 Access Control e Access Control Site Service Block Management QoS Setup Dynamic DNS e Dynamic DNS Outside DNS Management static Routes e St
16. Rule list Setup QoS rule applications online games Ethernet LAN ports and MAC Trust IP Control addresses to optimizes your network performance _ Enable Trusted IP Address bess a i e QoS Setup Click Add Priority Rule to add QoS policies Trusted IP Address e Qos Priority Rules Appl L O O PEY e QoS Policy For Enter the name of the QoS policy QoS Setup QoS Policy Priority Description Gaming Ethernet LAN Port and MAC Address e Priority Category You can select Applications On line Depending on which Category you select If you want to add Applications and On line Gaming You will need to QoS Priority Rules identify the Connection type and Specific Port Range for sl the router Specific information can be obtained from Qo5 Policy For Priority Category Applications the software providers Applications Add ANew Application Priority Specified Port Range Connection Type Starting Port 65535 Ending Port 65535 L600N Dual Band Wireless Router I CONFIGURATION GUIDE Dynamic DNS Dynamic DNS Dynamic DNS is a service linking with outside Dynamic DNS service provider to keep track of a web domain Dy ic DNS name or web address linked to the changing IP address that your ynamic Dynamic DNS E Use a Dynamic DNS Service Semice Provider dyndns org Host Name myhostname User Name User Fassword Apply Cancel ISP provides you If you want
17. a Sunday Monday week e Time of Day to Block This option allows you to set whole day Wednesday Thursday or start time to end time The time setup here applies to the one days you select above and can not define individually Saturday Time of day to Block use 24 hour clock All Day Start Blocking 00 Hour 00 Minute End Blocking 23 Hour 59 Minute Apply Cancel L600N Dual Band Wireless Router I CONFIGURATION GUIDE Access Control Block Sites Block Sites Keyword Blocking O Never Per Schedule Always Type Keyword or Domain Name Here Add Keyword Block Sites Containing these Keywords or Domain Names Max of terms 32 Delete Keyword Clear List_ _ Allow Trusted IP Address To Visit Blocked Sites Trusted IP Address Cancel 2 Block Sites Using keywords you can block with offended words or enter the website address you can block the site Keyword Blocking You can select Never Per Schedule or Always Type Keyword or Domain Name Here This function allows you to enter certain keywords and or Website address to block unwanted sites up to 32 terms Block Sites Containing these Keywords or Domain Names Here you can view your inputs Allow Trusted IP Address to Visit Blocked Sites Enable Disable Trusted IP Address You can enter 1 IP address as your trusted IP to visit without access control You can combine with LAN Interface Setup s A
18. ail router status on Summary System Information Connection status of the Internet port Modem port LAN Device Info l l o port and Wireless Port 2 4G and 5G and traffic statistics of each port Summary Internet Disconnected e Summary Information on L600N s connection Status Wireless 2 4GHz SSID RVV 2 4G 001 5GHz SSID RW 5G 001 e Internet Whether Connected Disconnected Client Devices Number of Device 1 e Wireless shows 2 4GHz s SSID name and 5GHz s SSID name Guest Network Status Disabled CAE e Client Devices how many client devices connected to L600N System Info Hardware Version v1 0 0 both wired and wireless Firmware Version 1 0 0 Product Name L600N e Guest Network Ti d Dat 2012 01 01 08 36 44 sbha Status Whether Enabled Disabled e Guest Network enabled how many Guest Network has been enabled e System Info Information on Hardware version Firmware version model name and system time L600N Dual Band Wireless Router I CONFIGURATION GUIDE Running Status Router Status Internet Port Internet Port MAC Address Internet Access Mode IP address IP Subnet mask Default Gateway Domain Name Server LAN Port MAC Address IP Address IP Subnet Mask 00 11 22 EE 33 34 Disconnected DHCP 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 00 11 22 EE 33 33 192 168 1 1 255 255 255 0 MAC Address The physical address of the router as seen from the Interne
19. atic Routes Setup Routing manually advanced information of network require E mail Setup e E Mail Setup E mail Notification Setup eee e Security Options Remote Management and WAN Security Firewall Multicast Control f a ia e Multicast Control Function supports for Layer 2 amp above switch Storage Setu J P e Storage Setup Allows managing USB drives and setup FTP Samba F system Tools e System Tools System related function setup e Logout Logout of the web management L600N Dual Band Wireless Router I CONFIGURATION GUIDE Running Status w Running Status Router Status Clients List Device Info Summary Internet Disconnected wa Clients List Wired Devices F IF Address MAC Address 1 192 168 1 2 PR an Wireless Devices Wireless intruders also show up here cos IP Address MAC Address Refresh Running Status You can review the device information and current clients list here Router Status Provides detail router status on Summary System Information Connection status of the Internet port Modem port LAN port and Wireless Port 2 4G and 5G and traffic statistics of each port Client list Displays information of computers connected to the router including the IP address the device name and the MAC address of each computer L600N Dual Band Wireless Router I CONFIGURATION GUIDE Running Status Router Status 1 Router Status Provides det
20. ation country Wireless Channel The current channel in use 802 11 Mode Indicates the current mode 802 11b 802 11 and 802 11b g n Wireless Radio Indicates if the access point feature of the router is enabled or not If not enabled the Wireless LED on the front panel is off Enable SSID Broadcast Indicates if the router is broadcasting its SSID Enable Wireless Isolation Indicates if wireless isolation is enabled Wi Fi Protected Setup Indicates if the router s wireless settings are configured Wireless Security Mode Indicates the Wireless Security Mode of your L600N s current setting L600N Dual Band Wireless Router I CONFIGURATION GUIDE Running Status Router Status Show Statistics Connection Status Statistic Information Port Status TxPkts RxPkts Collisions Tx Bls Rx Bis WAN NoLink 8 0 0 O48 0 LAN 1 Up 1242 1013 955954 125918 LAN 2 NoLink 132 0 20018 0 LAN 3 NoLink 132 0 20918 0 LAN 4 NoLink 132 0 20918 0 WLAN Auto 25 0 18087 0 System Up Time 00 57 53 Poll Interval 5 Jaam cae Set Interval Stop Connection Status IP Address 0 0 0 0 Subnet Mask 0 0 0 0 Default Gateway 0 0 0 0 DHCP Server 0 0 0 0 DNS Server 0 0 0 0 Lease Obtained 0Day 0Hour 0 Minute Lease Expires 0Day 0Hour 0 Minute Renew Close Window Statistic Information e Displays the performance statistics information of the router including the number of sent and re
21. ble Anonymous Ei Samba Setting Samba allows users to share file between windows host and the device via LAN connection Enable Samba Enable or disable the Samba server When the Samba server is enabled users can connect to your USB device to share files in the USB device Workgroup The workgroup the device belongs to Netbios Name Set the network name for the device Modify the password for user root Here is to set the password for Samba connection e New Password You can modify the root user s password here e Confirm Password Type in the password again to confirm the New Password e Enable USB Whether to allow USB storage e Enable Anonymous Whether to allow anonymous access If you chose this users do not need to enter a user name and password that can log into the samba server L600N Dual Band Wireless Router I CONFIGURATION GUIDE System Tools System Tools System tools provides with detail information on the System Tools router You can set password backup reset to factory default or Logs SNTP Schediles e Log Alog makes a detailed record of the Web sites that upgrade Firmware etc Backup Setup users on your network have accessed or attempted to Set Password Reset to Factory Default Router Upgrade Router Reboot someone on your network attempted to access a access If you have set content filtering on the Block Sites page records are made in the Logs page if blocked site
22. ceived packets at each port Connection Status e Displays the information of current connection on the router L600N Dual Band Wireless Router I CONFIGURATION GUIDE Running Status Client List 2 Client List This page displays information of computers connected to Clients List the router including the IP address the device name and the MAC Wired Devices IP Address MAC Address Device Name 1 192 168 1 2 Leah ete E ROSEWILL address of each computer Wireless Devices Wireless intruders also show up here F IF Address MAC Address Device Hame Refresh L600N Dual Band Wireless Router I CONFIGURATION GUIDE Network Setup Network Setup You can the Internal Network LAN and External Network Setup Network WAN settings LAN Interface Setup e LAN Interface Setup you can configure the IP address of the LAN port WAN Interface Setup according to the actual network environment WAN Interface Setup The router supports 5 modes of external LAN Interface Settings connection including Dynamic IP DHCP Static IP Fixed PPPoE LAN TCP IP Setup ae PPTP and L2TP You may need to confirm with your ISP before ress IP Subnet Mask 5 255 255 selecting your connecting modes RIP Direction RIP Version Use Router as DHCP Server Starting IP Address Ending IP Address DHCP Lease Timef 1 160 hours Address Reservation F IP Address Device Name MAC Address
23. ddress Reservation under Network Setup to fix the IP with the MAC address of your trusted Computer L600N Dual Band Wireless Router I CONFIGURATION GUIDE Access Control Block Services Block Services Services Blocking Never Per Schedule Always Block Service Rules Table Max of rules 32 Service Name Block Services Setup Service Type User Defined ka Protocol TCP ka Starting Port 165535 Ending Port 165535 Service Type User Defined fe Filter Service For only This IP Address 192 aca 1 I OIP Address Range 192 aes 1 I ta 192 168 ha AIF Address Cancel 3 Block Service Allows you to block certain Internet service by specific users on your local network based on their IP address Service Blocking You can select Never Per Schedule or Always Block Service Rules Table This table allows you to add the networking service type to block while able to control IP range in the blocking selection e Service Type Select a service type from the drop down list For services that exist in the drop down list the corresponding information is already preset If your desired type is not here select User defined You need to select the protocol enter the service name and specify the port range e Protocol The protocol that is used at service ports You can select TCP UDP TCP or UDP e Starting Port Ending Port You can enter the starti
24. de to your wireless router and is disable by default It is best to turn remote management off after use for safety e Turn Remote Management On Enable Disable e Remote Management Address The whole displayed address is what you need when access from outside e Port Number It is best to use 8080 unless under a complex network environment You may want to check with your network administrator Allow Remote Access By Set the computer which can remotely access the router e Only This Computer Only the specified IP address can access the router e IP Address Range A range of IP addresses on the Internet can access the router e Everyone Everyone on the Internet can access the router L600N Dual Band Wireless Router I CONFIGURATION GUIDE Security Options WAN Security Setup El Disable Port Scan and DOS Protection Respond to Ping on Internet Port A oo ore 168 255 Default DMZ Server 192 MTU Size 616 1500 bytes 1500 NAT Filtering Secured Open W Enable SIP ALG Enable L2TP ALG Enable PPTP ALG Enable IPSEC ALG E Enable IPv Pass Through Apply Cancel 2 WAN Security Setup This setup here will allow you to configure features that helps your router from outside hack attempts e Disable Port Scan and DoS Protection This function protects your LAN against DoS attack Do not disable this firewall function unless a special situation occurs e Respond to Ping on Interne
25. e type Triggering starting port triggering ending port connection type start port and end port L600N Dual Band Wireless Router I CONFIGURATION GUIDE Access Control Access Control This function allows you to tell the router that Access Control which IP within your network can communicate with outside Time of day to Block Network Block Sites Pecse poses e Time of day to Block You can manage your L600N s access QoS Setup schedule weekly or by selecting time everyday e Block Sites You can select key word or whole website address Schedule to block j Block Sites e Block Services You can select varies internet service to block d Keyword Blocking QoS Setup QoS Bandwidth Management allows you to set Ond Block Services y pd priorities in internet access depending on the programs Services QOS setup 1 QoS Control Enable WMM Wi Fi multi media Settings J Turn Internet Qos Access On Wax of ru Turn Bandwidth Control On Uplink bandwidth maximum 100 sd SN QoS Priority Rule list JU Trust IP Control L600N Dual Band Wireless Router I CONFIGURATION GUIDE Access Control Time of Day to Block 1 Time of day to Block You can tell L60ON which day and what time to block different access in combination use with Block Sites Schedule EAN and Block Services Days to Block Wl Every Day e Days to Block You can select one day or multiple days in
26. entering anything Usually happens when getting connection from an existing internet Connection Static IP Fixed Fixed requires you entering a set IP address Subnet Mask Gateway IP Address Primary DNS and or Secondary DNS These information will provided by your ISP and normally happens when using Cable connection Once complete the setting of this step your L600N should be ready to connect to the internet via wired connection L600N Dual Band Wireless Router I Quick SETUP GUIDE Wireless Connecting Guide 1 Wireless Setup Wireless Setup e Click on Wireless Setup then Basic Setup e At Wireless Basic Settings you can select below as you desired e Adapter 2 4G 5G e Region Default is United States but you can adjust the Region based on your location Wireless Basic Settings F 2 Wireless Network Region Selection docs a e Enable Wireless Router Radio This is turning on off the Region United States v Wireless Network wireless si gna V Enable Wireless Router Radio ie aie e Enable SSID Broadcast This is to make your SSID invisible Enable Wireless Isolation i i Once uncheck this You will need to enter your SSID manually Wireless Network Name RW 2 4G 001 ast when connecting to your Wireless Signal Channel Auto w Band Width 40M v e Enable Wireless isolation This setting is to turn off the Max Transmission Rate Auto w Mbps Security Options co
27. erence Recommended channels use are 1 6 and 11 Congratulations L60ON is now successfully configured and your settings are now saved You may now connect other devices directly to the 4 wired ports on the back panel or connect wirelessly to L600N If you have question Please feel free to contact us Support techsupport rosewill com Call Center 800 575 9885
28. erver is disabled by default If you have Ftp Server Setting USB drive connect to the router you can enable Once enabled L Enable FTP Server users can connect to your USB storage devices This requires the FIP Server Port users with an account name and password as well as Submit Refresh permissions such as upload download and other privileges e Enable FTP Server Enable Disable e FTP Server Port Set the listening port for the server The default listening port is 21 L600N Dual Band Wireless Router I CONFIGURATION GUIDE Storage Setup FTP Server Account Manager FTP Server Account Manager User Name Password Rights view Upload E Download Account Table Rights Password Operation View Upload Download FTP Server Account Manager You will need to create an account with password and access rights before users want to connect to your FTP server In this page you can add delete edit user accounts and give appropriate access to the users User Name Enter the desired user name for the user Password Enter the desired password for this user Rights Users can have rights of view download or upload privileges or a combination of all these permissions e View Users can view files in the USB storage device but they can not upload nor download files e Upload Users can upload files to the USB storage device but they can not download files Note The View right need to be e
29. hen the Router is powered on The LED will remain on 2 4 GHz Blinks rapidly when the wireless data traffic is transmitted or received over the 2 4GHz wireless network WPS Wi Fi Protected Setup activity When the WPS mode is activated the WPS LED blinks as it awaits a connection Modem Indicates when modem is connected to the modem port on the back of the Router The LED blinks rapidly when data is transmitted or received LAN Indicates when a networking device is connected to a wired port on the back of the Router The LED blinks rapidly when wired data traffic is transmitted or received 5GHz Blinks rapidly when wireless data traffic is transmitted or received over the 5GHz wireless network L600N Dual Band Wireless Router ia PRODUCT OVERVIEW Back Panel Indicator From Left to Right RESET Push once to reboot the Router Hold down for 5 10 seconds to reset the Router back to factory settings POWER ON OFF Push to Power on or off the Router 12V 1A Power Adapter port Output 12V 1A Input 100 240v Modem RJ 45 port for connecting to your Broadband Modem LAN RJ 45 ports for connecting to wired computers or other network devices LAN 1 4 from left to right WPS Push and hold for 3 seconds to enable WPS push button configuration L600N Dual Band Wireless Router 7 PRODUCT OVERVIEW Side Panel Indicator e WiFi ON OFF Push to turn ON OFF of the WiFi Signal ddddde e USB I
30. ion Selection Adapter 246 v Region United States w Wireless Network V Enable Wireless Router Radio V Enable SSID Broadcast Enable Wireless Isolation Wireless Network Name RW 2 4G 001 Mode 802 11b a n v Channel Auto w Band Width 40M v Max Transmission Rate Auto Mbps Security Options Security Options None Apply Cancel e Wireless Network Wireless Network Name This is SSID You can set this to your desired name Mode e 2 4G supports the following mode 802 11b 802 11b g 802 11b g n e 5G supports the following mode 802 11a 802 11a n e To fully utilize your L600ON we suggest 2 4G with 802 11b g n 5G with 802 11a n Channel Set Auto if you are not sure what is the best channel to avoid neighbors signal interference System will pick for you Bandwidth e For 20M the maximum rate is 130 Mbps 150 Mbps in short preamble e For 40M bandwidth the maximum rate is 270 Mbps 300 Mbps in short preamble Max Transmission Rate Select one from the drop down list that displays all rates that the system supports Or set at Auto for system to adjust the best transmitting rates for you L600N Dual Band Wireless Router I CONFIGURATION GUIDE Wireless Setup Basic Setup Wireless Basic Settings e Security Options Region Selection e Security Options L600N supports 4 wireless security Adapter 246 7 Region United States v encryption modes WEP WPA PSK TKIP
31. ions FCC CE L600N Dual Band Wireless Router ia PHYSICAL SPECIFICATION Frequency Band 2 4GHz 5GHz Radio Data Rate 300 300 mbps Modulation Support 256 64 16 8 QAM QPSK BPSK MCSO MCS15 Security 64 128 bits WEP WPA PSK TKIP and WPA2 PSK AES wireless encryption Antenna Gain 2x 5dBi Dual Band Antennas SMA Connectors Environmental and Physical Operating 0C 40C 32 F 104 F Temperature Storage 40 C 70 C 40 F 158 F Operating 10 90 RH Non condensing Humidity Storage 5 90 RH Non condensing Weight amp Dimension 6 5 x 4 72 x 1 18 in 16 5 x 12 x 3 cm 0 57 Ibs 250g L600N Dual Band Wireless Router i TROUBLESHOOTING Problem follow the steps but am not able to open router s web management page after type in 192 168 1 1 on my web browser Solutions 1 Check if your computer connected to L600N has being set as a Fixed IP You may want to change to DHCP setting e WIN7 Vista all Wireless Network Connection 9 Status Internet Protocol Version 4 TCP IPv4 Properties General Networking General Alternate Configuration Connection Connect using Yo t IP settings assigned automatically if your network supports RET th lity Otherwise you need to ask your network administrator i ar 1 1 a 7 p r s IPv4 Connectivity Internet e 202 11n USB Wireless LAN Card 2 Fa 4 Ea ag Sr IPve Connectivity No Internet access Media State Enab
32. led Configure SSID Rosewill Gateway1 2 This connection uses the following items Mra 04 13 38 OM Client for Microsoft Networks speed 300 0 Mbps 5 Packet Scheduler Signal Quality alll H Printer Sharing for Microsoft Networks met Protocol Version 6 TCP IPvS pean 4 Activity Obtain an IP address automatically Use the following IP address Obtain DNS server address automatically Sent A Rerived 6 Use the following DNS server addresses B 12 507 290 60 380 013 decane 1 Description Transmission Control Protocol Intemet Protocol The default f Properties H Disable Diagnose wide area network protocol that provides communication i i i i Validate settings upon exit across diverse interconnected networks alidate settings upon exi Advanced Cancel 2 Check if your computer is connecting to any wireless wired network other than L600N Network Setup 3 You may have a IP conflict on your modem and the router Please go to LAN Interface Setup and change the IP Address to 192 168 x 1 x can be any number from 2 to 255 then click LAN Interface Settings LAN TCP IP Setup Apply IP Address L600N Dual Band Wireless Router i TROUBLESHOOTING Problem My DSL connection is working but I can not access the internet with L600N Solutions Your Internet Service Provider ISP may require the entering of Login and password To enter please Network Setup click WAN Interface Setup under Network
33. less Router I CONFIGURATION GUIDE Wireless Setup Advanced Setup Wireless Advanced Settings Adapter C Enable Broadcom ACS Enable Broadcom WMF Enable Broadcom XPress Techn ology Enable Broadcom PHY Watchdog Fragmentation Length 256 2346 CTSIRTS Threshold 1 2347 Preamble Mode shorntPreamble Transmit Power Control Wireless Card Access List 4 Wireless Advanced Settings Wireless Advanced Settings allows you to set advanced wireless configuration If you are not sure what they are please keep default settings e Adapter 2 4G 5G e Enable Broadcom ACS Broadcom ACS will allow the best bandwidth and channel can be selected dynamically e Enable Broadcom WMF When Broadcom WMF is enabled better wireless multicast can be provided This feature is enable by default e Enable Broadcom XPress Technology This enables the Broadcom STA connection to have better wireless performance The function is disabled by default e Enable Broadcom PHY Watchdog If the function is enabled calibration is performed periodically to make parameters such as the output power more precise e Fragmentation Length 256 2346 This is to set the transferred packet size If the length was set too small your network may be overloaded Default at 2346 L600N Dual Band Wireless Router I CONFIGURATION GUIDE Wireless Setup Advanced Setup 4 Wireless Advanced Settings Wireless Advanced Settings all
34. mmunication among different clients but they can still Security Options None access Internet Apply Cancel L600N Dual Band Wireless Router I Quick SETUP GUIDE Wireless Connecting Guide Wireless Basic Settings Region Selection Adapter 246 v Region United States w Wireless Network J Enable Wireless Router Radio V Enable SSID Broadcast Enable Wireless Isolation Wireless Network Name RW 2 4G 001 Mode 802 11b a n v Channel Auto w Band Width 40M v Max Transmission Rate Auto w Mbps Security Options Security Options None Apply Cancel Wireless Network Wireless Network Name This is SSID You can set this to your desired name Mode e 2 4G supports the following mode 802 11b 802 11b g 802 11b g n e 5G supports the following mode 802 11a 802 11a n e To fully utilize your LEOON we suggest 2 4G with 802 11b g n 5G with 802 11a n Channel Set Auto if you are not sure what is the best channel to avoid neighbors signal interference System will pick for you Bandwidth e For 20M the maximum rate is 130 Mbps 150 Mbps in short preamble e For 40M bandwidth the maximum rate is 270 Mbps 300 Mbps in short preamble Max Transmission Rate Select one from the drop down list that displays all rates that the system supports Or set at Auto for system to adjust the best transmitting rates for you L600N Dual Band Wireless Router I Quick S
35. nable at the same time e Download Users can download files from the USB storage device but they can not upload files to the storage device Note The View right need to be enable at the same time L600N Dual Band Wireless Router I CONFIGURATION GUIDE Storage Setup USB Browse USB File Browse Current Directory l File Name File Permissions File Size Unmount USB File Browse Current Directory usb1_1 File Name File Permissions File Size drwxrwxrwt 60 dcim Crwxrwxrwx 32768 misc Crwxrwxrwx 32768 private CnAxrwxrnwx 32768 Operation Operation del at del Create Folder Browse Add File USB Browse You can browse and manage the files in USB disk Once the USB disk is insert you will be able to see the content here You can click the del button to delete the corresponding file You can click the Create Folder button to create a directory in current path You can input the path or select with clicking Browse button to add the file to current directory of USB disk Unmount this is to remove the USB disk safely Notice This device supports max single file size is less then 2GB L600N Dual Band Wireless Router I CONFIGURATION GUIDE Storage Setup Samba Setting Samba Setting Enable Samba E Workgroup home Netbios Name wifi_route Modify the password for user root New Password ELETE Confirm Password TITTI Enable USB F Ena
36. network games point to point P2P applications and multimedia applications e Open It provides firewall settings of a lower security level It allows running of almost all network applications L600N Dual Band Wireless Router I CONFIGURATION GUIDE Security Options WAN Security Setup I Disable Pot Scan and DOS Protection Respond to Ping on Internet Port Default DMZ Server 192 168 255 MTU Size 616 1500 bytes 1500 NAT Filtering Secured Open W Enable SIP ALG E Enable L2TP ALG OI Enable PPTP ALG l Enable IPSEC ALG E Enable IPv Pass Through Enable SIP ALG Certain SIP applications have special mechanisms for passing through the NAT firewall and SIP ALG may have conflicts with these mechanisms Enable L2TP ALG L2TP ALG can pass through L2TP communication data This function is disabled by default Enable PPTP ALG PPTP ALG can pass through PPTP communication data This function is disabled by default Enable IPSEC ALG IPSEC ALG can pass through IPSEC service data This function is disabled by default Enable IPv6 Pass Through By default IPv6 pass through is disabled If your configuration contains IPv6 devices and you want to replace IPv4 with IPv6 you can select the check box to enable IPv6 pass through L600N Dual Band Wireless Router I CONFIGURATION GUIDE Multicast Control Multicast Control Multicast control are support for layer 2 or higher Ethernet switch
37. ng port and ending port for this service e Filter Service For It determines the computers to be blocked L600N Dual Band Wireless Router I CONFIGURATION GUIDE Access Control QoS Setup QoS Setup Qo5 Control Enable WMM VVi Fi multi media Settings d Turn Internet Qos Access On Turn Bandwidth Control On Uplink bandwidth maximum wo Sti O O QoS Priority Rule list Trust IP Control _ Enable Trusted IP Address Trusted IP Address 4 QoS Setup QoS function sets priority policies on applications online games Ethernet LAN ports and MAC addresses sets an order for various network traffics and thus optimizes your network performance e QoS Control You can enable QoS control to run the traffic management policies here e Enable WMM Wi Fi multi media Settings Enable or disable WMM Wireless Multimedia WMM supports setting priorities of wireless traffics according to data types within a certain range such as audio and video has higher priority than normal data WMM is enable by default to ensure the quality of wireless connection Turn Internet QoS Access On Enable or disable QoS After it is enabled you can optimize the network access traffics according to the settings in the QoS Priority Rule List L600N Dual Band Wireless Router I CONFIGURATION GUIDE Access Control QoS Setup e QoS Priority Rule List QoS function sets priority policies on QoS Priority
38. nnected clients under guest network will not be able to communication to each other Guest Wireless Network Name SSID You can edit the Guest Network s SSID here Security Options You can select different security modes for each Guest Network Profile L600N Dual Band Wireless Router ia CONFIGURATION GUIDE Wireless Setup WPS Setup 3 WPS Setup You can use the WPS setup function to add a piel lar wireless client to a network without setting SSID security mode and password e WPS Settings e Router s PIN This is the PIN you use when your adapter does not support Push Button mode PBC WPS Setup P e Enable WPS Enable or disable WPS function WPS Settings Routers FIN 56281965 Enable WPS E Disable Routers PIN V Keep Existing Wireless Settings Apply ae be able to connect to your router by entering the PIN Stat PBC Push Button recommended e Disable Router s PIN By disable the PIN others won t e Keep Existing Wireless Settings Enable or disable You can either press the Push Button physically on the router or press the Button below soft Push Button PIN Personal Identification Number keeping the existing Wireless Settings e Add WPS Client You can select the methods of adding WPS Clients e Start PBC Using PBC method to connect You will need to press WPS button on the adapter as well e Start PIN Using PIN method to connect L600N Dual Band Wire
39. nsert USB storage devices such as USB flash drives and external hard drives for file sharing L600N Dual Band Wireless Router I Quick SETUP GUIDE Connecting Guide 1 Disconnect and Unplug your Existing Router e Disconnect the RJ45 Cable in your existing router from your computer broadband modem and the power adapter from the power outlet 2 Power Off your Modem and Remove the Backup Battery if any e Remove the power adapter to power off your modem Remove the modem s backup battery if your modem has one 3 Connecting the L600N Wireless Router to your modem e Plugs one end of your Ethernet Cable to the modem and the other end to your L600N s modem port Modem L600N Dual Band Wireless Router I Quick SETUP GUIDE Connecting Guide 4 Power on the Modem e Insert the backup battery back to your modem and plug back your modem s power adapter e Please wait 1 2 minutes the modem s initialization to complete 5 Power on your L600N Wireless Router and connect to your Computer e Connects one end of the Ethernet Cable to your L600N s LAN port LAN e Connects the other end of the Ethernet Cable to your Computer e Plug in the power adapter of your L600ON and power on your computer if it haven t turn on 6 Open your Web Browser and type in 192 168 1 1 in the address bar e When prompted Enter the User Name and Password User Name admin Password admin
40. ows Wireless Advanced Settings you to set advanced wireless configuration If you are not sure Adapter what they are please keep default settings J Enable Broadcom ACS e CTS RTS Threshold 1 2347 If the length of a packet is greater Enable Broadcom WMF C Enable Broadcom XPress Technology than this value here the router sends an RTS frame to the Enable Broadcom PHY Watchdog R i Pe destination station to negotiate After receiving the RTS frame Fragmentation Length 256 2346 CTSIRTS Threshold 1 2347 the wireless station responds with a Clear to Send CTS frame PAE N 2 to the router indicating that they can communicate with each Transmit Power Control other The default value is 2346 Wireless Card Access List e Preamble Mode If your Network environment will be heavy loaded you should set at Short Preamble Short preamble is mainly used to improve the efficiency of a wireless network for applications that have high requirement of real time such as streaming video and VolP e Transmit Power Control Set the transmit power of the router The default is 100 L600N Dual Band Wireless Router I CONFIGURATION GUIDE Wireless Setup Advanced Setup e Wireless Card Access List You will be able to set which wireless Wireless Card Access List clients can connect to L600N It is controlled via MAC address of __ Turn Access Control On E Nama a oe the wireless clients This function
41. port WPS If the wireless client does not support WPS you must manually configure so it has the same SSID and wireless security settings as the router Advanced Setup The advanced setup enable the configuration of L600N L600N Dual Band Wireless Router I CONFIGURATION GUIDE Wireless Setup Basic Setup 1 Basic Setup At Wireless Basic Settings you can select to edit your wireless signal e Region Selection Wireless Basic Settings 3 e Adapter 2 4G 5G Region Selection Adapter 24G e Region Default is United States but you can adjust the Region United States Region based on your location Wireless Network Fi Enable Wireless Router Radio i e Wireless Network V Enable SSID Broadcast Enable Wireless Isolation e Enable Wireless Router Radio This is turning on off Wireless Network Name RW 2 46 001 TEN e the wireless signal anai hania e Enable SSID Broadcast This is to make your SSID Band Width 40M or ian es invisible Once uncheck this You will need to enter Security Options iLL heals your SSID manually when connecting to your Wireless security Options None Signal Apply Cancel e Enable Wireless isolation This setting is to turn off the communication among different clients but they can still access Internet L600N Dual Band Wireless Router I CONFIGURATION GUIDE Wireless Setup Basic Setup Wireless Basic Settings Reg
42. riod in minutes Set the broadcast interval It indicates the interval for broadcasting the UPnP information by the router The value should be in the range of 1 to 1440 minutes and the default is 30 minutes Broadcast Time To live in hops The time for the broadcast to E Port Forwarding live It is the number of hops after each UPnP packet is sent The number of hops is the times that each packet can be C Enable Port Triggering broadcast before it vanishes The value should be in the range Port Triggering Timeout in minutes 20 of 1 to 255 hops and the default is 4 hops Max of rules 32 Service Server Name Service Type Required Inbound Connection 7 i iiaia oe UPnP Portable Table This table shows the IP addresses of UPnP Edit Service Delete Service devices that are connected to the router and open internal and external ports on the devices It also lists the types and status of the open ports L600N Dual Band Wireless Router I CONFIGURATION GUIDE Forwarding Port Forwarding 2 Port Forwarding Port Forwarding will allow your router Port Forwarding knowing what network data to the assigned port Service Name FTP v e Service IP Address Enter the IP address of the computer on Service IP Address Service Name Select a service type from the drop down list aal Add which the service is to be provided _ e Service List Display the information of configured services
43. seesssesssresesssresssesssresssrssresssesesreseseseeeeo 31 WPa e UD a a 32 Advanced SOC D oresonn en e EEEE iiei 33 FON WY AINE E EEE E E E E E ETES 36 UPOP ea E E A E E E O EA E 37 POr OMAN CIN Ss airneisi re nE EE 38 Port WIE SSE INS we cresesrarpacevenetoansesausnintstensinesnwnaseranmetaeanetomeaiaanas eas taganansnenien 39 PC COS SCO Ol spire acerca reese eae N E EE A E eeeeese 40 TMe OF Day to BIOCK aciui ra EO a 41 BIO CK SIN OS erana R E 42 BIO CK SOL VICES acc nscssecsaa sanescoensncnctoesnescenaotessecssssosaguncemsseesnacsecesacaenaoees 43 OO SOU oe E E E E E AE 44 PYNC DN speres aran E E E 46 aue ROUTO eaaa A E A E 47 Ea U as e EE EE E ENA 48 L600N Dual Band Wireless Router EE CONTENTS SECURITY OPTIONS scssasscnaaeessaaesarsaseacsanapvaqnayiaviaeemnnveineeiasaananseandasonnnangeetancsanans 49 Remote Management cssessaricscsvesendeadticrsendeesansete seerbecaseesdeedecsusinecendes 50 WAN Security SCEU Dcccoursnrsadsstasrenesnnsenaceunsnesiurdeneroereonsaondisnscepinaeandnes 51 MCa e COMMON aeee E N E EE 54 Salae e cio cD e E E EE E E E AT 55 PIP SOLVER CUD ene e A E 56 FTP Server Account Manager ssssssssssseesseessesssssssssssseesreesreereeereee 57 UE BOWS seisoessa onii E EN E E NS 58 Samba SCN E eh ccoassasceanncstasesespedoaasutineiananaaenenensananceiatavaceecnenteorsaeees 59 N WOO aE EEE EE E E EE 60 Physical Specification eessessssesesesseresssrseseseseeresesresesesreresseeresesesreerreeeseses 62
44. t IP Address The current Internet IP address If assigned dynamically and no Internet connection exists this will be blank or 0 0 0 0 Internet Access Mode Indicate DHCP PPPoE or Fixed IP IP Subnet Mask The subnet mask associated with the Internet IP address Domain Name Server Displays the address of the current DNS e LAN Port MAC Address The physical address of the router as seen from the LAN IP Address The LAN IP address of the router IP Subnet Mask The subnet mask associated with the LAN IP address DHCP Indicates if the router is acting as a DHCP server for devices on your LAN L600N Dual Band Wireless Router I CONFIGURATION GUIDE Running Status Router Status Wireless Port 2 4G Wireless Network Name SSID Region Wireless Channel 802 11 Mode Wireless Radio Enable SSID Broadcast Enable Wireless Isolation Wi Fi Protected Setup Wireless Security Mode Wireless Port 5G Wireless Network Name SSID Region Wireless Channel 802 11 Mode Wireless Radio Enable SSID Broadcast Enable Wireless Isolation Wi Fi Protected Setup Wireless Security Mode RVV 2 4G 001 United States Auto Mixed 802 1 1b g n Enabled ON OFF ON None RVV 5G 001 United States Auto Mixed 802 11a n Enabled ON OFF ON None Show Statistics Connection Status e Wireless Port 2 4G Wireless Port 5G Wireless Network Name SSID SSID name of the Signal Region The loc
45. t Port If you want the router to respond to ping commands from the Internet select the check box The ping command can be used for diagnosis Like a DMZ server this function also leads to security risks Hence do not select the check box unless it is necessary e Default DMZ Server Enter the IP address of a computer or server that serves as a DMZ server L600N Dual Band Wireless Router I CONFIGURATION GUIDE Security Options WAN Security Setup O Disable Port Scan and DOS Protection Respond to Ping on Internet Port C Default DMZ Server 192 168 255 MTU Size 616 1500 bytes 1500 NAT Filtering Secured Open v Enable SIP ALG Enable L2TP ALG Enable PPTP ALG E Enable IPSEC ALG UI Enable IPv6 Pass Through Apply Cancel 2 WAN Security Setup This setup here will allow you to configure features that helps your router from outside hack attempts e MTU Size The maximum transmission unit Normally it is 1500 bytes for most Ethernet networks 1492 bytes for PPPoE connection and 1436 bytes for PPTP connection Certain ISPs may require smaller MTU but this is a rare case Do not modify the value of MTU size unless it is necessary for your ISP connection e NAT Filtering Determines the mode of the router to handle the input traffics e Secured It provides a secure firewall that protects personal computers in an LAN against attacks from the Internet However it causes malfunction of certain
46. work Setup LAN Interface Setup e Address Reservation This function will assign a fix IP for connected LAN Interface Settings devices based on their MAC Address This will be particular useful sich ba when combine with Access Control IP Address IP Subnet Mask RIP Direction Both RIP Version Disablec W Use Router as DHCP Server Starting IP Address Ending IP Address DHCP Lease Time 1 160 hours Address Reservation IP Address Device Name MAC Address Add Edit Delete Apply Cancel L600N Dual Band Wireless Router I CONFIGURATION GUIDE Network Setup WAN Interface Setup 2 WAN Interface Settings The router supports 5 modes of WAN WAN Interface Settings connection including Dynamic IP DHCP Static IP Fixed PPPoE PPTP Dace al kcal Naa and L2TP You may need to confirm with your ISP before selecting your Account Name f Required Hos memet iP Address connecting modes itn e Dynamic IP DHCP L600N automatically obtains IP address subnet Use Static IP Address IP Address mask and IP address of the gateway from the ISP IP Subnet Mask i P e Static IP Fixed Select this If the ISP provides the IP address subnet Gateway IF Address Domain Name Server DNS Address mask and information about the gateway and DNS server You may Get Automatically From ISP i o E need to obtain the information from your ISP Use These DNS Servers rai di e PPPo
Download Pdf Manuals
Related Search
Related Contents
Nettoyant mains à sec 150ml The Embrace 44™ Snugger Ceiling Fan 877LM programming instructions equinox® finition de sol vers un - Toilettes Sèches Ecodomeo Freeman PFWS Installation Guide Pioneer PDV-10 User's Manual Manual de Usuario Sistema de Búsqueda de Información Petrolera Copyright © All rights reserved.
Failed to retrieve file