Home
Expression User Manual v2.0.0 1991
Contents
1. REMOTE FOCUS UNIT Fader control keys The fader control keys on the left side of RFU control the AB fader pair Fader window The fader window displays the percentage of the cue that has played I Cue channel number window The cue channel number window displays the currently selected cue or channel number Tt Channel level window The channel level window displays the level of currently selected channels J Power switch Power switch is on in the up position and off in the down position Chapter 7 Accessories 7 13 For RFU installation instructions see Chapter 2 Installation RFU must be turned Off before you install it For instruction on installing a remote monitor see nstalling two monitors on page 2 4 To operate your installed RFU move power switch to On Expression displays the message RFU On on the screen The console keypad and RFU are able to operate simultaneously Changes made from both console and RFU are displayed immediately on both console monitor and RFU You can control the majority of console functions with RFU you cannot control submasters however Warning Do not connect or disconnect the RFU when it is turned on Expression 2 0 Expression supports MIDI Musical Instrument Digital Interface To enable MIDI in Expression ETC must modify the hardware at the factory Consoles configured
2. Insert cue keystrokes Key Action Blind Displays Blind mode screen 1 Displays cue 1 Chan 1 0 Modifies cue Thru 1 5 fader wheel Rec Indicates you want to record cue 1 1 Enters cue number 1 1 Enter Records and inserts cue 1 1 between cues 1 and 2 4 22 Expression 2 0 Deleting cues Follow these steps to delete a cue from a show 1 Press Blind You cannot delete cues from live modes 2 Enter cue number you want to delete 3 Press Clear 4 To delete just the current cue press Rec To delete the current cue and any channels that track from that cue press Track 5 Press Enter For more information on tracking see Chapter 5 Learning advanced techniques Deleting cue keystrokes Key Action Blind Displays Blind mode Cue Indicates next number entered will be a cue 1 Displays cue 1 on Blind mode screen Clear Indicates you want to delete cue Rec Indicates that you want to delete just this cue not the tracks Enter Deletes cue 1 Chapter 4 Learning the basics 4 23 Viewing cues Once you have created a few cues you may want to look at them You can view stored cues in two ways live in Stage mode or just on the screen in Blind mode To view cues live you must select the cue and play it back in a fader see Lesson 3 Playing back cues for instructions To view a cue just on the screen select Blind mode and enter the cue number you want To vi
3. Group Group allows you to store groups of channels at proportional levels When you select a group Expression selects its channels If you then press At and enter a level the console enters at percentage of the group s recorded levels If you press Enter instead of At the group s proportional levels are imposed on the channels current levels The fader wheel then adjusts levels in the same proportions at which you recorded the group s channels For example assume you save channels 1 through 9 at full and channels 10 through 20 at 50 percent When you move the fader wheel channels 1 through 9 are twice the intensity of channels 10 through 20 In other words Group retains the channels relative levels If you continue to increase the intensity levels after channels with the highest relative level reach full the relative levels are distorted Channel levels continue to increase until all channels are at full For instructions on using Group see Lesson 3 Using Group in Chapter 5 Learning advanced techniques Example Group 1 Enter displays group 1 Cue 1 Group 1 At 5 0 displays cue 1 then adds group 1 to it and sets group channels at 50 percent of their recorded levels Numbering groups The sum of groups and cues in a show cannot exceed 400 However you can use any numbers between 1 and 999 to number groups Group numbers are independent of cue numbers 8 40 Expression 2 0 Nami
4. Indicates next number entered will be an intensity level Enters intensity level of 75 percent Indicates that you want to record cue Enters cue number Records cue Releases captured channels Chapter 4 Learning the basics 4 13 Cue 2 Creating a cue in Blind Follow these steps to create a cue in Blind mode for a range of chan nels using Full Exoression automatically enters 00 for channels you used in cue 1 to indicate that they will downfade in cue 2 ls 8 9 Press Blind Expression displays Blind mode screen You do not have live control of channels in Blind Expression automatically prompts you to enter cue number Enter cue number you want to record or display Press Chan to indicate that the next number entered will be a channel number Enter channel number to mark start of a range of channels Press Thru to indicate you are entering a range of channels Enter channel number to mark end of range Selected channels are highlighted or displayed in yellow Press Full to set channels at full intensity level Press Rec to indicate that you want to record the cue Press Enter Note When using Full you do not have to press At first Expression 2 0 Cue 2 keystrokes Key Blind 2 Chan 1 Thru Action Displays Blind mode screen Selects cue 2 Indicates that the next number entered will be a channel Selects channel 1 Indicates you are going to en
5. To print a report 1 Enter menu option number and press Enter 2 Follow prompts that ask for beginning and ending numbers if any 3 Press Enter Expression sends reports to the printer To cancel the print operation before Expression sends the report to the printer press Clear To stop printer while it is printing press Set Up Chapter 6 Using print and disk options 6 3 Cues The cue report prints each cue on a separate page From the Print Options Menu select 2 and press Enter Enter the first cue number you want to print or enter O if you want to print all recorded cues Press Enter If you are selecting a range of cues to print Expression prompts you for the last cue number to print Enter the last cue number you want and press Enter Exoression sends the report to the printer To cancel the print operation before Expression sends the report to the printer press Clear EXPRESSION LIGHTING CONTROL SYSTEM ELECTRONIC THEATRE CONTROLS INC CUE 1 1 XFAD 00 07 00 07 WT 00 00 LK 1 2 DL 00 07 123 4 5 6 7 8 910 11 12 13 14 15 16 17 FF FF FF FF 75 75 75 75 75 26 27 28 29 30 31 32 33 34 21 21 21 21 21 21 21 21 21 50 51 52 53 54 55 56 57 58 21 21 21 21 21 21 21 74 75 76 77 78 79 80 6 4 Expression 2 0 Cue sheet The cue sheet report lists all recorded cues From the Print Options Menu select 7 and press Enter Enter the first cue number you want to print or enter 0 if you want to print the
6. 87 ELECTRONIC THEATRE CONTROLS INC 19 20 21 22 23 24 43 44 45 46 47 48 67 68 69 70 71 72 34 91 92 93 94 95 96 Chapter 6 Using print and disk options 6 13 Submaster Sheet Submaster Sheet is a feature of Expression s expanded memory option Expression will only print the submaster sheet report if the expanded memory option is installed The submaster sheet report prints all 48 submasters 24 in each of two pages If recorded upfade wait and downfade times are included in the printout In addition if you have named the submasters using the optional alphanumeric keyboard the submaster name is also included in the printout To print submaster sheet select 12 from the Print Options menu then press Enter EXPRESSION LIGHTING CONTROL SYSTEM ELECTRONIC THEATRE CONTROLS INC SUBMASTER SHEET SUBMASTER 01 02 03 04 05 06 07 08 09 10 if 12 13 14 15 16 17 18 19 20 21 22 23 24 oocooo0oo0oo0oo0oo0o0o0o0o0000000000000 ooocoo0oo0oo0o0oo0o0o0o0o0o000000000000 oooooooocoo0qococoeoooceoooc9ceoe 6 14 Expression 2 0 Track Sheet The Track Sheet report lists all level settings for a specific channel in all recorded cues From the Print Options Menu select 5 and press Enter Enter desired channel number and press Enter Expression sends report to the printer To cancel the print operation before Expression sends the report to the printer press Clear EXPRESSION LIGHTING CO
7. Dimmer intensity increases when output exceeds 5 or 10 Dimmer at full whenever console power is on Affected by Black Out but not by Grand Master Expression 2 0 Resetting factory dimmer profiles and all dimmers to default setting The Default Dimmer Profiles option on the System Settings Menu allows you to reset all dimmers to the default linear profile and the dimmer profiles to the original factory settings 1 Press Set Up 2 Select 6 System Settings and press Enter 3 Select 9 Default dimmer profiles and press Enter Capturing channels in softpatch Expression lets you select and capture channels without returning to Stage mode so you can bring channels up on stage to view the propor tional settings of dimmers assigned to a channel while you set them To select channels from the softpatch screen follow these steps 1 2 Press Patch Press Chan Enter channel number or select a range of channels Press Full to set channel level at 100 percent or press At and enter a level setting Press Rel to release channel s Chapter 3 Entering softpatch and system settings 3 11 Unpatching individual dimmers Dim lets you select a single dimmer and bring it up independent of other dimmers softpatched to the same channel This is called unpatching a dimmer If a channel has more than one dimmer softpatched to it you may want to unpatch a single dimmer to check individual fixt
8. Table of Contents v Lesson 54 Working with effects v iuessisrediari ai ia i 5 29 Creating an electi sankoin e n etait eee 5 30 Inserting and deleting StepS ssssssseseeertirrreresertrrtterrrenrnen 5 34 Editing Steps keirin ee tat oe ie tees 5 34 ETfECtS SHOMMCULS epea E OERO 5 35 Lesson 6 Working with subroutines ssssssssssesiirrisrreereerrerrrrrrne 5 36 S EE E E E E E E E E atone 5 36 Crean SUBTE sa e i eI E A IRR Oi ee 5 37 DEIStING a Stepe ipa sie ee ete eee ee R RS 5 40 Inserting a Stop enrenar naaa a ea a 5 40 Lesson 7 Working with autoloads s sssssesessesseriirrinireereeertrrrrnna 5 43 Recording autoloads from Stage cecceccecceesseeceeseesseeesesteeeens 5 44 Recording previewing and modifying autolGads Trom BINA sers ee oi ceeded devenaniiewa ssc E dvene 5 45 Playing DaGk aUtolOads ts cis ieee enen hee eta i hess neal Gees 5 46 Lesson 8 Working WIth MACIOS 0 ccccceeceeeeeseeeeeeeeeeeeeeteeentsteeeeees 5 47 Creating or modifying a MACTO cc cccceceesstececeessseeeeceecsseeeeeeeeaes 5 48 Using s bmastersin MACOS siresrsingenti gnia a E g 5 50 RUNNING a MaC O a a pio eis Re e PNA 5 50 P tting a macio Om hola iessen aei tiaa een 5 50 Cancelling a acro ai enan aE AN eset 5 51 Deletinga maT Okene a e e ae 5 51 Sampe mad OSa a R E AN RERA 5 52 Chapter 6 Using print and disk options 6 1 AAO SLEA EREE ATE EEA E A 6 2 CUES a E E E E T E A E T vate attained 6 3 GU
9. Enter chapter 5 entering softpatcn and System settings Before you begin creating cues for a show you should first create your softpatch The softpatch assigns individual dimmers to control channel numbers You can use a default one to one softpatch setup or you can assign groups of dimmers to channels The softpatch screen lets you proportionally patch dimmers to channels System settings also allow you to indicate default up and down fade times default fader clear times enable and disable bump switches and the level that the Full key enters for selected channels This chapter includes the following system setting instructions Entering softpatch Setting default full level Setting default up and down fade times Setting default fader clear times Enabling and disabling bump switches 3 2 Expression 2 0 Entering softpatch Expression accommodates up to 512 dimmers or 1 024 if you have the optional second DMX512 connector in 250 channels Softpatch gives you complete flexibility in assigning dimmers to control channels in any order Softpatch also allows you to proportionately assign levels to individual dimmers to balance a wash or ensure that a specific lamp cannot be brought above a specific level For instructions see page 3 8 In addition you can select from 10 dimmer profiles for each individual dimmer Dimmer profiles allow you to select a nonlinear output curve for dimmers For instructions on selecting dimme
10. Expression 2 0 And allows you to select a set of channels cues dimmers or steps that has a break in the numerical sequence You can then enter an intensity level for the set For example you can select channels 1 and 7 and 9 You can also use And in conjunction with Thru to select a set such as 1 through 10 and 15 through 20 To select a discontinuous set of cues or channels follow these steps 1 Press Chan or Cue whichever you are selecting 2 Enter a channel or cue number 3 Press And 4 Enter a second channel or cue number Hint You can combine the use of And and Thru For example 1 Ana 5 Thru 9 Example Chan 1 And 5 selects channels one and five Chapter 8 Reference 8 3 At At indicates that the next number entered will be an intensity level for selected channels You can also use the fader wheel or Full to set intensity levels 1 Select channels 2 Press At to indicate that next number entered will be an intensity level setting 3 Enter a two digit intensity level setting for selected channels Or if you prefer to enter levels on a scale of 1 to 10 for example 1 10 percent 2 20 percent etc enter a one digit level and press Enter Hint It is not necessary to use At before pressing Full or before moving the fader wheel Examples At 5 0 or At 5 Enter sets selected channels at 50 percent 8 4 Expression 2 0 Autoload Th
11. Expression back panel Expression 2 0 Alpha AMX192 RFU DMX512 Fuse Analog Analog input keyboard outputs DWS outputs 5A 3AG dimmer channel output r1 192 r 1 512 outputs inputs 193 384 513 1024 o 97 128 129 160 161 192 4 mai 97 128 129 160 161 192 33 64 Printers parallel serial DIP Monitors switches color monochrome Chapter 2 Installation 2 3 Installing your console and monitor This section includes installation instructions for Expression and connec tor and pinout specifications for the monitor Follow these steps to install your Expression 1 Place console on a hard stable flat surface with at least 6 inches of space behind it for ventilation and cable clearance Console should be at least 6 feet away from dimmers and high current AC lines Caution Do not leave the console in a road case tray or on a soft surface This will inhibit proper ventilation 2 Verify that your dimmer connector pinout is correct Pinouts for several dimmer types are listed on pages 2 8 through 2 9 If your dimmer type is not listed contact your dealer or ETC Caution Your dimmer control common must be compatible with console control common they must either be the same level or the dimmer control comm
12. effect plays in standard mode Standard Expression creates effects by holding channels at low levels and flashing them to their high levels to create effect 15 16 Expression 2 0 Negative When you select negative instead of flashing channels to their high level to create an effect channels remain at their high levels and flash to their low level to create the effect Alternate This modifier alternates playing the steps back in standard and negative modes Build The build modifier starts each sequence by setting all channels at their low levels Each step flashes to full and stays there until the beginning of the next sequence playback Press Rec enter cue number and press Enter to record the effects cue Play back an effects cue as you would a normal cue press Stage Cue enter effect number and press either Go When you play back an effects cue the left fader of the fader pair A or C controls intensity levels The right fader of the pair either B or D controls the playback rate When you begin an effect with the right fader at 10 Expression plays it back at the recorded rate the LED strip indicates 50 percent on the right fader To take manual control of the playback rate move the fader to 50 percent Then move the fader up or down to adjust rate 10 is instantaneous playback through steps and 0 stops playback If right fader is set at any level other than 10 when you start the effect it pla
13. follow these steps 1 Turn Designer s Worksheet on You should see the message DWS On on the screen 2 With the worksheet pen touch Set Up Expression displays the Set Up Menu 3 Select 17 Edit Designer s Worksheet and touch Enter Expres sion displays the screen illustrated below EDIT DESIGNER S WORKSPACE l REGION 1 REGION OPERATION S SELECT REGION NUMBER OR TOUCH A PREVIOUSLY DEFINED REGION THEN TOUCH ENTER 4 Tocreate a new region enter the number you want Or select an existing region either by touching the region on the worksheet or by entering the number from the number pad 5 Touch Enter 10 Expression 2 0 To create a new region or to change an existing region trace the area you want to define for that macro number To keep an existing region touch Enter Expression displays a highlighted R next to the macro number to indicate that a region is defined for it Touch desired keystrokes As you touch keys on worksheet they are displayed on the screen Use the arrow keys as described below to edit macros if necessary Left and right arrows Move highlight to left or right Up arrow Inserts keystroke before highlighted keystroke Down arrow Deletes highlighted keystroke Macro wait To program a pause in the macro press Macro wait Expression displays Macro wait 00 00 Enter the length of the pause in minutes and seconds or as a fraction of a second in decimal
14. subsequent cues in reverse numerical order For example if you play cues one two three twenty two and sixteen then press Back cue sixteen will fade into cue twenty two If you press Back again cue twenty one will play not cue three Cues are played back using the fade and wait times recorded with the cue Back allows you to play back cues loaded in either fader pair If you are using only one fader pair you need only press Back to replay the previous cue If you have cues loaded into both fader pairs you must press Back then the Go button below the desired fader pair If you play cues one two and three in the AB fader pair and cues six seven and eight in the CD fader pair pressing Back then the AB Go plays back cue two pressing Back then the CD Go plays back cue seven Note Each time you press Back Expression resets the cue sheet The cue replayed with Back becomes the first cue in the cue sheet If you then press Go without first pressing Back the next numerical cue plays Chapter 4 Learning the basics 4 35 Clearing fader pairs Each timed fader pair is equipped with a blue Clear key To clear a cue from the fader pair press the appropriate Clear key Faders will clear immediately unless you have reset the default fader clear time For instructions on changing fader clear time see page 3 15 4 36 Expression 2 0 Lesson 4 Working with submasters Expression is equipped with 24 submast
15. 00 Channel 5 Figure 4 Note that Expression enters a level of 00 percent for channel 4 in cue 2 This downfades the channel when cue 2 is played Expression 2 0 When you insert a cue with Track new channels track through the cues after it until Expression encounters a cue with a level previously re corded for that channel Pressing Track rather than Rec as in the previous example then 1 1 1 Enter to insert and record the same cue 1 1 as above produces the results illustrated in Figure 5 Compare it to the results illustrated in Figure 4 in which the same cue was inserted using Rec rather than Track Cue 1 1 Cue2 Cue3 Cue4 Cued Channel 1 50 50 50 25 00 Channel 2 FF FF FF 00 Channel 3 FF FF 00 Channel 4 50 FF 00 Channel 5 Figure 5 Channel 4 creates a track from cue after 1 1 until a prerecorded level interrupts it Chapter 5 Learning advanced techniques 5 15 Blackout cues and tracking Sometimes you may add a channel to a sequence of cues that has not used that channel yet For example you may want to add a channel to all cues in a scene To do this add the channel to the first cue in the sequence and use Track to track the change through the remaining cues However the last cue in sequence may be a blackout cue When you track the channel the new channel tracks until it runs into a different recorded level To assure that channels are not tracked through a blackout cue the allfade
16. 1 2 8 Press Stage Press Cue and enter cue number Press Go to playback cue Push faders down and back up to avoid fade times Modify cue Press Rec To rerecord as same cue press Enter To record as a new cue enter new cue number and press Enter Release captured channels Note If you rerecord as same cue modifications are reflected in fader If you record the cue with a new number modifications are not reflected in the fader you may want to run cue through fader before you release channels if you don t want to lose the look from stage Chapter 4 Learning the basics 4 33 Update cue The preceding steps allow you to record the entire on stage look into the modified cue To add only selected channels to the cue use the Update cue feature alk 2 Press Stage Press Cue and enter cue number Press Go to playback cue Push faders down and back up to avoid fade times Add channels and set levels or modify levels of existing channels Press Update Cue Enter to update the existing cue or Update Cue a new cue number and Enter to record the updated cue as a new cue To rerecord as same cue press Enter To record as a new Cue enter new cue number and press Enter Release captured channels 4 34 Expression 2 0 Back key The back key replays the most recently played cue regardless of the order in which the cues were recorded in the cue sheet It then plays
17. 6 kw or 12 kw dimmer The console requires that you include all 96 possible dimmer numbers per rack in the softpatch Refer to the charts below to determine dimmer numbers for each slot on each rack When patching 6 kw or 12 kw dimmers enter the slot s odd dimmer number under the desired channel number Enter the slot s even dimmer number under channel 0 For example to patch a 6 kw dimmer into the last dimmer slot on the first rack enter dimmer 95 in the desired channel number and dimmer 96 in channel 0 3 13 Chapter 3 Entering softpatch and system settings Entering system settings These system settings are discussed on the following pages Default full level Default up and down fade times Default fader clear time Enable disable bumpswitches To display the System Settings Menu follow these steps Press Set Up L 2 Select 6 System Settings and press Enter The system setting menu is illustrated below t lr wi E mi j w tal ta GRAND MASTER 100x FUNCTION SELECT ATE OVERRIDE ENTER THEN PRESS URH TO SETUP MEHU Expression 2 0 Setting default full level The default full setting is the level Expression enters for selected channels when you press Full Full is set originally at 100 perce
18. 9 8 30 Expression 2 0 Selecting channels cues or dimmers with Except When you are selecting channels for a look cues in the Track Sheet or dimmers on the patch screen use Except to exclude a subset of the items channels cues or dimmers already selected Follow these steps to exclude items 1 When items are selected press Except 2 Press any of the following key sequences to exclude a subset of selected items e Enter channel numbers You can select groups of channels by using And and Thru e Press the bump switch of any submasters whose channels you do not want recorded with the look You can press as many bump switches as you want e Enter channels included in cues or groups by pressing Cue or Group and entering the cue or group number To enter more than one cue or group press And between numbers 3 Complete action with the remaining set of selected items For example set channel levels or assign dimmers to channels Chapter 8 Reference 8 31 Expand Expand allows you to toggle between 125 channel display and 250 channel display in Stage Blind and Fader modes To expand the standard 125 Expression channel display screen press Expand To return screen to 125 channel display press Expand again 8 32 Expression 2 0 Fader display Fader displays the Fader mode screen Fader mode displays captured channels and channels currently in either one or both fader pairs Like Stage Fad
19. Bounce can be used for marquee or runway type effects Random Plays steps back in random order Channels flash to high and low levels they do not fade Random creates lightning flashing or strobe effects Ripple Plays steps in random order but unlike random channels fade between steps Ripple creates the effect of flames or water reflections Expression 2 0 Creating an effect To create an effect follow these steps 1 Press Blind You must be in Blind to create an effect 2 Press Type to display the fade type menu 3 Select 3 Effect Expression displays the following screen GRAND MASTER leew HOT RECORDED CUE 31 EFFECT RUH STYLE Loop NEGATIVE STEP Bi Bz A FADER B FADER C FADER I FADER CLEAR CLEAR i 3 4 535 6 7 8 9 1B 1i 12 SUB ONH WAIT LINK DELAY 48 1 00 58 uot Ba Pa Pca CNEL EE OS tae Cot 13 14 15 16 17 18 19 20 21 22 23 aa SELECT TIME 4 Press Chan and enter channel number s you want to include in the first step Then press Enter Or press Group enter a group number and press Enter to enter all channels in that group You can also select channels in cues and submasters by pressing Group then Cue or Submaster entering the cue or submaster number and pressing Enter 5 Enter a two digit high level To set level at 100 percent press Full Or press Enter to accept the displayed setting 6 Enter a two digit low level setting Or press En
20. Enter to record cue Expression 2 0 Cue 5 keystrokes Assuming you are still in Blind and have cue 4 displayed follow these steps to create a cue using Solo Key Action Chan Indicates that the next number entered will be a channel number 6 0 Marks the beginning of the subset Note If you are entering a range of channels in Flexichannel mode you must press Thru Thru to indicate a range Thru Indicates you are selecting a range of consecutive channels 6 5 Marks the end of the range Solo Deletes all unselected channels all channels except 60 through 65 Fader wheel Sets desired level or At and At and numeric keypad Rec Indicates that you want to record the cue 5 Enters cue number Enter Records cue Chapter 4 Learning the basics 4 21 Inserting cues You may want to insert a cue between recorded cues For example you may want to modify cue 1 slightly and insert it between cues 1 and 2 You can number cues with a one digit decimal Therefore you can insert up to nine cues between one and two 1 1 1 2 etc To modify and insert a cue follow these steps 1 Press Blind Expression automatically prompts you for a cue number 2 Enter cue number you want to modify 3 Make modifications 4 Press Recl 5 Enter cue number with a decimal to insert it between cues If you do not enter a new cue number you will overwrite the existing cue 6 Press Enter
21. Part The Step Part key is used in editing subroutines and effects and in creating and editing mulitpart cues For information on using Step Part to edit effects see page 5 34 For information on using Step Part to edit subroutines see page 5 40 Information on using Step Part to create and edit multipart cues begins on page 5 4 Examples Blind Cue 1 Step Part 1 displays step 1 of subroutine cue 1 in Blind Blind Cue 2 Step Part 1 displays step 1 of effect cue 2 in Blind Stage 1 Thru 5 Full Rec 3 Step Part 1 Enter records chan nels 1 through 5 at 100 percent as part 1 of cue 3 8 64 Expression 2 0 Sub Pressing Sub indicates that the next number entered will be a submas ter number You may want to select a submaster to display it in Blind or you might use Sub when you save a look in a submaster Press Sub and then the submaster number you wish to select For detailed instructions on working with submasters see Chapter 4 Learning the basics Example Blind Sub 1 displays supmaster 1 on the Blind mode screen Rec Sub 2 records the current look as submaster 2 Chapter 8 Reference 8 65 Submaster Sheet The Submaster Sheet lists all submasters Page one and two are dis played separately Press Blind Sub Page to display Submaster Sheet Press Page to toggle between Submaster Sheet for page one and page two All 24 submaster pots per page are rep
22. Tt Cue display The cue display lists recorded cues and the level recorded in each J Operator prompt line The operator prompt line displays messages to guide you through Track Sheet functions Chapter 5 Learning advanced techniques 5 19 Working with Track Sheet With the Track Sheet you can track one channel at a time through any group of cues at any level including zero Track Sheet is useful when you want to track a channel through blackout cues or when you want to complete a broken track To track a channel follow these steps 1 2 Press Track Sheet Enter channel number you want to track Press Cue to indicate that you want to select cues Select the cue number s that you want to track this channel through Use And and Thru to indicate a range or group of cues Press and to select the next or previous cue Enter the desired level using the fader wheel At or Full Press Rec Enter to record level settings To track a different channel press Chan and enter the next channel number you want to display Hint To track a channel at zero through all cues it is included in press Track Sheet enter channel number then press Solo Solo Expression 2 0 Track Sheet keystrokes Key Track Sheet 5 Cue 2 Thru 5 At 5 0 Rec Enter Action Displays Track Sheet Selects channel five Indicates that you are going to enter cue numbers Select
23. allows you to set channels levels check dimmers or run cues from remote locations To install Remote Focus Unit follow these steps 1 2 Verify that RFU power switch is turned Off Insert the RFU cable into the connector on the back of the console labeled RFU DWS Turn RFU power switch to On Expression displays the message RFU On when RFU is properly installed and turned on RFU connector and pinout Console connector XLR 6 pin female Pinout 1 Data to RFU 2 Data 3 Data from RFU 4 Data 5 Common AC ground 6 12 VDC fused 2 A Chapter 2 Installation 2 17 Installing Redundant Tracking Backup 1 Configure both consoles for parallel printers a Press Set Up b Select 6 System settings and press Enter c Select 10 Serial parallel printer and press Enter d Select 1 Parallel and press Enter 2 Reset DIP switches on both consoles according to the chart below Both consoles B4 On Master console Bb Off Slave backup console B5 On Note Expression reads DIP switch settings when you turn it on You must turn power off and back on for console to recognize new settings 3 Connect consoles with an RS 232 cable Belden 9503 or equivalent that is not longer than 50 feet Use console connectors labeled Serial Cable pinout DB9F DB9F 2 3 3 2 5 5 Pins 1 6 7 and 9 are not connected Pins 4 and 8 are tied together at each end but are not connected through ca
24. any time Entering the softpatch screen also restores patch Hint You can perform a dimmer check by pressing Dim 1 Full and then pressing Dim to move to each subsequent dimmer You can write these key sequences as macros if you use dimmer checks often Example Stage Dim 1 Enter unpatches dimmer one Dim Clear restores patch Chapter 8 Reference 8 23 Dimmer profiles Dimmer profiles allow you to select a specific output curve for a dimmer over the range of a fade This can compensate for nonlinear light outputs from certain types of fixtures or incorporate a preferred response in a fade If you do not select a dimmer profile the console defaults to a linear output To select a dimmer profile for a specific dimmer follow these steps 1 Press Patch 2 Press Dim and enter dimmer number or a range of dimmer numbers using And and Thru 3 Press Typel 4 Enter profile number Profile numbers are listed on menu at the bottom of the softpatch screen Each is also described and illus trated below 0 Linear 1 IES square 2 Slow bottom 3 Fast bottom 4 Slow top 5 Fast top 6 Full at 1 7 Preheat 5 8 Preheat 10 9 Hot patch Dimmer intensity jumps from 0 to 100 at 1 output t Dimmer at 5 or 10 whenever console power is on Dimmer intensity increases when output exceeds 5 or 10 Dimmer at full whenever console power is on Affected by Black
25. before the selected step Chapter 5 Learning advanced techniques Subroutine keystrokes Key Action Blind Displays Blind mode screen Cue Selects cue number 7 Enters cue number Type Displays fade type menu 4 Select subroutine fade type Cue Select Indicates next number entered will be cue number 1 Enter Enters cue 1 3 Enter Enters 3 second upfade Enter Accepts 3 second downfade 5 Enter Enters 5 second delay time before second cue begins Cue Select Indicates next number entered will be cue number 2 Enter Enters cue 2 At 7 5 Enters 75 percent intensity level for cue 1 Enter Enters 1 second upfade time 4 Enter Enters 4 second downfade time 1 0 Enter Enters 10 second delay time Cue Select Indicates next number entered will be cue number 3 Enter Enters cue 3 At 5 0 Enters 50 percent intensity level for cue 5 Enter Enters 5 second upfade time Enter Enter Enter 1 2 Enter Record Enter Expression 2 0 Accepts 5 second downfade time Accepts 00 second delay time Displays style menu Selects loop Indicates to return to start of loop twice Subroutine makes three runs through steps Enters the style Records subroutine cue Chapter 5 Learning advanced techniques 5 43 Lesson 7 Working with autoloads The autoload feature lets you load and playback cues in both fader pairs simultaneously You can record a
26. controls The five macro keys allow you to access macros M1 M2 M3 and M4 allow you to access macros one two three and four M allows you to enter any other macro To access other macros press M enter the desired macro number and press Enter Y Fader controls The fader control keys allow you to play back cues in the console s crossfaders Go controls the AB fader pair the remaining keys function as on the console keyboard Other controls The remaining controls enable you to select dimmers channels groups and cues Keys function as they do on the console keyboard Chapter 7 Accessories 7 11 mT Connector for hard wire connection to receiving unit Pressing any key on the infrared controller automatically turns power on Once you have turned the unit on if no key is pressed after three minutes the power shuts off The unit is powered by a nine volt size PPS battery Console controls and the infrared controller are able to operate simulta neously Changes made from both console and infrared controller are displayed immediately on the console monitor 7 12 Expression 2 0 Remote Focus Unit RFU The Remote Focus Unit RFU is a small portable control panel you can use from a remote location such as in the house on your studio set or from backstage You can use an RFU with or without a remote monitor
27. cues Tracked channels are channels in which an inten sity level setting is unchanged from the previous cue Complete description and instructions on using the Track feature begins on page 5 9 Chapter 8 Reference 8 73 Track Sheet Track Sheet displays the Track Sheet mode screen While in Track Sheet press Track Sheet again to display a second screen of cues if any Track Sheet displays level settings of one channel for all recorded cues The Track Sheet screen is illustrated below Instructions on working with Track Sheet begin on page 5 17 STER 160 TRACK SHEET l CHANNEL 1 CUES i 6 1 3 4 5 3 18 13 14 15 19 28 23 z4 29 30 J6 37 46 47 36 a7 64 64 SELECT CHANNEL TO BE TRACKED Expression 2 0 Type displays the fade type options described below The menu that appears in Stage omits the effect and subroutine options In subroutines another fade type plusfade is also available SELECT FADE TYPE C1 CROESSFABE 2 ALLFADE 3 EFFECT OR 4 SUEFROUTINE To select a cue fade type in Stage Blind or Fader modes press Type and enter an option number If you change a cue s fade type you must rerecord the cue If you do not enter a fade type cue defaults to crossfade Crossfade A crossfade upfades increasing levels as it downfades decreasing levels Crossfade starts the upfade time when you press Go You can program a wait time between the start of the upfade and downfade A
28. current show follow the instructions on the previous page to record current show before you read a new show from disk When using the read option any fades being executed are interrupted during the read operation fades resume when read is complete To read a show from disk into memory follow these steps 1 Insert disk in disk drive 2 Press Set Up 3 Select 2 Read show from disk and press Enter Expression displays the screen illustrated below TO READ FROM DISK SELECT SHOH NUAEER THEN PRESS ENTER TO ABORT PRESS CLEAR SHOW 1 RECORDED SHOW 2 RECORDED LUSE DOUBLE SIDED DOUBLE DENSITY DISH ONLY If either show one or two is currently recorded on disk the screen displays the message Recorded or the date recorded if you have the Real Time Clock option If no show is recorded on disk Expres sion displays the message Not recorded 4 Select either show one or two and press Enter The show you enter will overwrite the current show in memory Or press Clear to cancel the operation Note See page 4 38 for information about submaster pages when reading a new show into console We recommend that you verify the show immediately after reading it to ensure that is was read without errors See page 6 19 for instructions Chapter 6 Using print and disk options 6 19 Verify show on disk The Verify show on disk option compares a show that is recorded on disk with the show in memory Expression i
29. display mode you used last when you turned it off Follow these steps to enable or disable the Flexichannel display mode 1 Press Setup 2 Select 6 System settings and press Enter 3 Select 18 Enable disable Flexichannel and press Enter 4 Press 1 Enter to enable Flexichannel or 0 Enter to disable it Flexichannel displays any channels that you have recorded or selected at any time while working on show To clear the channels that you have selected but chose not to record reenable Flexichannel from the System Settings Menu Note When using Thru to select a range of channels in Flexichannel you must press Thru twice See the section titled Thru in this chapter for more information 8 36 Full Expression 2 0 Full enters full intensity for all selected channels Full works in all display modes When you use Full you do not have to press At You can change the level Full enters by changing the default setting For example you could change the default full level to 85 pressing Full would then enter 85 for all selected channels Follow these steps to change the default setting 1 Press Set Up 2 Select 6 System Settings and press Enter 3 Select 1 Default Full Level and press Enter 4 Either enter a two digit intensity level or press Full to set level at 100 percent 5 Press Enter When the Full default is set below 100 percent you can still set levels at any
30. entire cue sheet Press Enter If you are selecting a range of cues to print Expression prompts you for the last cue number to print Enter the last cue number you want and press Enter Expression sends the report to the printer To cancel the print operation before Expression sends the report to the printer press Clear EXPRESSION LIGHTING CONTROL SYSTEM ELECTRONIC THEATRE CONTROLS INC CUE SHEET LK LK LK LK LK LK LK LK LK LK LK LK LK LK LK LK LK LK LK LK LK LK Chapter 6 Using print and disk options 6 5 Designer s Worksheet Since Worksheet regions are specialized macros when you select the Print Designer s Worksheet option Expression prints all macros and worksheet regions From the Print Options Menu select 9 and press Enter Enter the first region you want to print or enter 0 if you want to print all regions Press Enter If you are selecting a range of regions to print enter the last region you want and press Enter Exoression sends the report to printer To cancel the print operation press Clear EXPRESSION LIGHTING CONTROL SYSTEM ELECTRONIC THEATRE CONTROLS INC REGION OPERATION S CHAN 1 THRU 25 AT 55 REC SUB SETUP 1 ENTER 1 ENTER 1 ENTER 2 ENTER STAGE CUE 500 GO AB CHAN 1 THRU AT 00 6 6 Expression 2 0 Groups The group report prints each recorded group on a separate page From the Print Options Menu select 3 and press Enter Enter the fi
31. fade type records all unused channels in a cue at zero This works as a roadblock for added tracks Figure 6 displays what happens when we track channel 5 through the sequence when cue 5 is a regular crossfade cue Cue 1 Cue1 1Cue2 Cue3 Cue4 Cued Channel 1 50 50 50 50 25 00 Channel 2 FF FF FF 00 Channel 3 FF FF 00 Channel 4 FF 00 Channel 5 FF FF Figure 6 Channel 5 tracks through cue 5 and ruins the black out cue Expression 2 0 If cue 5 is an allfade Expression records all unused channels at 00 percent In the example below an allfade enters 00 in channel 5 cue 5 When you track a channel through the sequence the new channel will not track through the blackout cue To select the allfade type for cue 5 enter these keystrokes Blind Cue 5 Type 2 Selects allfade fade type Rec 5 Enter Rerecords cue Now when we track channel 5 through the sequence cue 5 acts as a roadblock for the track The result is illustrated in Figure 7 Cue 1 Cue1 1Cue2 Cue3 Cue4 Cued Channel 1 50 50 50 50 25 00 Channel 2 FF FF FF 00 Channel 3 FF FF 00 Channel 4 FF 00 Channel 5 FF 00 Figure 7 For more information on cue fade types see page 8 74 Chapter 5 Learning advanced techniques 5 17 Lesson 3 Track Sheet Tracked channels are channels whose levels do not change from one cue to the next The Track Sheet allows you to display one channel s settings for all recorded cues At a glance you can
32. form from 1 second to 99 59 minutes Touch Enter Macro to save the macro Each macro has a 32 keystroke limit Enter another macro or edit an existing macro by following steps four through nine Or return to another mode by touching the appropriate key Hint If you need to exceed the 32 command limit link another region to the end by entering another region number as the last command and finish entering commands in the linked macro Chapter 7 Accessories 7 9 Deleting regions To delete a region follow these steps 1 2 Press Setup to display the Set Up Menu Select 12 Designer s Workspace and press Enter To clear a range of regions enter the first region number you want to clear and press Enter Then enter the last region number you want to clear and press Enter To clear all regions press 0 Press Enter to complete the command or press Clear to cancel it 7 10 Expression 2 0 Infrared Remote Focus Unit IRFU The Infrared Remote Focus Unit IRFU allows you to control the Expres sion console from distances up to 225 feet 75 yards With it you can play back cues and macros and access dimmers channels groups and cues The IRFU can also be wired to the main control console To enable the IRFU in Expression ETC must modify the console at the factory z es o 0 M1 z Go E E E 7 8 9 E E E 4 5 6 E E E 1 2 3 E E E 0 E E E _ ie Infra Red Macro
33. in Chapter 8 Reference is Create and record a cue using techniques described for cues 1 through 3 Press Link Enter cue number to which you want to link current cue You can enter either a cue number that exists already or one you are going to create Press Enter On the cue description line the number of the linked cue and LK appears This information is also added to the cue sheet Enter delay time in minutes and seconds or as a fraction of a second in decimal form Delay times may be between 1 second and 99 59 The delay time is the length of time between the start of the first cue and the start of the cue it is linked to For example if the delay time for the link is 10 seconds the second cue upfade starts 10 seconds after the first cue s upfade begins Expression enters a default delay time that equals the total running time of the first cue That way the cues run back to back The total running time of a cue is the longer of either the upfade time or sum of the wait and downfade times To change the delay time for a cue that is already linked press Link twice enter delay time and press Enter Note If you are entering link information for existing cues you do not have to rerecord the cue Expression 2 0 Cue 4 keystrokes Key Blind Chan 5 1 Thru Action Displays Blind mode screen Indicates that you are going to enter channel numbers Selects channel 51 Indicates that you
34. indicate on which days the cue should run Then press Enter 1 Sunday 2 Monday 3 Tuesday 4 Wednesday 5 Thursday 6 Friday 7 Saturday To run cue on more than one day of the week use And and Thru to select a group of days For example to enter Monday through Wednesday and Saturday enter 2 Thru 4 And 7 8 Press Enter to record the program Or press Clear to cancel it 7 20 Expression 2 0 Setting Real Time Clock Follow these steps to set Real Time Clock 1 Press Set Up 2 Select 10 Set real time clock and press Enter Expression displays the following screen ENTER CURRENT TIME 24 HOUR CLOCK ME 18 16 DATE 23 JAH 91 DAY HEDNES DAY 3 At Current Time prompt enter time in military format For example enter 8 00 a m as 08 00 and 5 15 p m as 17 15 Press Enter 4 At Current Date prompt enter day of the month Press Enter 5 At Current Month prompt enter one of the following month codes and press Enter 1 January 7 July 2 February 8 August 3 March 9 September 4 April 10 October 5 May 11 November 6 June 12 December 6 At current Year prompt enter the last two digits of the desired year Press Enter 7 At current Day prompt enter one of the following day codes and press Enter 1 Sunday 5 Thursday 2 Monday 6 Friday 3 Tuesday 7 Saturday 4 Wednesday 8 Press Rec to start clock Or press Clear t
35. level up to 100 by using At and the numeric keypad or the and keys Examples Chan 5 Thru 1 0 Full sets channels 5 through 10 at 100 percent Set Up 6 1 8 5 Enter sets default full levels to 85 percent Chapter 8 Reference 8 37 Go The Go keys initiate the playback of cues When you press a Go key the cue highlighted on the cue sheet begins playing back in the fader pair If you have pressed Hold to interrupt the playback of a cue press Go to resume the fade Hint To go to a cue out of sequence press Cue enter the cue number and press Go To push the levels to their full recorded levels immedi ately avoiding the fade time push fader controls to 0 and back up to 10 Example Cue 5 Go plays back cue 5 Pressing Go again plays the next cue on the cue sheet 8 38 Expression 2 0 Grand Master The Grand Master pot overrides all other channel level settings except Black out Normally the Grand Master is set at 10 100 percent so that all channels operate at 100 percent of their set levels When the Grand Master is set at a level less than 10 channel outputs equal current settings multiplied by the percentage level at which the Grand Master is set The current Grand Master setting is displayed in the upper left corner of the screen It is not displayed when Black out is activated in which case Black out flashes in the upper left corner Chapter 8 Reference 8 39
36. lit and you are selecting chan nels press to highlight the preceding channel or to highlight the next channel Or once you have selected the channels you want press At to indicate that you are entering levels Then use and to adjust the level one point at a time Shortcut To select all channels with the minimum keystrokes press Chan 1 Thru This selects all channels from one to the channel before it which Expression reads as the last channel Example Chan 1 At ll I I decreases channels one s intensity level one point at a time 8 50 Expression 2 0 Page Page has two functions one is to select submaster pages the other is to display the Submaster and Group Sheets Submaster pages Expression has two pages of submasters Each page stores a complete set of recorded submasters This doubles the number of available recorded submasters Expression displays the message Page 1 Loaded or Page 2 Loaded in the message display window to indicate which page is currently active To switch pages press Page enter the new page number and press Enter The message indicates the new page number and displays the message Loading instead of Loaded When you load a new page any submasters set at a level above zero remain on stage until you pull them down to zero This prevents the stage from going black when you switch pages Submasters remaining from the previous page are indicated by flash
37. recorded level press At and enter a two digit level To playback a cue at full recorded level press Full Note When you play an effect in autoload the level and rate set tings will be applied to channels on stage from the previously run cue Expression 2 0 5 To modify playback rate press Time Enter a number between zero and 100 to indicate playback rate zero stops the sequence 50 plays it back at the recorded rate and 100 flashes through cues or steps instantaneously 6 Enter cue number you want to play from CD fader and press Enter 7 Repeat steps four and five if necessary for second cue Playing back autoloads To playback autoloads press Autoload and enter number of the autoload you want to playback Then press either Go key When you playback autoloads the left fader in each fader pair controls intensity levels The right fader controls the playback rate When you begin an autoload with the right fader at 10 Expression plays it back at the recorded rate the LED strip indicates 50 percent on the right fader To take manual control of the playback rate move the fader to 50 percent Then move the fader up or down to adjust rate 10 is instanta neous playback through steps or cues and 0 stops playback If right fader is set at any position other than 10 when you start the autoload the linked cues or effects playback at the rate set on the fader Chapter 5 Learning advanced techniques 5 47 L
38. sections of this chapter Timed fader pairs and Grand Master Numbers next to submaster pots indicate the percentage of the re corded levels at which the submaster is set Scale numbers are divided by 10 For example if pot is set at 5 the submaster is output at 50 percent of recorded levels Chapter 8 Reference 8 55 Power The power switch is key operated Both keys shipped with your console work in the power switch To turn the console on insert the key and turn it to the ON position To turn the console off insert the key and turn it to the OFF position We recommend that you turn the console power switch to the OFF position before you plug or unplug the power cable Warning Always remove keys from console before shipping Expression 2 0 Rec indicates that you want to save a look that is currently on stage or on the screen as a cue group submaster or autoload When you record a cue using Rec levels are recorded only in the specified cue To save a look press Rec Expression assumes that you want to save the look to the current mode you are in For example if the Cue LED is lit Expression assumes you want to save the look as a cue when you press Rec However you can save a look in any of the preceding forms regardless of the active mode In fact you can save the same look in as many different forms as you wish To record a look 1 Press Rec 2 If you want to save the look in the same format indi
39. selecting groups Press Rec Press Page and enter the page number onto which you want to copy the submaster if it is not the currently loaded page Enter new submaster number and press Enter Or press the submaster bump switch Chapter 4 Learning the basics 4 47 Deleting submasters You must be in Blind to delete individual submasters To delete all submasters and all other show information you can use the Set Up Menu option Diagnostic system clear It is described on page 8 21 To delete submasters follow these steps 1 Press Blind and then Sub 2 Enter submaster number you want to delete 3 Press Clear 4 Press Rec to delete the submaster or Clear to cancel the action 4 48 Expression 2 0 Submaster sheet Submaster sheet is a feature of Expression s expanded memory option It is available only when expanded memory is installed Submaster sheet allows you to view submasters on the display screen All 24 submaster pots per page are represented on the submaster sheet Submasters with recorded levels are displayed in green those with no recorded levels are displayed in blue Inhibitive submasters are displayed in red If a submaster is recorded with specified upfade and downfade times the times are displayed Alphanumeric names are also displayed if this option is installed The submaster sheet lists all 24 submasters Page one and two are displayed separately Follow these steps to display su
40. show in console chapter 5 learning advanced techniques The lessons in this chapter address advanced features that allow you to use Expression more efficiently and to create more complex lighting effects Before you start the lessons you should know how to create and play back cues and submasters and how to take manual control of timed fades Chapter 4 Learning the basics includes lessons on these tasks The lessons in this chapter will teach you how to Create and run multipart cues Use Track record function Use Track Sheet Use Group feature Create and run effects Create and run subroutines Create and run autoloads Create and run macros Each of these features is described briefly below Multipart cues A multipart cue is a cue that consists of two or more parts Each part is in effect an individual cue with its own levels and upfade and downfade times A multipart cue allows you to simultaneously run and control up to eight discrete looks through one multipart cue Each part may have its own fade and wait times A multipart cue takes up the equivalent storage space of three cues Expression 2 0 Track record function Track is a record function that allows you to modify recorded cues and designate new levels for the displayed cue only or to track them forward until a different level is encountered It also allows you to quickly modify groups of cues and add channels to cues You can also use it to create a new cue from t
41. three through six to create each part Note When all of the channels are assigned to a part part eight is automatically deleted Chapter 5 Learning advanced techniques 5 7 Editing a multipart cue Once you have created a multipart cue you can add or delete channels from the parts change channel levels or change fade and wait times Adding deleting and modifying channels Follow these steps to make changes to a multipart cue 1 Press Blind Expression displays the Blind mode screen The Cue LED lights prompting you to enter a cue number Enter the cue number Press Step Part then press or until the part you want to edit is displayed Note When you initially display a multipart cue the channels that are tracking from the previous cue are displayed in green those that are at new levels are displayed in blue When you press Step Part to display a part channels that make up the selected part are displayed in blue channels that make up other parts of the multipart cue are displayed in green Press Chan and select the channels you want to modify To add channels Set intensity by level of new channels by pressing At and entering a two digit level moving the fader wheel or pressing and To delete channels Set channel levels to zero by pressing At 0 0 To change level settings Set new intensity level by pressing At and entering a two digit level moving the fader wheel or p
42. to 25 charac ters Submaster names can have up to 10 characters Group names can have up to 25 characters You may enter the name using overwrite or insert mode In over write you type over any previously entered characters in insert mode each new character pushes the previously entered characters one space to the right Press Insert on the keyboard to toggle between insert and overwrite mode Press F2 to delete all text in the naming window Press Enter on the alphanumeric keyboard to record the name or press Esc to quit and return to the original Expression display screen 7 4 Expression 2 0 Naming shows You can use the alphanumeric keyboard to name the show currently loaded in the console The names you give shows can consist of letters numbers or the symbols amp L Z as well as the comma and period Follow these steps to name a show 1 2 Press Setup Press F1 on the alphanumeric keyboard and enter the name you want to give the show The show name can have up to 25 charac ters You may enter the name using overwrite or insert mode In over write you type over any previously entered characters in insert mode each new character pushes the previously entered characters one space to the right Press Insert on the keyboard to toggle between insert and overwrite mode Press F2 to delete all text in the naming window Press Enter on the alphanumeric keyboard t
43. to add fade times Press Time Enter upfade time in minutes and seconds or as a fraction of a second as a decimal and press Enter Upfade time cannot exceed two minutes Enter wait time and press Enter Wait time is the length of time the submaster holds a look before starting to downfade To enter an infinite wait time press If you record a submaster with an infinite wait time the submaster will not fade out until you press the bump switch again If you do not enter a wait time upfade runs as long as you press the bump switch the downfade begins when you release it Therefore when you haven t recorded a wait time and if you don t hold the bump switch for the duration of the fade time channels do not reach their full recorded levels Also if you press the bump switch and hold it beyond the length of the upfade time the downfade does not begin until you let the switch up Note The wait time for a submaster begins at the end of the uptade versus a cue wait time that begins at the start of the upfade Enter downfade time in minutes seconds or as a fraction of a second as a decimal Downfade cannot exceed two minutes Press the bump switch to start submaster upfade The submaster runs as described above 4 42 Expression 2 0 Controlling submaster fades manually When a timed submaster pot is set at zero and you press the bump switch recorded fade times playback as you recorded them However you can take m
44. with MIDI option will display a message indicating so during system boot Expression both transmits and receives MIDI messages with any MIDI instrument The MIDI protocol can operate cues macros and submaster bump switches ETC assumes that MIDI users have a working knowledge of MIDI This section provides MIDI interface information message formats and message definitions If you need more technical information about MIDI contact ETC Note Macros cannot execute MIDI commands Chapter 7 Accessories 7 15 Interfacing with MIDI Follow these steps to connect MIDI equipment to Expression 1 2 Turn console power off Insert standard MIDI cable into the connector on the back of the console labeled MIDI In Warning Do not insert MIDI cable into connector labeled Keyboard doing so may damage MIDI equipment 3 If you are sending MIDI commands from the console insert another standard MIDI cable into the connector on the back of the console labeled MIDI Out Set DIP switch B7 on up position DIP switch B7 is located on the DIP switch panel label SWB on the back of the console Turn console on Press Set Up to display Set Up Menu Then select 6 System Settings and press Enter to display the System Settings Menu Select 5 Select MIDI channel and press Enter If MIDI option is not installed or if DIP switch is not correctly set Expression displays the message Optional feature not installed on this sy
45. 0 fade times 3 14 fader clear times 3 15 Full levels 3 14 Setting Real Time Clock 7 20 Setup Menu 8 59 Shows naming 7 4 Softpatch 6 10 captured channels 3 10 channel zero 3 4 custom 3 4 entering 3 2 inhibiting dimmers 3 8 one to one 3 3 patching 3 6 proportional 3 8 Solo 4 19 8 60 Stage 4 2 8 62 8 63 Stage display 6 11 Step Part 8 63 Stop See Hold Storing disks 6 16 Style 5 36 Sub 8 64 Submaster Sheet 4 48 6 7 6 13 8 65 Submaster window 4 5 Submasters 4 36 6 12 8 64 copying 4 46 deleting 4 47 in macros 5 50 inhibitive 4 43 manual fades 4 42 modifying 4 45 naming 7 3 pages of 4 38 record 4 39 record to a different page 4 40 Subroutines 5 36 creating 5 37 deleting step 5 40 inserting step 5 40 playing back 8 71 plusfade 8 74 System configuration 2 6 System Settings Menu 3 13 8 66 T Text conventions 1 5 Thru 8 68 Time 8 69 Timed faders 4 26 Track 5 2 5 9 5 10 8 72 allfade 5 15 Track Sheet 4 3 5 2 5 17 6 14 8 73 Tracked channels 4 7 Tracks extending 8 14 Type 8 74 U Unpatching dimmers 3 11 Update 4 46 8 75 cues 8 75 groups 5 24 8 75 multipart cues 8 75 submasters 4 46 8 75 Using this manual 1 3 vV Verify show 4 52 6 19 Viewing cues 4 23
46. 2 0 Bump switches Bump switches push untimed submasters to 100 percent immediately and hold them at that level for as long as you press the bump switch If the submaster has timed fades pressing the bump switch initiates the upfade For timed submasters with no wait time pressing and holding bump switch initiates upfade releasing the switch begins the downfade For submasters with programmed wait times press and release bump switch to initiate the upfade Submaster plays with programmed upfade wait and downfade times To reverse the direction of the fade press bump switch again You can reverse a timed submaster during either its upfade or its downfade Pressing the bump switch during a wait will interrupt the wait period and start the downfade When you press a bump switch or when a timed submaster is playing back the LED flashes until you release the key or the fade is complete A lit green LED indicates that a regular submaster is recorded in that pot A lit red LED indicates that an inhibitive submaster is recorded in that pot If no LED is lit a submaster has not been recorded in that pot Note You can disable bump switches by selecting the Enable Disable option from the System Settings Menu See the section titled Enable Disable bump switches on page 3 15 for more information Chapter 8 Reference 8 9 Recording submaster using bump switches You may also use bump switches to indicate the submaster in which you want
47. 5 Learning advanced techniques 5 9 Lesson 2 Track record function The Track record function records the levels currently displayed on the screen in a cue and allows you to create tracks into subsequent cues A track is created by a channel whose level does not change through a series of consecutive cues Track creates tracks by pulling channel levels from the previous cue in Blind mode or by adding tracks to existing cues in either Blind or Stage Cue levels are usually set live working in Stage mode When you record a series of cues you typically record the first cue of the sequence The second cue is built from the first with some of the channels changing but many remaining the same The third cue is built from the second and so on until a major change such as a black out is recorded This procedure results in many channels being set to a level in one cue and staying at that level for several cues These tracks develop regard less of the record function Record or Track you use to record the cues Channels levels displayed in blue on the Blind screen indicate that the channel has moved to a new level in that cue This serves as a blocking level when you create a track Channel levels displayed in green on the Blind screen indicate that the recorded level is the same as in the previous cue The following examples demonstrate how Track works and compare it to how Record works The examples include five cues each with five
48. 8 21 DIMA aaa e a a a a a a a wen nt Sat ha a ae 8 22 DIMIMEL OF OMES ie osier e TETEA EER OSCE 8 23 ETfECTS KEYG itn ER E sia R a 8 26 ENTET eenen a Rea Rant ire a daa e E a A 8 27 EXCEPT aia ale Settee aa aie cee e e a ender 8 28 EXpa NA srren een a a a a aa a 8 31 Faderdisplay merene n at kh ee A ee E a ee e Poea 8 32 Fader WES toui doc mes escent aa n a a e a ad eoadtde whore 8 33 PEAS sit aa E E E E E AAT 8 34 FIGKICMANME leese a a n a a an a Mech 8 35 Ul AEE EEEE E AE E AESA ge ALEE EREE E E E E E 8 36 GO daent aa aea ea a a a ea eea 8 37 Grand Master ren a e aa a Oe at aaa cas Ot 8 38 EE a OETA EE I LE E EE I E AN I E AE E AT 8 39 Group SNES Ths a a A ol SR ae A ed ee 8 41 FS Piet cetonste ate cevtradaeaetiss peueeiedan as reatchlae eter dy aetettlini a eenias ee Aaaa 8 42 Hola ana a a a a PON SOE 8 43 finite wat tines rears u Toena n E n A E A EAA 8 44 INAIBItIVE SUBMASTERS keine aunan a e a a baci aes 8 45 ENRE ae a e a n a a E Atel Les 8 46 Machos aen e A a Be aa n a a ae Bs Be 8 48 MINUS araen a aE E A aa eain 8 49 Ee E EE E E E E 8 50 Patean a a e a an a a e a Aa ta 8 52 PUSTE a ae a E a EE E Or EO 8 53 Potentiometers Pots ir nes aeee Ra clad A TA A 8 54 POWER ic EER REER EIN EE ELA Nee tak EEE E EAE N 8 55 REC anma nea aa a Raa a a e on ale 8 56 Recorda aaa a CN STA a a CIS SRO OR Se a 8 57 aE ET AEAEE EET E A EEE A AAAA a 8 58 SOtUP EE N hin hed Gil ein hie 8 59 Solenan n ea a a aetetadt a a a e alg 8 60 eee a e E tate
49. ANU Al 248 tere cease a a a A 1 3 Text CONVENTIONS ccc cece eceeccec cece eee ceeeeteceecacaeeaeeeeeeeeeeseeseencesuesaeeeeeeenens 1 5 Pilen convention 3323 5 setter adit Meth teats a eh ihe uh eth ae oblate he 1 5 E ae EENE Pace ee AG tN ie AT 1 6 GUSTOMEF SEIW ICO onii a A EA nid EAEE leeds 1 6 Chapter 2 Installation nnn Zi Expression back Panel ccccccccceceeeeeecceececneceeeeeeeeeeeteeseesuesaeeeeeeenens 2 2 Installing your console and MONItOT cee cee eeee cee ceceeeeceeesteteeeeeeeeees 2 3 Installing two MONITO S a since assed ee ener ieee a 2 4 Monitor connectors and pinouts ccceeecececeeeeeeeceeeeereeeeeeeeeees 2 5 Monochrome monitors RS 170 ccccccceeesseceeesesseeeeeseeseeees 2 5 Color RGB MON LOLS kacie era aree e ae EE 2 5 Entering system configuration sssssesssseriissttrrittttrrittrttrrtrttrrrr rrena 2 6 Installing AiINMETS ssai nnna i e E ia aaa 2 8 Digital outputs DMX512 ETC LMI D192 dimmers 005 2 8 Analog wire per dimmer output optional 00 2 8 Analog wire per dimmer input optional cceeeeeeeeeeeeeeeeees 2 9 AMX192 analog multiplex Optional cccceeeccceeceeeeeeteeeeeeeeees 2 9 Installing Printers va Sian Be a AL 2 10 Parallel PUNTES Mirtes n dienes aeaaea lee rants fa ud 2 11 Ella PUEIS ari ro a Gia ceese se ela cacdatns ee ted deat 2 12 Installing Designer s Worksheet ceecee
50. C 2 10 Expression 2 0 Installing printer Expression supports both serial and parallel printers Printer functions are described in Chapter 6 Using print and disk options Pinout and connector specifications are on the next page Follow these steps to install printer ale Parallel printers Insert parallel printer cable into connector labeled Parallel on the back panel of the console Serial printers Insert serial printer cable into connector labeled Serial on the back panel of the console Set printer protocol at 1200 baud 8 data bits 2 stop bits no parity Insert opposite end of printer cable into printer With the console on press Set Up Select 6 System Settings and press Enter Select 10 Serial Parallel Printer and press Enter Enter 0 to select serial printer or 1 to select parallel printer and press Enter Turn printer power switch on and verify that printer is on line Chapter 2 Installation Printer connectors and pinouts Parallel printer and Centronics interface adaptor Console connector Printer connector DB25F Centronics D36 Pinout Signal Pinout 1 STRB 1 2 DO 2 3 D1 3 4 D2 4 5 D3 5 6 D4 6 7 D5 7 8 D6 8 9 D7 9 10 ACK 10 11 12 13 ___ not used 11 12 18 14 to 25 ne 13 to 17 19 to 36 2 12 Expression 2 0 Serial printers Console connector Printer connector DB9F DB25M Pinout Signal Pinout 2 Data in 2 from printer 3 Data out 3 t
51. CXL1ESSION Lighting control system Version 2 0 User manual March 1991 Copyright Electronic Theatre Controls 1991 Limited warranty Electronic Theatre Controls ETC warrants to the original owner or retail customer that for a period of one year from date of delivery of a portable system or energization of a perma nently installed system up to a maximum of 18 months from delivery its products will be free from defects in materials and workmanship under normal use and service Warranty is limited to 90 days for rental equipment Warranty does not cover any product or part of a product subject to accident negligence alteration abuse or misuse or any accessories or parts not supplied by ETC Warranty does not cover consumable parts such as fuses lamps color media or components warranted directly to the owner by the original manufacturer ETC s warranty does not extend to items not manufac tured by us Freight terms on warranty repairs are FOB ETC factory or desig nated repair facility Collect shipments or freight allowances will not be accepted ETC s sole responsibility under this warranty shall be to repair or replace at ETC s option such parts as shall be determined to be defective on ETC s inspection ETC will not assume any responsibility for any labor expended or materials used to repair any equipment without ETC s prior written authoriza tion ETC shall not be responsible for any incidental general
52. Er SCC E EE NEE T A E E N E ENT 6 4 Designer s Worksheet 0 0 ccccecceeececneceeeeeeeeeeeeeesennnecuesaeeeeesenens 6 5 Ee ela AIRE A R T EEE EET haere A E A E TA 6 6 Group SHEE tere atea E a E E E E ES 6 7 IENEI AEE E O E E E E 6 8 Real time Programs redier ren a aa a a ea 6 9 SOPA ee a a a a TS 6 10 Sage display eonen a a E E E ONEROA 6 11 SMDIMASTO E A r ET 6 12 SUBMAStEr Shet narede a AA EA 6 13 WACK SMSC ES E AS TE SATSE et EAA EOT ASETE S 6 14 vi Expression 2 0 DISKIMANAGEMENT asire Elo cis ete ethene Neidio ai e i 6 15 Stoma Ske waved sexe R A ERE en eset ae 6 16 Formatting ASKS eirean ieia eee a s 6 16 Recording a show on CiISK cccceeceeeeeeeeeceeeeeeteeeceeeceeeeeeeeeeeeeeeees 6 17 Reddinga SHOW TONV GISK ais arase n en p EORI 6 18 Verify SHOW ON GEK wann aa an aE RR AREATA die 6 19 Eraseshow Tom Giok enruenssierie eea enee as 6 20 Chapter 7 ACCeSsories nn 734 Alphanumeric keyboard cccccccceceecceeceeeceeeeceeeeeeeeeeececetensseeeeeeeeees 7 2 Naming cues Submasters and groupS ccceeeeeeeeeeeeeeeeeeeeeeees 7 3 Naming ShOWS22 c c0co uae a a a teehee 7 4 Designer s Worksheet ccccccccceeeeeeeeeceecceeaeeeeeeeeeeetestensncsueeeeeeeees 7 5 Using thedigtize esatea a a eE a a 7 6 Programming FEGIONS eeecceecceceeeeeeceeeeeeeeeeeeeeeeeeeeeseetenteeaeeees 7 7 Deleting regions 22 2ics sek eee hed ede dese and E Es 7 9 Infrared Remote Focus Unit IRFU cc ccceeceee
53. Expression displays the message Page 1 Loaded or Page 2 Loaded in the Page Display window to indicate which page is currently active To switch pages press Page enter the page number you want and press Enter The message indicates the new page number and displays the message Loading instead of Loaded When you load a new page any submasters set at a level above zero remain on stage until you pull them down to zero This prevents the stage from going black when you switch pages Submasters remaining from the previous page are indicated by flashing bump switch LEDs Submasters on the new page are not loaded into pots until you pull them down to zero The message Loading remains on the screen until all submasters on the new page are loaded Note When you read a new show into the console from a disk the console loads the same page number that was loaded from the previous show If any submasters are on stage when you read a new show into the console they will remain on stage until you pull pots down to zero Submaster LEDs flash to indicate that the associated submaster levels are not from the currently loaded page Chapter 4 Learning the basics 4 39 Creating pile on submasters Creating a submaster is as easy as creating a cue You can create submasters in Stage or Blind mode To create a submaster follow these steps 1 Select channel and level settings as you did for cues See Lesson 2 Creating cues if you need a revi
54. HH WAIT n NOT RECORDED CLEAR CLEAR 3 4 3 6 7 9 1B ii 12 amp seLecT CHAHNEL NUMBERS Grand master setting The grand master setting displays the master intensity level With it you can proportionally inhibit the level of all channels The grand master overrides all other settings 2 Mode label This field displays the current mode either Stage Blind or Fader I Keypad prompt window This window indicates how the console will interpret the next number you enter from the keypad For example if you press Chan the keypad prompt window displays the message Channel indicating that the console will read the next number you enter as a channel number Tt Channel display The channel display lists available channels and their current levels If you have a color monitor Expression color codes level displays to Chapter 4 Learning the basics 4 5 provide additional information about channels For example in Blind mode tracked channels are green See the section Channel modes on page 4 6 for further description Note In Flexichannel display mode only selected channels and channels that are part of a recorded cue submaster group or effect are dis played other channels do not appear on the display screen Channels are displayed in vertical columns rather than in horizontal rows The Flexichannel display is a feature of Expression s expanded memory option See Chapter 8 Reference Flexichannel for more informati
55. NTROL SYSTEM ELECTRONIC THEATRE CONTROLS INC TRACKSHEET FOR CHANNEL 06 CUE 1 1 TO 600 00 FF 00 20 23 23 1 50 50 50 00 28 31 32 32 6 00 50 50 50 50 FF 34 36 37 38 39 41 00 00 68 50 50 FF FF 00 41 2 41 5 100 500 500 1 500 2 500 3 500 4 00 FF FF 00 00 00 00 00 FF 500 6 500 7 520 520 1 520 2 520 3 600 00 00 00 00 FF FF 00 Chapter 6 Using print and disk options 6 15 Disk management Expression s disk drive lets you save up to two shows per standard 3 5 inch computer disk This allows you to work on more than one show at a time or to use more than 400 cues for your production by loading a second show into memory after the first 400 cues If you have installed expanded memory only one show may be saved per disk We recommend that you make two back up copies of each show on separate disks and that you keep them in different locations If your show disk were damaged a back up disk stored at home could save you hours of work When you select disk options any fades in progress are stopped Therefore if you need to load an additional show in the middle of a performance load it between cues when all channels are static Disk options do not affect channel levels that are not currently fading Before you can use a disk in Expression you must format it on the console Formatting instructions are on the following page Note If you read a show that you saved from an Insight console Expression will not read the su
56. Out but not by Grand Master Dimmer profile graphs 100 90 80 70 60 50 Intensity 40 30 0 10 20 30 40 50 60 70 Percent fade complete 100 90 80 70 60 50 Intensity 40 30 0 10 20 30 40 50 60 70 Percent fade complete Expression 2 0 Linear IES square Slow bottom 80 90 100 Fast bottom Slow top 80 90 100 Chapter 8 Reference Intensity Intensity 100 90 80 70 60 50 40 30 20 10 10 20 30 40 50 60 70 Percent fade complete E Fast top Full at 1 80 90 100 30 40 50 60 70 Percent fade complete E Preheat 5 i Preheat 10 Hot patch 8 26 Expression 2 0 Effects keys Effects are cues that include a series of steps The effect plays back the steps to produce one of the special effects described below Each effect can hold up to 10 steps each with up to 10 channels Steps list channels the high and low intensity level limits for those channels and the fade or wait time for those channels Effects are cues and are therefore included in the 400 cue limit Detailed instructions for working with effects are included in Chapter 5 Learning advanced techniques To display effects screen press Blind Type 3 Enter Styles The following four playback effect styles are available Loop Runs through steps consecutively returns to the first step and repeats the loop Channels flash rather than
57. Selecting cues in Track Sheet To select cues while in Track Sheet follow these steps 1 Press Cue 2 Enter cue numbers and And or Thru to enter a group of cues Example Track Sheet Cue 1 Thru 5 selects cues 1 through 5 from the Track Sheet Numbering cues Expression has a 400 cue limit per show However you can number cues from 1 to 999 9 using up to one decimal place Naming cues Expression s expanded memory features an optional alphanumeric keyboard option With the keyboard you can name cues submasters groups and shows Follow these steps to use the keyboard to assign a name to a cue 1 Make sure the keyboard is properly connected See instructions in Chapter 2 Installation 2 Press Stage or Blind 3 Press Cue then enter the number of the cue you want to name 4 Press F1 on the keyboard then enter the desired cue name See Chapter 7 Accessories page 7 3 for more information on naming conventions 5 Press Enter on the keyboard to record the name 6 Press Esc on the keyboard to quit and return to the original display screen 8 20 Expression 2 0 Delay time To change the delay time for linked cues or cues linked to macros follow these steps 1 Press Cue and enter the first cue in the link 2 Press Link twice 3 Enter the delay time in minutes and seconds 4 Press Enter Example Cue 1 Link Link 5 Enter enters a delay time of five secon
58. You can also select a range of steps by pressing Step Part and then entering step numbers with Thru and And 5 36 Expression 2 0 Lesson 6 Working with subroutines A subroutine is a cue that controls the playback of a series of existing cues The subroutine feature lets you change fade rates for the subrou tine without changing rates in the original cues You can use subroutines and effects to create similar looks However subroutines have some advantages over effects Since each step of a subroutine is a cue with proportional levels you can create loops or chases with proportional looks Also since subroutine steps are actual cues there is no limit to the number of channels you can use Styles The following playback styles are available for subroutines Styles are entered as steps When the subroutine plays back the steps play back in numeric order until the subroutine reaches a style step The style step then determines which step will play back next Loop Runs through steps until Loop step returns to first step and repeats sequence for the number of times you specify Bounce Runs through steps until subroutine reaches Bounce step then runs through steps in reverse order Plays back in this pattern for the number of times you specify Jump to cue Runs through steps until subroutine reaches Jump to cue step Auto matically starts another cue not included in the subroutine You can jump to any type of cue r
59. a DM 512 ETC LMI D192 Clock ETC LMI only Clock ETC LMI only aRWN Caution If you do not use the ETC LMI protocol do not connect wires to pins four and five Analog wire per dimmer output optional Connector Centronics D36 female 3 connectors per 96 output card 6 connectors maximum 192 dimmers Pinout Connector one Pins 1 32 dimmers 1 32 Connector two Pins 1 32 dimmers 33 64 Connector three Pins 1 32 dimmers 65 96 Connector four Pins 1 32 dimmers 97 128 Connector five Pins 1 32 dimmers 129 160 Connector six Pins 1 32 dimmers 161 192 All connectors Pins 33 36 common Earth ground Chapter 2 Installation 2 9 Analog wire per dimmer input optional Connector Centronics D36 male 3 connectors per 96 input card 6 connectors maximum 192 dimmers Pinout Connector one Pins 1 32 dimmers 1 32 Connector two Pins 1 32 dimmers 33 64 Connector three Pins 1 32 dimmers 65 96 Connector four Pins 1 32 dimmers 97 128 Connector five Pins 1 32 dimmers 129 160 Connector six Pins 1 32 dimmers 161 192 All connectors Pins 33 36 common Earth ground AMX192 analog multiplex optional Connector XLR 4 pin male 192 dimmer outputs per connector 384 outputs maximum 2 connectors Pinout 1 Common Earth ground 2 Clock 3 Analog data 4 Clock Note You can configure console for Strand CD80 Dimmer and Dimmer ll cabling convention Contact an authorized dealer or ET
60. a description of the key you pressed Help screens are not available for menu options Example Help Set Up displays the Set Up help screen Chapter 8 Reference Hold Hold stops the playback of the cue in the fader pair above the key To resume the playback press Go To cancel the playback press Hold again The faders hold current levels until you play another cue or clear the fader pair Example Cue 1 Go Hold begins playing back cue 1 and then puts it on hold 8 44 Expression 2 0 Infinite wait times Expression lets you enter an infinite wait time on submasters An infinite wait time holds a timed submaster for an indefinite period of time To start the downfade press bump switch again ls 2 Example Press Time Enter upfade time and press Enter Press and press Enter Expression displays INF to indicate an infinite wait time Enter downfade time and press Enter Sub 1 Time 5 Enter Enter Enter enters five second up and down fade times and an infinite wait time for a new submaster Chapter 8 Reference 8 45 Inhitbitive submasters Inhibitive submasters are submasters that include a set of channels whose levels you can limit to a specific level Inhibitive supbmasters work similarly to the Grand Master but for a limited number of channels When an inhibitive submaster is set at 10 100 percent no channels are affected by it When the submaster i
61. age display The Stage display report prints channel settings as they currently appear on Stage When you select the Print Stage Display option Expression sends the report to the printer immediately No options are available for this report From the Print Options Menu select 1 and press Enter EXPRESSION LIGHTING CONTROL SYSTEM ELECTRONIC THEATRE CONTROLS INC 20 21 22 23 24 25 26 27 28 29 30 31 44 45 46 47 48 49 50 51 52 53 54 55 68 69 70 71 72 19 19 73 74 75 76 77 78 79 92 93 94 95 96 97 98 9910 1 2 3 4 6 12 Submasters Expression 2 0 The submaster report prints each submaster on a separate page From the Print Options Menu select 4 and press Enter Enter the first submaster number you want to print or enter O if you want to print all recorded submasters Press Enter If you are selecting a range of submasters to print Expression prompts you for the last submaster number you want Enter the last number and press Enter Expression sends the report to the printer To cancel the print operation before Expression sends the report to the printer press Clear EXPRESSION LIGHTING CONTROL SYSTEM SUBMASTER 53 UP 00 00 123 4 5 6 7 8 FF FF FF FF FF 11 03 25 26 27 28 29 30 32 11 11 11 49 50 56 34 80 WI MAN 9 03 33 11 57 10 17 34 34 58 11 17 35 34 59 DN 00 13 34 37 20 61 11 85 00 14 PILE ON 15 16 17 18 07 39 10 63 11
62. ailable from your dealer or ETC 14 10 11 Expression 2 0 Set the three sets of DIP switches on the worksheet as indicated in the chart below Switch A 1 2 3 4 5 6 7 8 Off Off On On On On On Off Switch B 1 2 3 4 5 6 7 8 Off On Off On Off Off On On Switch C 1 2 3 4 5 6 7 8 On On Off Off Off Off On Off Turn the worksheet power on by pressing the on off switch The LED labeled Indicator is lit when power is on If LED blinks four times after you turn the power on the interface cable is not con nected correctly Expression displays the message DWS ON when the worksheet is properly installed and turned on Press Set Up and select 6 System Settings Select 17 Designer s Worksheet Options Expression displays Designer s Worksheet Options Menu illustrated on the next page Chapter 2 Installation GRAND MASTER 1007 SELECT FUNCTION 2 15 DESIGNER S WORKSHEET OPTIONS l HENI i 12 12x12 12x12 12x12 12x12 17812 17x12 ONSOLE CONTROLS LOCKED OUT OHSOLE CONTROLS ACTIVE CONSOLE CONTROLS LOCKED QUT a2 CONSOLE CONTROLS ACTIVE THEN PRESS ENTER TURM TO SETUP MENU Select one of the displayed options Options three through six are available only if your console has an expanded memory board Expanded memory increases the number of available macros and regions from 125 to 640 2 16 Expression 2 0 Installing Remote Focus Unit The Remote Focus Unit RFU
63. ally When you play a string of linked cues or a chase loop you only need to start the first cue Timed faders and LED displays Each fader has a strip of LEDs next to it When running a timed crossfade cue the lit LEDs indicate how much of the cue has run This is displayed as a percentage For example when the LED s are at 5 50 percent of the cue has run In default operation Expression s faders function in level override mode In level override faders control the percentage of completion of the fade and can be used to take manual control of fades Alternatively you may choose to use the faders in proportional rate override In this mode the faders control the rate of the fade with the A and C faders controlling the upfade rate and the B and D faders controlling the downfade rate For information on taking manual control of fades see the section titled Controlling fades manually later in this lesson Chapter 4 Learning the basics 4 27 Playing cues back To playback the cues you created in Lesson 2 follow these steps Al 2 5 Press Stage to display Stage mode Press Cue to indicate that you want to select a cue Enter the cue number you want to playback To playback cues you recorded from Lesson 2 press 1 1 Press either Go key Cue 1 1 begins Expression assumes that you want to play cue 2 next Press Go to start cue 2 If you press Go before a cue finishes playing the previous cue stop
64. alphanumeric keyboard allows you to assign names to cues sub masters groups and shows It is available only when expanded memory is installed Call ETC or your local dealer to add the expanded memory option to your console Once you have installed the expanded memory option you can install a standard PC XT AT compatible manually switchable alohanumeric keyboard The keyboard can be used only in the XT compatible mode Although many keyboards can be used with the Expression control conosle ETC recommends the Datacomp Electronics model DFK121A08 and Unitek K 155 keyboards Keyboards that have an Auto setting must be switched to XT mode Automatic switching keyboards must be manually set when used with Expression 2 0 Note Console must be off when keyboard is plugged in Refer to Chapter 2 Installation for installation instructions Chapter 7 Accessories 7 3 Naming cues submasters and groups You can use the alphanumeric keyboard to assign names to cues submasters and groups Names can consist of letters numbers or the symbols amp L Z as well as the comma and period Follow these steps to name a cue or submaster 1 2 Press Stagel Blind or Fader to select a display mode Press Cue Submaster or Group then use the Expression number keys to select the desired look Press F1 on the alphanumeric keyboard and type the desired name You can assign cues and groups names of up
65. ammingofupto32button sequenceseach 640macroareavailablewithexpandedmemory Optionalmemoryexpansioncardtoallowfor640macros Effects packages Subroutines Cannedeffects Simultaneousvariabilityofrateandintensityduringplayback Fullvariabilityofrateandintensityduringplayback Fader wheel e Proportionalintensitycontrolofchannelsorgroups Size and weight e 40x15 25x6inches e 35pounds ndex A Accessories alphanumeric keyboard 7 2 Designer s Worksheet 7 5 MIDI 7 14 Real Time Clock 7 18 Redundant Tracking Backup 7 22 Remote Focus Unit 7 12 Serial Button Protocol 7 21 Allfade 5 15 8 74 Allpart 8 74 Alphanumeric keyboard 2 18 4 9 7 2 installing 2 18 keyboard type 2 18 naming groups with 8 40 pinout 2 18 And 8 2 Autoloads 5 2 5 43 8 4 in Blind 5 45 in Stage 5 44 playing back 5 46 8 4 8 71 B Back key 4 34 8 5 Back panel illustration 2 3 Black out 8 6 Blackout cues 5 15 Blind 4 2 8 7 Boot options 2 7 Bump switches 8 8 enable disable 3 15 in macros 5 50 recording submasters with 8 9 c Captured channels 4 6 8 10 Chan 8 11 Channel display 4 4 Channel modes 4 2 4 6 Channel zero 3 4 Channels customizing 3 5 selecting 8 11 Clear 8 13 Clear faders 4 35 8 15 Clear show from memory 8 16 Clock 7 18 Connectors dimmers 2 8 Infrared Remote Focus Unit 2 19 keyboard 2 18 monitor 2 5 printer 2 11 Remote Focus Unit 2 16 Console installation 2 3 Crossfade 8 74 Cue 8 17 C
66. an hold two shows Warning Formatting a disk erases all information recorded on disk It does not affect the current show in console To format disk follow these steps 1 Insert standard double sided double density 3 5 inch computer disk in disk drive 2 Press Set Up 3 Select 5 Format disk and press Enter 4 Begin formatting by pressing Enter Or cancel format operation by pressing Clear You cannot cancel format after you press Enter Chapter 4 Learning the basics 4 51 Recording a show on disk To record a show from the console memory to a disk follow these steps 1 Insert a formatted disk in disk drive 2 Press Set Up 3 Select 1 Record show on disk and press Enter Expression displays the screen illustrated below 10 RECORD ONTO DISK SELECT SHOH MUMBER THEN PRESS ENTER T ABORT PRESS CLEAR SHOW 1 RECORDED SHOW 2 RECORDED USE DOUBLE SIDED DOUBLE BENSITY DISH ONLY If either show is currently recorded on disk the screen displays the message Recorded or the date recorded if you have the Real Time Clock option If no show is recorded on disk Expression displays the message Not recorded 4 Select either show and press Enter If the show number you select is already recorded the new show will overwrite the old show Or press Clear to cancel the operation 4 52 Expression 2 0 Verifying a show on disk The Verify show on disk option compares a show that i
67. and enter a number between one and 25 Press Enter to record autoload Note If you record an autoload with an effect or a cue in only one fader the other fader pair is unaffected when you playback the autoload This allows you to record the same effect in a number of autoloads with different rates and use the second fader pair to run any cues you want For example you may want to run the same effect at different rates on the cyc throughout a show You can use the second fader pair to run other cues at the same time Chapter 5 Learning advanced techniques 5 45 Recording previewing and modifying autoloads from Blind To record autoloads from the Blind mode screen follow these steps 1 Press Blind and Autoload Expression displays the screen illus trated below GRAND MASTER 188 BLIND l ALITO LOAD 1 l HOT RECORDED ALT LOAD SETUP INFORMATION CUE INFORMATION MUST BE EDITED IN CUE AUT o LOAD Bi A B CUE C D CUE AUT LOAD GE ALITO LOAD B3 A E CUE C D CUE AL B4 A B A FADER E FADER C FADER D FADER CLEAR 1 2 3 4 5 6 7 8 9 46 1 06 58 13 14 15 16 17 18 19 20 21 22 23 Abhinit tat ADCO aaa SELECT AUTO LOAD HUMBER 2 Enter autoload number you want to create or modify and press Enter 3 Enter cue number you want to play from AB fader and press Enter 4 For effects and linked cues you can modify level settings and playback rates in an autoload To enter a percentage of the
68. anual control over fades much as you can for cue fades You can increase the upfade rate by pushing the pot ahead of the programmed fade rate You can force the downfade to start early by pressing the bump switch but you cannot change the fade time Once a timed submaster is running pressing the bump switch changes the direction of the fade For example if half of the upfade is complete pressing the bump switch starts the downfade from 50 percent If a downfade is running pressing the bump switch begins an upfade again from the current level Hint You cannot cancel a timed submaster once it s started However you can force the channel levels to zero with the following key se quence Press Group Sub and the number of the running submaster Then press Inhib Sub and any available inhibitive submaster bump switch This puts all channels included in the running submaster in an inhibitive submaster Pull inhibitive submaster level to zero Modifying pile on submasters To modify a recorded pile on submaster follow these steps 1 Press Blind to display Blind mode 2 Press Sub and the number of the submaster you want to modify 3 To add or change channels Select channel numbers and set desired levels To change all channels proportionately Press Group Sub and enter the submaster number you are modifying This selects all channels at current levels Move the fader wheel to proportionately modify levels To delete c
69. ber you want for step one and press Enter Cursor moves to Upfade field Enter an upfade time from 1 seconds to 99 59 minutes then press Enter Cursor moves to downfade field Enter downfade time from 1 seconds to 99 59 minutes then press Enter Enter delay time from 1 seconds to 99 59 minutes then press Enter Delay time is the time between the start of one cue and the start of the next Repeat steps 6 through 10 to add cues as subroutine steps Press Style to select a subroutine style Styles are defined below When subroutine runs Expression plays back each step in the sequence as you have programmed up down and delay times When the subroutine reaches a style step the style you select instructs the subroutine which step to play back next 1 Loop Runs through preceding cues and then returns to first cue Enter the number of times you want the loop to return to the top of the cue list If you enter 5 the sequence will play 6 times Enter 0 for a continuous loop 2 Bounce Runs though preceding cues then plays them in reverse order One bounce equals running through the sequence forward once and reverse once Enter 0 for a continuous bounce 3 Jump to cue Links subroutine to another cue or subroutine Enter the number of the cue to link to 4 Hold for Go Forces subroutine to pause until Go is pressed Chapter 5 Learning advanced techniques 5 39 13 Complete entering all cue steps and style ste
70. ble 2 18 Expression 2 0 Installing the alphanumeric keyboard The alphanumeric keyboard is available only when an expanded memory card is installed You can use the keyboard to assign alphanumeric names to cues submasters groups and shows You can use a standard PC XT AT compatible manually switchable alphanumeric keyboard with the expanded memory option The key board can be used only in its XT compatible mode ETC recommends the Datacomp Electronics model DFK121A08 and Unitek K 155 keyboards Although you may be able to use keyboards from other manufacturers ETC does not guarantee the results Follow these steps to install the alphanumeric keyboard 1 Be sure the selector switch is set to the XT position 2 Insert the keyboard cable into the connector labeled Keyboard on the Expression back panel Note Console must be off when keyboard is plugged in Keyboard connector and pinout Console connector DIN 5 pin female Keyboard pinout Clock Data Reset Ground 5V DC aRWN Chapter 2 Installation 2 19 Installing Infrared Remote Focus Unit The Infrared Remote Focus Unit IRFU allows you to set channel levels check dimmers or run cues from remote locations in your studio or theatre The IRFU consists of two components a receiver and a trans mitter The receiver is connected to the console with a standard multi conductor cable The transmitter is a hand held wireless unit that sends infrared control si
71. bmaster sheet 1 Press Blind Sub Page to display submaster sheet page one 2 Press Page to toggle between submaster page one and page two Chapter 4 Learning the basics 4 49 Lesson 5 Saving your show on disk You should always make at least one back up copy if not two of each show you are working on Back up copies are stored on standard 3 5 inch double sided double density computer disks We suggest that you make back up copies of your work after every session during which you modify a show When you record a show to disk all information that you have entered in the console is saved This includes all system settings softpatch cues groups and submasters To make a backup copy of your work requires three steps each is included in this lesson e Format a standard double sided double density 3 5 inch disk on the console e Record show on formatted disk e Verify that show was properly recorded For more disk information and instructions on reading a show from disk see Chapter 6 Using print and disk options Naming shows If you have the expanded memory option and alphanumeric keyboard you can assign alphanumeric names to shows For information on naming shows see page 7 4 4 50 Expression 2 0 Formatting disks You must format disks in a console before you can record shows on them Expression cannot record shows on unformatted disks or disks that are formatted in a personal computer Each disk c
72. bmasters from the disk Likewise if you record a show on Expression and read it in an Insight console you will not be able to read submasters 6 16 Expression 2 0 Storing disks Computer disks are somewhat fragile magnetic devices for storing your work Therefore we suggest the following disk storage and handling practices to ensure that your work is not lost as a result of disk damage Store disks at a temperature between 50 and 140 degrees Fahrenheit Keep disks away from magnets magnetized objects or heavy electrical equipment Some large lighting equipment may damage disks Do not touch the magnetic disk inside the plastic disk case Do not eat drink or smoke when you handle disks Formatting disks Before you can use a disk in an Expression you must format it on an ETC console Disks formatted on a standard personal computer do not work in Expression To format a disk follow these steps Warning Formatting a disk erases all information recorded on it For matting does not affect show in console 1 2 Press Set Up Insert standard 3 5 inch double density double sided disk in disk drive Select 5 Format Disk and press Enter To format the disk press Enter To cancel the format command press Clear Warning When you select this option any fades in progress stop you cannot restart them except by reselecting cues from Stage and pressing Go again Chapter 6 Using print and disk op
73. boot performs a series of hardware tests If the tests find any hardware problems Expression displays a message indicating so The fast boot option skips the hardware test and therefore boots faster Both boot options test the memory that holds show information Expres sion displays a message during either boot option if it detects that the memory has been corrupted You will probably want to run the console with the fast boot option for convenience However you should select the full boot option periodi cally to run the console s hardware tests The boot option you select will perform tests the next time you turn console on To select a boot option follow these steps 1 Press Set Up to display the Set Up Menu 2 Select 6 System Settings and press Enter 3 Select 12 Full fast boot test and press Enter 4 Enter 0 for full boot test or 1 for fast boot test Then press Enter 2 8 Expression 2 0 Installing dimmers To install dimmers determine which of the following connectors are appropriate Then insert dimmer cables in appropriate connectors Dimmer connectors are illustrated on page 2 2 Caution Your dimmer control common must be compatible with console control common they must either be the same level or the dimmer control common must float Digital outputs DMX512 ETC LMI D192 dimmers Connector XLR 5 pin female 512 digital multiplex dimmers Pinout Common Data DMX512 ETC LMI D192 Dat
74. can use a standard PC XT compatible alphanumeric keyboard to assign alphanu meric names to cues groups and submasters The alohanumeric key board is an optional feature available with Expression s expanded memory option and is available only when expanded memory is in stalled See page 7 3 for more information on using the alphanumeric keyboard to name cues 4 10 Expression 2 0 Creating cues Five cues are included in the following instructions The first few are simple the rest use more complicated features This lesson includes the following sections Cue 1 Creating a cue in Stage Cue 2 Creating a cue in Blind Cue 3 Modifying up and down fade times Cue 4 Linking cues Cue 5 Creating a cue using Solo Deleting cues Viewing cues There are several methods you can use to create any one look with Expression Deciding how to create a look depends on your situation and what information is already stored in the console If you have several cues already stored you may want to use the look from one cue and add to it to create another In another circumstance you may want to enter all channel levels from scratch If you are in the middle of a tech rehearsal you will probably want to use Stage mode so you can see your adjustments live If you have a good idea of how you want cues to look you may want to record the show in Blind ahead of time The following instructions include general instructions with numbered steps Th
75. cated in the operator prompt enter a cue group submaster or autoload number If you want to save the look in a format other than that indicated in the operator prompt press the appropriate key to indicate what form you want to save the look in Cue Group Sub or Autoload 3 Enter a number to identify the look you saved and press Enter You can also indicate what form you want to save the look in before you press Rec If you try to record a look with a used number Expression displays the message Cue recorded or whatever form you are saving flashing on the operator prompt line If you press Enter the new look will replace the previously saved look To cancel the operation press Clear You can then enter a different identification number for the look Note If you record a modified cue that is in a playback fader pair the changes are reflected in the fader That is when you release the chan nels that you modified the changes remain on stage Example Rec Cue number Enter or Rec number Cue Enter both record cues Chapter 8 Reference 8 57 Record The key switch labeled Record lets you disable the record function When the switch is set at On you can record all show information as described in this manual When switch is in the Lock position all play back functions work but you cannot change or record show information from the show in memory Expression 2 0 Rel releases captured channel
76. channels When a channel changes level from one cue to the next it is printed in bold on the following pages tracked channels are printed in regular print This is similar to how Blind mode displays levels on a color monitor channels that change intensity are displayed in bright blue tracked channels are displayed in green Using record to create tracks Expression 2 0 In Stage mode the following keystrokes create the five cues illustrated below Each cue adds channels to the previous cue The example uses Record to record the cues Cue 1 Chan 1 Full Rec 1 Enter Cue 2 Chan 2 Full Rec 2 Enter Cue 3 Chan 3 Full Rec 3 Enter Cue 4 Chan 1 At 2 5 Chan 4 Full Rec 4 Enter Cue 5 Chan 1 Thru 4 At 0 0 Rec 5 Enter These keystrokes produce the results illustrated in Figure 1 Cue2 Cue3 Cue4 Cue5 Channel 1 FF FF 25 Channel 2 FF FF FF Channel 3 FF FF Channel 4 FF Channel 5 Figure 1 00 00 00 00 Notice the horizontal tracks developed by keeping a channel at the same level through a number of cues For example channel 1 tracks from cue 1 to cue 3 When a channel is not set at any level such as channel 5 above it is considered tracked at clear Note that channels remain at set levels while you program the series of cues because they are captured and have not been released Chapter 5 Learning advanced techniques 5 11 Recordi
77. ckingt Redundant tracking on Redundant tracking off Master console Slave console tSet printer to parallel Face panel diagnostics Enabled Disabled Displays timeout message MIDI Interface Enabled Disabled System boot Enable system boot B4 On Off B6 Off B7 On Off B8 Off B5 Off On appendix b Error MESSAGES Bad sector Diskindrivehasabadsector Iftheconsoledisplaysthismessage whenyourecordashowtodisk throwitoutanduseanewone Consolecannotreadshowsfromadiskwithabadsector lftwoshows areonthedisk Expression mightbeabletoreadtheother show Configurations differ Cannot verify Theshowyouaretryingtoverifywaseither 1 configuredwith different systemsettingssuchasnumbersofchannelsordimmers or2 saved fromanearlierversionofETCsoftwareoradifferenttypeof ETC console Console configured without a face panel Indicatesthatconsoledoesnotdetectanoperationalfacepanel This willoccurifyourconsolehasbeensetuptouseaDesigner s Work sheet forexample insteadofafacepanel orcouldbecausedbya damagedcablelinkingthefacepaneltothemainprocessor Drive error Consolecannotrecordtoorreadfromdiskbecauseofadiskordrive error Verifythatthediskisformattedandretryoperation lferror messagerecurs useanewdisk Drive not responding Diskdriveisnotworkingproperly Tryanotherdisk _ lferrormessage recurs contactanauthonzeddealerorETC Error found in backup memory Theconsole smemoryhasbeencorrupted Whenamemory
78. cord submaster pages 4 40 Page display 4 5 Pages 4 38 Parallel printer 2 10 Patch 8 52 Pile on convention 1 5 Pinouts dimmers 2 8 monitor 2 5 printer 2 11 Remote Focus Unit 2 16 Playing back cues 4 25 4 27 Plus 8 53 Plusfade 8 74 in subroutines 5 39 Potentiometers Pots 8 54 Power 8 55 Print options Expression 2 0 Cue Sheet 6 4 cues 6 3 Designer s Worksheet 6 5 Group Sheet 6 7 groups 6 6 macros 6 8 Real Time Programs 6 9 Softpatch 6 10 Stage display 6 11 Submaster Sheet 6 13 submasters 6 12 Track Sheet 6 14 Printer connector 2 11 installing 2 10 pinout 2 11 Programming regions 7 7 Proportional patching 3 8 Proportional rate override 4 26 4 29 4 30 8 70 selecting 4 30 4 31 R Real Time Clock programs 6 9 setting 7 18 Record 8 56 cue only 4 8 8 56 pile on submasters 4 39 shows 4 51 6 17 tracking 4 8 Record keyed switch 8 57 Record functions 4 8 Recorded channels 4 7 Recording submasters with bump switches 8 9 Redundant Tracking Backup 7 22 installation 2 17 pinout 2 17 Rel 8 58 Release captured channels 8 58 Rem dim See Solo Remote Focus Unit 7 12 connector 2 16 installation 2 16 pinout 2 16 Remote macros 7 24 installing 2 20 pinout 2 20 Index Remote submasters 7 24 installing 2 20 pinout 2 20 S Save show 4 51 Selected channels 4 6 Selecting cues 4 26 Serial Button Protocol 7 21 Serial printer 2 10 Setting defaults dimmer profiles 3 1
79. cro options THEN PRESS ENTER TOP ALL FADES gt Chapter 6 Using print and disk options page 6 15 Chapter 3 Entering softpatch and system settings Chapter 8 Reference page 8 66 Chapter 6 Using print and disk options Chapter 8 Reference page 8 16 Chapter 7 Accessories page 7 18 Chapter 7 Accessories page 7 20 Chapter 5 Learning advanced techniques page 5 47 Designer s Worksheet options Chapter 7 Accessories page 7 5 8 60 Expression 2 0 Solo lets you select a channel or a group of channels and suppress all others to a level of zero Solo is useful for selecting part of a look currently displayed on your screen in any mode and recording only that portion You may also want to use Solo to isolate a subset of a live look to readjust or refocus those channels without the other channels interfer ing Follow these steps to select a subset of channels from a display screen Using Solo in Stage 1 Select the channels you want to isolate 2 Press Solo Selected channels remain at current levels all other channels are suppressed to zero 3 Now you can work with the selected channels live save them as a cue group or submaster or use them as you would any other set of selected channels 4 Torestore the full set of channels press Solo again The changes you made are reflected on the screen Chapter 8 Reference 8 61 Using Solo in Blind or Track Sheet 1 Select a subse
80. cue in the link press Link twice enter the delay time and press Enter Chapter 8 Reference 8 47 Example Cue 1 Link 2 Enter 5 Enter links cue 1 to cue 2 with a five second delay time between the cues Cue 1 Link Link 6 changes the delay time to six seconds Deleting links To delete link information from a cue follow these steps 1 In either Stage or Blind press Cue 2 Enter number of first cue from which you want to delete link infor mation and press Link 3 Press Clear Example Cue 1 Link Clear clears link information from cue 1 8 48 Expression 2 0 Macros Macros allow you to store a sequence of keystrokes and play them back by starting the sequence with just one keystroke For example you may want to check each of your channels by bringing each up for a couple of seconds Rather than manually bringing each up you can create a macro to automatically bring each channel up for any period of time and then move on to the next one Chapter 5 Learning advanced techniques includes detailed instructions for working with macros Chapter 8 Reference 8 49 Minus The minus key decreases the value of a highlighted number by one The value could be a channel number a cue number a level setting or any other type of number that is highlighted on the screen The plus key increases the value of a highlighted number by one For example when the LED on Chan is
81. default fader clear time is the length of time required for a fader pair Clear to fade out channels from the faders A diagnostic system clear resets Clear fade time to zero channels black out immediately when clear time is zero To change the fader clear time follow these steps 1 Press Set Up 2 Select 6 System Settings and press Enter 3 Select 3 Default Fader Clear Time and press Enter 4 Enter fader clear time in minutes and seconds or as a fraction of a second in decimal format Fade times can be any length of time from 1 second to 99 59 minutes 5 Press Enter Enable disable bump switches Bump switches are momentary switches that flash submasters to their full recorded levels or initiate a timed submaster You may disable bump switches to eliminate the possibility of accidentally bringing up un wanted channels When bump switches are disabled submaster slide pots function normally To enable or disable bump switches follow these steps 1 Press Set Up 2 Select 6 System Settings and press Enter 3 Select 14 Enable disable bump switches and press Enter 4 Select 0 to enable or 1 to disable bump switches 5 Press Enter Expression 2 0 Enable disable Flexichannel Flexichannel is an optional display mode that displays only selected channels and channels that are recorded in a cue submaster group or effect To enable or disable Flexichannel follow these steps 1 2 P
82. ds for cue 1 when cue 1 is already linked to anther cue or macro Chapter 8 Reference 8 21 Diagnostic system clear The Diagnostic system clear option erases all cues groups submasters autoloads macros and real time programs and it resets all system settings to their factory default settings Warning When you initiate a diagnostic system clear all show data stored in Expression is lost Save the current show on disk if you do not want to permanently lose it The Diagnostic system clear option is included on the System Settings Menu Follow these steps to initiate the system clear option 1 Press Set Up 2 Select 6 System Settings and press Enter 3 Select 16 Diagnostic System Clear and press Enter Expression displays the following screen DIAGNOSTIC SYSTEM CLEAR MARKING IS FUNCTION HILL CLEAR ALL CUE INFORMATION AND RESET L Ss STEM SETTINGS TO DEFAULTS CHECK WITH AUTHORIZED SERVICE CENTER BEFORE USING TO CLEAR SYSTEM PRESS ENTER TO ABORT PRESS CLEAR 4 Ifyou are certain you want to initiate the diagnostic system clear press Enter To cancel the system clear press Clear Note You can also force a diagnostic system clear by turning the console off and pressing and holding down bump switches for submas ters 7 8 and 9 while you turn the power back on Release the bump switches when the Stage screen is displayed Example Set Up 6 1 6 Enter Enter performs a diagnost
83. e 72 parameters 0 127 Controller change 73 parameters 0 127 Controller change 74 parameters 0 127 Controller change 75 parameters 0 127 Controller change 76 parameters 0 127 Cue execution in CD fader pair Next cue Cues 1 127 Cues 128 255 Cues 256 383 Cues 384 511 Cues 512 639 Cues 640 767 Cues 768 895 Cues 896 999 Controller change 77 parameter 0 Controller change 77 parameters 0 127 Controller change 78 parameters 0 127 Controller change 79 parameters 0 127 Controller change 80 parameters 0 127 Controller change 81 parameters 0 127 Controller change 82 parameters 0 127 Controller change 83 parameters 0 127 Controller change 84 parameters 0 127 Macro execution Macros 1 127 Macros 128 255 Macros 256 383 Macros 384 511 Macros 512 639 Macros 640 767 Macros 768 895 Macros 896 999 Controller change 85 parameters 0 127 Controller change 86 parameters 0 127 Controller change 87 parameters 0 127 Controller change 88 parameters 0 127 Controller change 89 parameters 0 127 Controller change 90 parameters 0 127 Controller change 91 parameters 0 127 Controller change 92 parameters 0 127 7 18 Expression 2 0 RealTime Clock The Real Time Clock option allows you to program cues to playback in real time That is you can program a cue to playback automatically at any time of day on any day of the week For example you mi
84. e autoload feature lets you load both fader pairs simultaneously You can record any cues in an autoload For example you might want to run a regular crossfade cue in one fader and an effects cue in the other With autoloads you can playback the same effects cue at different rates during different times in the show Expression lets you store up to 25 autoloads they are not cues and are not included in the 400 cue limit You can record autoloads in either Stage or Blind For instructions on creating autoloads see page 5 44 and 5 45 For instructions on taking manual control of autoloads see page 5 46 Playing back autoloads To playback a recorded autoload 1 Press Autoload 2 Enter autoload number you want to playback 3 Press either Go key Example Autoload 1 AB fader Go plays back autoload 1 through the AB fader Chapter 8 Reference 8 5 Back Back lets you replay previously played cues This is a handy feature for bows or similar situations The back key replays the most recently played cue regardless of the order in which the cues were recorded in the cue sheet It then plays subsequent cues in reverse numerical order For example if you play cues one two three twenty two and sixteen then press Back cue sixteen will fade into cue twenty two If you press Back again cue twenty one will play not cue three Back allows you to play back cues loaded in either fader pair If you are using onl
85. e console while in black out and can still create or edit cues groups or submasters Examples Black out sets all channels at zero Black out second press restores channels to previous levels Chapter 8 Reference 8 7 Blind Blind is a display mode that allows you to create preview or edit cues submasters and effects without affecting live fixtures If you want live control of dimmers use Stage mode When you press Blind Expression displays the following screen GRAND MAETER BLIND 18 17 GBL 62 G3 B4 12 13 14 15 B16 26 27 28 239 37 38 39 40 B4i 51 32 53 34 62 63 64 65 B 076 77 7B 79 87 8 89 J0 B91 161 62 03 g4 12 13 14 15 116 CHE XFAD 88 457 80 65 HT GB 68 FADER E FADER C FADER I FADER CUESTYPE UPFSDOMN WAIT i NOT RECORDED CLEAR CLEAR 3 4 5 6 7 8 8 1B 11 12 SUB SELECT CUE NUMBER While in Blind mode there are three other screens that you can display the Autoload Subroutines and Effects screens For descriptions of those screens see Chapter 5 Learning advanced techniques In Blind you can perform some actions that you cannot perform in Stage For example you can clear cues groups and submasters and can create effects See the section titled Clear for instructions on clearing cues and submasters Note You must record your work in Blind before selecting a different display mode If you press Stage before recording a look in Blind you will lose your work 8 8 Expression
86. eceeceeeeeeeeeeeteeteensestesaeees 3 13 Setting default full EVEL ccc cccccetceceestteeeeeescseeeeenees 3 14 Setting default up and down fade times ceceeeeee ees 3 14 Setting default fader clear tiMe s ccccccccccccceceeceesseaeaes 3 15 Enable disable bump switches 0 ccccececcceeceeeeeteeeeeeeeeees 3 15 Enable disable Flexichannel cccccccccecceeeeeseeceeeeeeeeeees 3 16 Chapter 4 Learning the basics 4 1 Lesson 1 Display channel and record Modes ccccceeeseseeseeeeeeeees 4 2 Display Node S enin ea a o nthe hives ole hn Maeda ee 4 2 Stage Blind and Fader screens ccceececeecseseceeessseeeeeesaaes 4 4 Channel MOSS carens e eee a A 4 6 Captured Channels oer erreskan ier E EEIE A ERRIENT RERET A EE 4 6 Selected channels xiv ices ivchd ech tuccdasvadeeedbsMundedevaetlaneethatetas 4 6 Recorded channels cccccecceceeccecceeeeeeeeeeeeeeeennessaaeeeeeeeness 4 7 Moving ichaninels iex salt nat ei bel eee nec Uh ae er Mind us ae 4 7 Tracked Channels ccccecceesecceeceeeeeeeeeeeseeseeneesaeeeeeeeeeeeeetees 4 7 ROGOrd FUNCTIONS init tse tecekt deck e ioc neti oda oh eet Sha hae a 4 8 Table of Contents iii Lesson 2 Working With CUES 00 ccccccecceeceeceeeeeeeeeeeteeceensneeeeeeeness 4 9 Creating CUES ie sce de nerra nat a ER 4 10 Cue 1 Creating a cue IN Stage ooo cccccecccetceceesstteeeeeeeaees 4 11 Cue 2 Creating a cue in Blind ooo cccceeceetecee
87. ected channels levels with Full At or the fader wheel You can select channels in all display modes Selected channels are highlighted on a monochrome monitor and are displayed in yellow on a color monitor Selected captured channels are live channels that are under immediate keyboard control You can select channels in Blind but they won t be captured since Blind mode is not live Chapter 8 Reference 8 11 Chan Chan allows you to select channels in all display modes Pressing Chan indicates that the next number entered will be a channel number Once channels are selected you have immediate keyboard control over channel levels You can use Full At or the fader wheel to set desired levels Selecting channels in Stage Blind and Fader To select channels in Stage Blind or Fader modes follow these steps 1 Select a display mode 2 Press Chan 3 Enter the channel number you want to select or if you are selecting a set or range of channels enter the first channel in the range 4 Ifyou are selecting a set or a range of channels use the And and Thru keys to select channels Expression highlights selected channels 8 12 Expression 2 0 Selecting channels in Track Sheet Track Sheet displays level settings of one channel for all recorded cues When you select the Track Sheet display Expression prompts you to enter the channel number you want to display To change the channel disp
88. eeeceeceeeeceeeeeeteetteetteeees 2 13 Installing Remote Focus Unit wo ce eceeceeseeeeeeeceeeeeetettneeteeaees 2 16 Installing Redundant Tracking Backup 0 ccceceeeeeeeeeeeeeeeteteeeeees 2 17 Installing the alphanumeric keyboard 0 ceceeeeeeeeeeeeeeeteeteeeees 2 18 Installing Infrared Remote Focus UNit cccccccccccececcsseeeeesstteeeeeeees 2 19 Installing Remote Submasters and Macros n 2 20 ii Expression 2 0 Chapter 3 Entering softpatch and system settings gsi EEEE EE E T E A E EAE T E N 3 2 Entering one to one SOFtPAtTCH cece ce eeteeeeceeeseeeeessttaeeeeeeees 3 3 Creating CUSTOM SOFtDATCH 0 cece ccceeeeseeceeseeeeeeesesssseeeeenensaees 3 4 Using Channel Zero ienen aeieea a a r e 3 4 Entering numbers of channels and diMMEers 0 cc00e ees 3 5 Patching dimmers to Channels ccccccecceeeeeeeeeeeeteeeeeeeeees 3 6 Additional patching features ccccccccccceccceecsteeeessstteeeeesssseeeeeness 3 8 Proportional Patching earainn ana e A ees 3 8 Dimmer groleska a e a E EA 3 9 Resetting factory dimmer profiles and all dimmers to default setting s issesiiieeeeiirrerrrreene 3 10 Capturing channels in softpatch s ssssiiiseeriireerrrirrerre 3 10 Unpatching individual diMMETrS cc ccceeeeeeeeeeeeeeeeeeeees 3 11 Softpatching to a Strand CD80 dimmer rack 0000000 3 12 Entering system settings ccc cecccccececeeceeeece
89. eeesteeeeeeeeaes 4 13 Cue 3 Modifying up and down fade times 00csseeee 4 15 CUSA LINKING OUB aaen a a iin aR RN ne 4 17 Cue 5 Creating a cue using Solo ou ceceececteceeeesteeeeeeeneaes 4 19 INSErtING CUGS caren A Geena teri eee PR 4 21 Deleting CUG Sn a e a A 4 22 VIGWINGICUCS aee a e e a adage eae 4 23 COPYING CUES Aas eaa te ee oe eeds E T AA 4 24 l sson73 Playing Dack CUCS renoma oerariosnig eon enie aaa 4 25 SEIECTING CUES ina a E ER A A R R 4 26 Timed faders and LED displays ccccccccccceseeceeessteeeeeeesteeeeenees 4 26 Playing cues Dack iin i a a ees a A 4 27 GO torardifferent CUC eie tatir O OOE E e ei Oiii 4 28 Controlling fades manually 0 cece eena n a 4 29 LEVEIOVENRTIG Gres creck ce chord cuesateesatengactatnapeeitiatanehatninh Seseenenetaes 4 30 Proportional rate override cceceeceeecceececeeeeeeeetteneeeeeeeeeeeees 4 30 Selecting fader operating MOE 2 0 0 ceececcetteeeeecsteeeeeeees 4 31 Manual control of linked CUES ooo ceecccececceessseeeeeeeteeeeeeeeaes 4 31 Modifying cues om stage euesan een epeei enet 4 32 Update CUS ee Se r ae Oe Sena ees 4 33 Back KE reteo E e T eles aae dy E A bined cold AE 4 34 Clearing adet pal S iur an E R R RR 4 35 Lesson 4 Working with submasters ssssssssseerirriirreererereerrrrnne 4 36 Submaster PAGES ro eo EEC EE O 4 38 Creating pile On SUbMAStETrS s ssssniiseseniiieeeniritrttrirreerrrr rreren 4 39 Recording submaster on a diffe
90. eet 2 13 dimmers 2 8 Infrared Remote Focus Unit 2 18 monitor 2 3 printer 2 10 Redundant Tracking Backup 2 17 Remote Focus Unit 2 16 remote macros 2 20 remote submasters 2 20 K Keyboard See Alphanumeric keyboard Keypad prompt window 4 4 L Last See Minus LED displays 4 26 Link 8 46 cues to cues 4 17 cues to macros 8 46 M Macros 5 2 5 47 6 8 8 48 cancelling 5 51 deleting 5 51 7 9 examples 5 52 putting on hold 5 50 running 5 50 submaster bump switches 5 50 with expanded memory option 5 47 Manual fade control submasters 4 42 MIDI 7 14 interfacing with 7 15 message definitions 7 17 message formats 7 16 Minus 8 49 Mode label 4 4 Modifying groups with Group 5 24 Modifying submasters with Update 4 46 Monitor color monochrome selection 2 6 connector 2 5 installation 2 3 pinout 2 5 remote installation 2 4 Moving channels 4 7 Multipart cues 5 1 5 3 Multipart cues continued converting regular cues to 5 6 creating 5 4 definition 5 3 editing channels 5 7 fade and wait times 5 7 wait times 5 3 N Naming cues 4 9 7 3 8 19 groups 7 3 8 40 shows 4 49 7 4 submasters 4 37 7 3 Next See also Plus Numbering cues 8 19 0 Operation modes 4 2 Operator prompt line 4 5 Optional equipment alphanumeric keyboard 2 18 8 19 Designer s Worksheet 2 13 Infrared Remote Focus Unit 2 19 7 10 Remote Focus Unit 2 16 remote macros 2 20 7 24 remote submasters 2 20 7 24 P Page 8 50 re
91. egular subroutine or effect Hold for Go Runs through steps until hold for go step Subroutine pauses until you press Go Chapter 5 Learning advanced techniques 5 37 Creating subroutines Each subroutine can hold up to 24 steps Each step lists a cue or a Style The jump to cue option essentially lets you increase the number of steps indefinitely until you exceed 400 cues total To create a subroutine follow these steps Create the cues you want to use in your subroutine 2 Press Blind You must be in Blind mode to create subroutines 3 Press Cue and enter the cue number you want to assign to the subroutine Note You cannot use effects cues in a subroutine except in jump to cue steps lf you include an effects cue in a jump to cue step the cue in the previous step remains on stage while the effect plays It remains on stage until a non effect cue begins 4 Press Type to display the fade type menu 5 Select 4 Subroutine Expression displays the screen illustrated below GRAND MASTER Lees HOT RECORDED STEP CHE 200 SUBROUTINE A FADER B FADER C FADER D FADER C CLEAR CLEAR 12 3 4 5 6 7 3 16 11 128 ErTYPE WAIT LINK DELAY ee pg mg a PP a a fam EOD Gi pa pa tE o DDDDDDOD SELECT STEP NUMBERS 10 11 12 Expression 2 0 Press Cue Select The following line appears at the top of the screen CUE CROSSFADE TO 100 UP 00 00 DOWN 00 00 DELAY 00 00 Enter cue num
92. eiierereree 5 6 Editing a Multipart CUCM ete casei ds eee ead ne eee 5 7 Lesson 2 Track record fUNCTION sive scccecdesasoeeceaeiaidedevessesceeievsedoeccaseeions 5 9 Using record to create tracks eceeececeeceeeceeeeeeeceeseeeeeeeeeeenes 5 10 Recording modified CUES 00 0 ceeeececccceeeeeeecesteeeeceestesseeseesteaaeess 5 11 INSERING CUCS 3 2 2 EAE hoa sah cians ke a eas hua spe teta dd 5 13 Blackout cues and tracking cccceeeeeeeeeeeceeeeeeeeeeeceeetnteeeeeeeeees 5 15 Lessons Track Shete ee E E 5 17 Track SHEET screen wolscedtececp sian sncenatapaewtdnn iaahinctcs ATi 5 17 Track sheet description 0 2 22 cc cceeceeeeecteececeeeeceeeeeeceectecsaeaeeeeeeeness 5 18 Working with Track Sheet ccccccccccececceecsteceeessssteeeeesssteeeeeneees 5 19 Lesson 4 USING GrOUP ooo cece rrara AE ATEEN 5 21 Greating GrOUPS eire a tain Mavtient iia sett cetas tose dy auedeas ee 5 22 Displaying groups ON StaQe ccecceeeeeeeeeeeceeeeeeeeeeeceeeetseeeeeeeeees 5 22 MOdIFYING groups iee a 5 23 Modifying groups in Blind e leete a EEE 5 23 Modifying groups IN Stage seess or n 5 24 Modifying groups using Update cc ceeececeeeeessteeeeeeeees 5 24 Deleting Grop Serc hecccnct angen Mad hebege rahe eerie nese 5 25 COPVING GlOUDS 22 5 fel a a e e EN a a a 5 26 Using groups to modify cues or submasters in Blind 5 27 Using Group Sheet to display groups ccccccccceeeessseeeeesseseeees 5 28
93. el number and press Enter To delete a channel from a step enter the channel number and press Clear Chapter 5 Learning advanced techniques 5 35 Effects shortcuts Expression assumes you want to organize channels in a pattern There fore you can enter the numbers of steps and channel numbers you want and create all your steps at once To create all your steps at once press Step Part 1 Thru and then enter the total number of steps you want Then select all the channels you want in the effect by pressing Chan and the channel numbers you want in conjunction with Thru and And Expression assigns channels to steps numerically until it reaches the last step the next channel is assigned to the first step and so on until all channels are assigned For example if you select steps 1 through 10 and then select channels 1 through 60 Expression assigns channels as illustrated below GRAND MASTER 186 CUE 31 EFFECT STYLE LooP STEF CHANNEL NEGATIVE BSSSSREERE OOS Oe je Bl B2 B3 Ba BS B BT BE Bo is ane o2f5m MAAS TEN Ce i pel lal td NOOO OTe WN hafai Daaa id BR a A ENa fe f a fa Pa Ps won Ga k ga RATATAT anan DAIN CN Pac i SR OE OM OD PACT NEN INEN GEN HE E a j Hee tnentnenenenenenenin All your steps will still be selected When you enter high and low levels and delay time all selected steps are affected Remember that you can but don t have to enter up to 10 channels per step
94. els To extend a track follow these steps 1 Press Blind and enter cue number you want to modify 2 Select channels you want to clear 3 Press At Clear 4 Press Track to clear the selected channels and their tracked levels through subsequent cues Then press Enter Resetting channels to zero To set channels to zero follow these steps 1 Select channels 2 Press At 3 Press Clear Examples Blind Cue 1 Clear Rec deletes cue 1 Blind 2 Chan 1 At 0 0 Track Enter deletes channel one from cue two and remaining track Chan 5 At Clear sets channel five at zero Chapter 8 Reference 8 15 Clear fader The blue Clear keys next to fader pairs clear all cue information from faders The default fader clear time is zero therefore channels fade immediately To change fader clear time follow these steps 1 Press Set Up 2 Select 6 System Settings and press Enter 3 Select 3 Default Fader Clear Time and press Enter 4 Enter fader clear time in seconds or as a fraction of a second in decimal format Fade times can be any length of time from 1 second to 99 59 minutes 5 Press Enter Example Set Up 6 3 4 Enter resets fader clear time to four seconds 8 16 Expression 2 0 Clear show from memory The Clear show from memory option on the Set Up Menu clears all cues submasters effects subroutines groups autoloads and real time progra
95. emory option It allows you to list all recorded groups on screen If you have named groups using the optional alphanumeric feature group displays the names Follow these steps to display Group Sheet 1 Press Blind Group Page Group Sheet displays the first 32 recorded groups 2 Press Blind again to display additional groups 3 Press to return to Blind or press another stage display button to move to another display mode Chapter 5 Learning advanced techniques 5 29 Lesson 5 Working with effects The effects feature lets you create special lighting effects such as lightning strobes and chases Each effect can contain up to 10 steps Each step can include up to 10 channels high and low intensity level limits for those channels and a fade or delay time between steps Each effect can be programmed to run for 1 second to 99 59 minutes Each effect plays back in one of the four styles described below Effects are a type of cue therefore they are included in the 400 cue limit When you play back an effect the previously played cue remains on stage while the effect plays It continues until you begin another non effect cue Loop Runs through steps consecutively returns to the first step and repeats the loop Channels flash rather than fade between steps Loop is useful for creating marquee type effects Bounce Runs though steps in forward and then in reverse order Channels flash between steps rather than fade
96. en there are specific keystroke sequences to create sample cues There are several ways you can go about creating any one look The following instructions give examples of how you could generate each cue Experiment and add as much as you want to each We assume that when you start this tutorial there are no cues stored in the console To erase the current show from the console follow this key sequence Set Up 6 Enter 1 6 Enter Enter Before you clear the console make sure that the show currently in the console memory is saved on disk When you clear the console all show information is erased Chapter 4 Learning the basics 4 11 Cue 1 Creating a cue in Stage Follow these steps to create a cue in Stage mode 1 Press Stage Expression displays the Stage mode screen Once you are in Stage you have live control of channels Expression automatically prompts you to enter a channel number Enter channel number s with numeric keypad Set intensity level by pressing At and entering a two digit level moving the fader wheel or pressing and Press Rec to indicate that you want to record the cue Enter cue number with numeric keypad Press Enter to record cue Expression returns to the Enter channel prompt Press Rel to release captured channels Expression 2 0 Cue 1 keystrokes Key Stage 1 At 7 5 Rec 1 Enter Rel Action Displays Stage mode Selects channel 1
97. er mode is live You can select and capture channels and make live adjustments to them You can save looks you create in Fader as cues groups or submasters Fader mode can display the output of one fader pair at a time or both at the same time This allows you to modify a cue that has played back in one fader pair and record it without also recording the output from the other fader pair Fader mode also lets you combine the output of both fader pairs while eliminating the submaster outputs When you press Fader Expression displays channels in the AB fader pair The operator prompt line displays the message Select fader number 1 AB fader 2 CD fader 3 AB CD fader Press 1 to display channel settings currently stored in the AB fader press 2 to display channel settings in the CD fader or press 3 to display channels in both fader pairs To clear a fader pair press the blue Clear next to the pair Chapter 8 Reference 8 33 Fader wheel The fader wheel gives you incremental proportional control of selected channels intensity levels When selected channels are displayed on your screen regardless of what mode Expression is in you can move the fader wheel to adjust level settings The fader wheel is speed sensitive Move the wheel quickly to make large adjustments or slowly to make fine adjustments 8 34 Flash Expression 2 0 Flash pushes selected channels to a level of either zero or full depend ing on their l
98. er potentiometers or pots A submaster is a set of channels recorded at levels to create a look The submaster pot gives you manual control for the recorded look You cannot play submasters back through autofader pairs Submasters allow you to save looks that you use often You can use submasters as building blocks when you create cues or other submasters For example you might create a different submaster for each cyclorama wash another submaster might include practicals Or you might choose to create a series of submasters for each area of your set Each submaster consists of a slide control and a bump switch The slide control allows you to bring the submaster look up manually The bump switch allows you to flash the submaster to its full recorded level or to begin its programmed fade time if any When a slide pot is set at 0 the submaster is at zero percent of its recorded level To increase submaster level push pot up When pot is set at 10 submaster is at 100 percent of recorded level Expression submasters are pile on submasters That is if several outputs timed playback faders and other submasters include the same channel the highest output level overrides all others However captured channels and inhibitive submasters override pile on submaster levels Any specific channel may be included in as many pile on submasters as you choose Half of Expression s submasters can be recorded as either pile on or inhibitive submast
99. er the cue number if it is currently displayed on the cue submaster description line 5 Press Enter 6 Press Rel to release captured channels Examples Chan 1 Thru 5 At Full Update Cue 1 Enter Rel adds chan nels 1 through 5 at full intensity to Cue appehdix a dip switch settings DIP switches are located on the back panel of the console To change the DIP switch settings remove the clear panel and set switches Expression reads DIP switch settings when console is turned on Therefore if you change any settings you must reboot console to initialize new settings Switches in the down position are off switches in the up position are on Expression does not use DIP switches A1 A2 and A5 DIP switch B8 must be Off for the system to boot Messages A3 ETC messages Off ARRI messages On CRT AC line frequency A4 60 Hz Off 50 Hz On Manual readback A6 None Off 32 channels Off 64 channels Off 96 channels Off 192 channels On A7 Off Off On Off Analog dimmer outputs 96 wire per dimmer outputs 192 wire per dimmer outputs Strand 192 AMX192 Multiplex outputs Strand 384 AMX192 Multiplex outputs Digital dimmer outputs DMX 512 output ETC LMI output Colortran D192 output B1 Off Off On On B3 Off On Off Expression 2 0 B2 Off Off On Remove jumper R and install jumper S For Revision F circuit boards only remove jumper C and install jumper D Redundant tra
100. error occurs youshouldinitiateadiagnosticsystemclear Tumconsoleoff pressandholdbumpswitches7 8and9down andturnconsoleback on Thenreloadshowinconsolefromyourbackupcopyondisk Memorymaybecorruptedifconsoleisleftoffformorethanaweekor ifconsoleisexposedtoastaticcharge Expression 2 0 Error found in dynamic RAM Indicateshardwareerrorindynamicmemorychip Pleasenotechip numberindicatedbythemessagesandcallETCfieldserviceat 608 831 4116 Error found in EPROM check sums IndicatesthatanEPROMhasbeencorrupted Consolemayfailto operatecorrectly Pleasenotechipnumberindicatedbythemessages andcallETCfieldserviceat 608 831 4116 Error found in static RAM Indicateshardwareerrorinbatterymemorychip Pleasenotechip numberindicatedbythemessagesandcallETCfieldserviceat 608 831 4116 Error in face panel Indicateshardwareerrorinfacepanel memory PleasecallETCfield serviceat 608 831 4116 Error in slave processor Indicatesahardwareproblemintheslaveprocessor PleasecallETC fieldserviceat 608 831 41 16 Maintenance required Indicatesthatyourdiskdriveneedsrepairs Contactyourauthorized dealerorETCforrepairs Malfunction in disk drive Indicatesahardwareproblemassociatedwiththediskdrive Pleasecall ETCfieldserviceat 608 831 4116 No cues left Currentshowhasmaximumnumberofcuesrecorded fyouneedmore than400cuesforyourperformance recordcurrentshowondisk and writetheremainingcuesinanothershow Thenrecordsecondshowon adisk Tostarttheperforma
101. ers Inhibitive submasters limit the intensity level for the channels recorded in it See page 4 43 for more information on inhibitive submasters Chapter 4 Learning the basics 4 37 Naming submasters with expanded memory If you have installed the expanded memory option you can use a standard PC XT compatible alphanumeric keyboard to assign names to submasters See page 7 3 for more information on using the alphanu meric keyboard to name submasters This lesson includes the following sections Submaster pages Creating pile on submasters Recording submasters on a different page Adding fade times to submasters Controlling submaster fades manually Modifying pile on submasters Creating inhibitive submasters Recording inhibitive submasters on a different page Modifying inhibitive supbmasters Using Update to modify submasters Copying submasters Deleting submasters Submaster sheet After creating cues in Lesson 2 you should be well acquainted with several methods for creating looks on stage In this lesson we won t trouble you with reading instructions on selecting channels and setting levels since you already know how to do that Instead we ll concentrate on how creating submasters is different from creating cues 4 38 Expression 2 0 Submaster pages Expression has two pages of submasters Each page can hold a full set of recorded submasters one in each pot This doubles the number of recorded submasters available
102. ers up and down fade times of 5 seconds and a wait time of 10 seconds 8 70 Expression 2 0 Timed fader pairs The AB and CD fader pairs are timed faders through which you can play back recorded cues The two fader pairs are independent of each other You can playback cues in both fader pairs at the same time The fader pairs operate in two different modes level override and proportional rate override When you turn Expression on it defaults to the fader mode in effect the last time you used the console You can select another fader mode from the System Settings Menu Note Executing a Diagnostic System Clear from the System Settings Menu resets the faders to level override mode The procedure for playing back cues is the same in both modes To playback the highlighted cue in the cue sheet press the Go key for the fader pair in which you want to play the cue To override the timed fader and play a cue manually set the cross faders to zero then press Go This enables you to control the fade manually using the faders The principal difference between the two modes is that in level override you can use the faders to manually control the fade levels In propor tional rate override you use can use the faders to modify the recorded fade rate Select level or proportional rate override modes from the System Settings Menu See page 8 57 for more information on System Set tings Menu options In level mode move the faders to the
103. esson 8 Working with macros A macro works like a redial button on a telephone You can store a series of keystrokes and later replay it with a simple keystroke Macros simplify complex tasks that you perform often You can program up to 125 macros in Expression If you have expanded memory you can program up to 640 macros For example you might program a macro to simplify the process of performing a channel check Rather than manually selecting each channel and bringing it up and then clearing it and moving to the next channel you can write a macro to do all the key punching for you You can include any keys on the console except Enter Macro Flash and MIDI commands in a macro You cannot enter fader wheel move ment Each macro can contain up to 32 keystrokes If you need more than 32 keystrokes you can link macros together by putting a macro keystroke at the end of a macro to link it to another macro You can also program the macro to pause for any length of time be tween one second and one hour The Macro wait key lets you program a pause anywhere in a macro Hint See page 5 52 of this chapter for examples of some handy macros 5 48 Expression 2 0 Creating or modifying a macro Follow these steps to create a macro dls Plan your macro by determining exactly what keystrokes you want to include You might want to do this by running through the task and writing down each keystroke Press Set Up Selec
104. evel when you press Flash If selected channels are set at a level from one to 50 percent press Flash to flash them to full If selected channels are set at a level from 51 percent to full press Flash to flash them to zero Channels remain at flash level until you release the key One application of Flash is identifying which lamps are controlled by a channel To do so select desired channel and press Flash Chapter 8 Reference 8 35 Flexichannel When Flexichannel mode is enabled Expression displays only selected channels and channels that are part of a recorded cue submaster group or effect channels not used in the current show do not appear on the display screen Flexichannel is a feature of Expression s expanded memory option It is available only when expanded memory is installed If you are creating a new show in Flexichannel mode and have not selected or recorded any channels no channels appear on the display As you create a show the channels you select appear If you enable Flexichannel once you have started working on a show channels not recorded as part of a cue submaster group or effect are removed from the display If Flexichannel is enabled and you read a show into the console from disk only recorded channels will appear in the display Display mode information is not recorded as part of a show Regardless of the display mode selected when you record a show the Expression console returns to the
105. everal outputs Expression reads all output levels it receives for a specific channel and sets that channel to the highest of these For example assume a channel is included in a submaster If a channel is also included in a cue that has played back and is in a fader Expres sion sets the channel at the greater of the two settings The two exceptions to Expressions pile on convention are channels captured by the keyboard or wheel and inhibitive submasters Captured channel settings override submaster and fader pair outputs When you release captured channels they return to their pile on level The other exception to pile on convention inhibitive submasters limit output levels from other submasters and timed fader pairs Inhibitive submasters do not affect captured channel levels 1 6 Expression 2 0 Getting help Help screens are available for all Expression keys To display help screens 1 Press Help 2 Press any key on the console Expression displays a description of the key you pressed Help screens are not available for menu options Customer service If you have problems with your console please follow these steps 1 Refer to the manual for instructions 2 If you do not find the answer in the manual call your local dealer or ETC for customer service Please have the following information available before you call e Console model and serial number located on back panel e Software version displayed on bo
106. ew You can use channel settings from other submasters or cues by bringing up a recorded look then modifying as you desire Press Rec and press the bump switch where you want to record the submaster Or press Rec Sub then enter a submaster number and press Enter Press Rel to release captured channels Push the submaster pot up The channels you recorded come up at the proportionate levels you recorded 4 40 Expression 2 0 Recording submaster on a different page You may record a submaster to a page other than the one currently loaded or loading For example if you have page one loaded you can create a look on stage and record it to page two if you wish To do so follow these steps 1 2 Create a look on the screen Press Rec Press Page Enter the page number on which you want to record submaster Press the bump switch of the submaster in which you want to record the look Chapter 4 Learning the basics 4 4 Adding fade times to submasters Bump switches let you add upfade downfade and wait times to sub masters When you record fade times for a submaster you can play the recorded fade with the bump switch or retain manual control with the sliding fader You can add fade times to a submaster from any mode To add fade times to an existing submaster follow these steps 1 2 Press Sub to indicate that you are selecting a submaster Enter the submaster number to which you want
107. ew a different cue press Cue and the new cue number that you want to see In Blind mode you can also use and to move through recorded cues and cue parts one at a time Press Cue thereafter displays the next cue or part and displays the previous cue or part 4 24 Expression 2 0 Copying cues Once you have created a cue you may copy it and give it anew number This can be helpful if you want to create a cue based on one you have already recorded You can copy cues in Stage or Blind modes Follow these steps to copy a cue 1 Press Blind or Stage You can copy a cue in either mode 2 If you are working in Blind mode press Cue then enter the num ber of the cue you want to copy Or if you are working in Stage mode press Cue enter the number of the cue you want to copy then press Go 3 In either Stage or Blind once the cue is displayed press Rec Cue the number of the new cue and Enter The new cue will be recorded the original cue will not be affected Copying cue keystrokes Key Action Blind or Stage Selects operating mode Cue 1 or Displays selected cue Cue 1 Go Rec Cue 2 Copies Cue 1 and Cue 2 Chapter 4 Learning the basics 4 25 Lesson 3 Playing back cues Now that you have some cues you re probably anxious to play them back Expression has two sets of timed fader pairs that playback re corded cues The left fader in each pair faders A and C con
108. f you have created all cues for a scene and then decide to add a new channel or group of channels to all cues Track lets you do so with one short record command To do the same thing with Record would require you to add the channels to each cue individually We use the standard Record function for all cues in this chapter Instruc tions for using the Track function are included in Chapter 5 Learning advanced techniques Chapter 4 Learning the basics 4 9 Lesson 2 Working with cues Now that you have an orientation to the channel display screens you re ready to create cues If you are not sitting at the console but want to refer to the keyboard see Appendix D for an illustration When working with Expression a cue is a look you have created and recorded and can replay in a timed fader pair After you select channels and set their intensity levels you can store the look as a cue You can save up to 400 cues per show in Expression Each disk can hold two shows If your performance runs over 400 cues you can read a second show from disk during a break or between cues See Lesson 5 for more information about recording shows on disk This lesson includes instructions and examples for creating cues using several different methods When you have completed the lesson you will have five cues recorded You will also know how to modify and delete cues Naming cues with expanded memory If you have installed the expanded memory option you
109. fade between steps Loop is useful for creating marquee type effects Bounce Runs though steps in forward and then in reverse order Channels flash between steps rather than fade Bounce can be used for marquee or runway effects Random Plays steps back in random order Channels flash to high and low levels they do not fade Random creates lightning flashing or strobe effects Ripple Plays steps in random order but unlike random channels fade between steps Ripple creates the effect of flames or water reflections Chapter 8 Reference 8 27 Enter Enter functions as an Enter key does on most computer keyboards It indicates that you have finished entering a number or have completed an operation The operator prompt line indicates when you should use this key Expression 2 0 Except allows you to exclude a subset from active channels when you are recording a cue group or submaster You can also use Except to exclude a subset of the current selected channels from direct keyboard control For example you may have several submasters active on stage a cue in a fader pair and some captured channels You can use Except to record all channels except a subset that you indicate When using Except you can designate any recorded set of channels such as cues groups or submasters as the excepted channels Or you can designate specific channels by number and And and Thru You can also use Except when you are select
110. ght program the work lights to come on for a choir rehearsal on stage between 7 p m and 9 p m on Monday and Wednesday Or you may want to warm the filaments of your studio instruments 15 minutes prior to your news program The Real Time Clock also displays the current time under the display mode label and date stamps shows when you record them on disk You can record up to 10 real time programs in Expression This section includes instructions for creating real time programs and setting the real time clock The Real Time Clock is an optional accessory that must be installed at the factory Creating or editing real time programs 1 Press Set Up 2 Select 9 Edit real time programs and press Enter Expression displays the following screen GRAND MASTER 1007 check l PROGRAM PROGRAM START CUE TIME ON TIME OFF DAYS OF WEEK L 2 3 4 5 6 t g a a 1 SELECT PROGRAM HUMBER Chapter 7 Accessories 7 19 3 Select a program number and press Enter 4 Enter the cue number you want program to bring up and press Enter 5 Enter the time you want cue to playback Enter time in military format For example enter 8 00 a m as 08 00 and 5 15 p m as 17 15 Press Enter 6 Enter the time you want cue to fade out Enter time in military format Press Enter Hint You can use Cue to edit cue numbers and Time to edit on and off times 7 Atthe day of the week prompt enter any of the following codes to
111. gnals to the receiving unit To enable the IRFU in Expression ETC must modify the console at the factory To install the infrared remote control unit follow these steps 1 Verify that the receiver unit is properly connected to the console and that battery in transmitter is good See infrared remote documenta tion for correct connection procedure 2 Press Set Up 3 Select 6 System settings and press Enter 4 Select 15 Enable disable infrared control and press Enter 5 Enter 0 to enable infrared controller and press Enter 6 Press any key on the transmitter unit to turn power on Transmitter power automatically shuts off three minutes after last key press Infrared Remote Focus Unit pinout Console connector DIN 5 pin female Pinout Ground PPM data 12V WSI data Charge current aRWN gt 2 20 Expression 2 0 Installing Remote Submasters and Macros Remote Submasters and Remote Macros are custom installed ETC products To enable Remote Submasters and Macros ETC must modify the console at the factory Follow these steps to begin remote operation 1 Verify that all control cables are properly connected Check connec tions at rear of main control console wall plug connections and connections at all remote panels Press Set Up Select 6 System settings and press Enter Select 13 Enable disable remote submasters and press Enter Enter 0 to enable or 1 to disable and press
112. hannels Select channels and press Clear to set them to 00 4 Press Rec Enter Chapter 4 Learning the basics 4 43 Creating inhibitive submasters Inhibitive submasters allow you to limit the intensity level for a group of channels When an inhibitive submaster pot is on 10 100 percent the channels are not inhibited As you pull the pot down the channels levels are limited to the percentage to which you set the submaster For example assume you select channels 1 through 15 for an inhibitive submaster As long as the submaster is set at 10 100 percent chan nels 1 through 15 are not affected When you pull the submaster down to 5 50 percent channels 1 through 15 are limited to 50 percent of any other output settings Each channel can be included in only one inhibitive submaster If you assign a channel to an inhibitive submaster that is already included in another Expression removes it from the first one and adds it to the submaster that you most recently recorded Inhibitive submasters affect timed fader pairs and other submasters Captured channels are not affected by inhibitive submasters but cues playing back through timed fader pairs are Remember leave inhibitive submasters at 10 100 percent unless you want to inhibit channels Otherwise channels may be missing from your cues If you seem to be missing some channels check your inhibitive subs You can record submasters 13 through 24 either as pile on or
113. he previous one by pulling all levels forward into the Blind display of the new cue Track Sheet Track Sheet displays one channel s intensity level settings for all re corded cues From it you can quickly see tracks for any individual channel You can then select a cue or a group of cues from the Track Sheet and modify channel levels Track Sheet provides one means for tracking channels through allfade cues Group Expression s Group feature lets you store groups of channels with proportional level settings Group numbers are independent of cue and submaster numbering Effects The Effects feature lets you create special lighting effects such as lightning strobes and chases for marquees or runways Subroutines A subroutine is a cue that controls the playback of a series of recorded cues Subroutines are similar to linked cues except that they have more playback options Subroutines allow you to link and playback cues with modified fade times without affecting originally programmed fade times Autoloads The Autoload feature allows you to load and play cues or effects from both sets of faders at the same time You can save up to 25 autoloads per show Macros A macro works like a redial button on a telephone With it you can store a series of keystrokes and later replay it with a simple keystroke Macros simplify complex tasks that you perform often Expression can save up to 125 macros or 640 if you have expanded memory Chapte
114. hen you install both a monochrome and a color monitor select mono chrome monitor from the System Settings Menu as described on page 2 6 Chapter 2 Installation Monitor connectors and pinouts Monochrome monitors RS 170 Console connector BNC female Pinout Center Video Shield Common Color RGB monitors Console connector DB 9 male Pinout Common AC ground Common Red Green Blue Intensity nc Horizontal sync Vertical sync OANDOARWDN 2 6 Expression 2 0 Entering system configuration When you install your Expression you have two system configuration options to set monitor selection and boot option selection Expression retains these settings until you change them you perform a diagnostic system clear or the memory is corrupted Monitor selection To configure your system for the type of monitor you have follow these steps 1 2 5 Press Set Up to display the Set Up Menu Select 6 System Settings and press Enter Select 11 Color monochrome monitor and press Enter Select either O for a monochrome or grayscale monitor or 1 for a color monitor Press Enter Note Some monitors may not be compatible with the console or may need special adjustment If the picture breaks up rolls or is not fully shown check with your dealer for compatibility Chapter 2 Installation 2 7 Boot option selection Two system boot options are available fast and full boot The full
115. ic system clear Expression 2 0 Dim allows you to select a specific dimmer or a group of dimmers The two times when you need to select dimmers are for softpatching and for unpatching single dimmers For more information about softpatching see Chapter 3 Entering softpatch and system settings Unpatching a dimmer is explained below Dim lets you select a single dimmer and bring it up independent of other dimmers softpatched into the same channel This is called unpatching a dimmer If a channel has more than one dimmer softpatched into it you may want to unpatch a single dimmer to check individual fixtures to turn on a work light or to focus a single fixture To unpatch a dimmer follow these steps 1 Determine which dimmer you want to unpatch You may want to display the softpatch screen to display the current dimmer to channel patching To display the softpatch screen press Patch 2 Press Stage then Dim 3 Enter the dimmer number you want to unpatch Unpatching does not affect the level at which other dimmers in the channel are set If you want all other dimmers in the channel off set channel at zero 4 Toset the unpatched dimmer at full intensity press Enter Or to set the unpatched dimmer at less than full press At and enter a two digit level Then press Enter 5 Press Dim Clear to restore dimmer to patch You can perform most other console tasks with dimmer unpatched then restore the patch at
116. ifferently See Record functions on page 4 8 for more information Display modes You can work in any of four different modes to create and modify cues groups and submasters Stage Blind Fader or Track Sheet The first three modes have very similar screens the Stage screen is illustrated and described on the next page The Track Sheet screen is illustrated and described on page 5 17 Stage Stage mode controls live channels This mode allows you to adjust lighting levels and save a look as a cue group or submaster when you are satisfied with the look on stage Blind Blind mode allows you to work on cues groups or submasters without affecting the stage lights Blind mode is useful when you know ahead of time what channels and levels you want for most of your cues and submasters Blind also lets you jump ahead of the stage action and make changes to recorded cues groups or submasters without affecting live stage lighting Fader Fader mode lets you make live adjustments to channels that are in one fader pair while another cue is currently running in the other For ex ample if you have a cyclorama cue in one fader and a stage cue in the other Fader mode lets you modify the stage cue live and record changes without capturing the cyclorama cue Fader mode is not in cluded in this tutorial but it is described in Chapter 8 Reference Chapter 4 Learning the basics 4 3 Track Sheet Track Sheet displays a specific channel s le
117. ing bump switch LEDs Submasters on the new page are not loaded into pots until you pull them down to zero The message Loading remains flashing on the screen until all submasters on the new page are loaded Warning Changing pages momentarily interrupts any fades in progress Page also allows you to create a submaster while one page is loaded and to record it on the other page of submasters To do so follow these steps 1 Create submaster look 2 Press Rec 3 Press Page and enter the page number on which you want to record the submaster Chapter 8 Reference 8 51 4 Press the submaster bump switch in which you want to record look Shortcut To load the other page press Page Enter Hint If you use both pages of submasters you may want to record the following macros Rec Page 1 and Rec Page 2 Example Rec Page entering page number and pressing a bump switch records a submaster on the submaster page you designate Displaying Submaster and Group Sheet Submaster Sheet and Group Sheet are features of Expression s ex panded memory option They are available only when expanded memory is installed To display Submaster Sheet press Blind Sub Page Press Page to alternate between the two pages of Submaster Sheet To display Group Sheet press Blind Group Page Press Page to alternate between the two pages of Group Sheet 8 52 Expression 2 0 Patch displays the softpatch
118. ing dimmers on the softpatch screen or cues on the Track Sheet Recording with Except To record a look currently on the screen except for a subset of the channels follow these steps 1 Press Rec to indicate that you want to save the current look 2 Press Cue Group or Sub to indicate how you want to save the look 3 Enter the cue group or submaster number 4 Press Except 5 Press any of the following key sequences to delete some of the channels from the look you are recording e Enter channel numbers You can select groups of channels to exclude by using And and Thrul e Press the bump switch of any submasters whose channels you do not want recorded with the look You can press as many bump switches as you want to increase the number of excluded channels Chapter 8 Reference 8 29 e Enter cues or groups by pressing Cue or Group and entering the cue or group number To enter more than one cue or group press And between numbers 6 Press Enter to record the look Examples Rec Cue 2 3 Except bump switch 1 bump switch 4 bump switch 7 Enter records the current look as cue 23 except for channels included in submasters 1 4 and 7 Rec Sub 4 Except Group 3 Enter records the current look in submaster 4 except for the channels included in group 3 Rec Group 5 Except Chan 1 Thru 9 Enter records the current look as group 5 except for channels 1 through
119. ing inhibitive submasters You can not use the Update key to modify inhibitive submasters To modify an inhibitive submaster follow these steps 1 Press Blind 2 Press Sub and enter the submaster number Note If you press Rec Enter Expression deletes the submaster 3 Select the channels you want to add or remove from the submaster 4 Press Rec Sub and the supmaster bump switch to add the selected channels Or press Clear Rec Sub and the submas ter bump switch to delete them 4 46 Expression 2 0 Using Update to modify submasters In Stage mode Update allows you to modify or add channel levels to a recorded submaster without recording the entire stage look to the submaster you are modifying Follow these steps to update a submaster 1 2 Press Stage to display Stage mode Select and set desired levels of the channels you want to add to the submaster Press Update Sub and enter the number or press the bump button of the submaster you want to update Copying submasters You may want to copy a submaster or use submasters as building blocks for new submasters To copy a look from one submaster to another in Stage follow these steps 1 2 Press Stage Set submaster pot s that you want to copy at desired level Make any additional adjustments you want such as selecting channels to add playing back cues through fader pairs bringing up other submasters or
120. inhibitive A lit red LED in the bump switch indicates that an inhibitive submaster is recorded Follow these steps to create an inhibitive submaster 1 Press either Stage or Blind 2 Press Chan to indicate that next number entered will be a channel 3 Enter the channel numbers you want to include in the submaster using the numeric keypad And and Thrul Expression 2 0 Expression saves only selected channels when you record an inhibitive submaster on a color monitor selected channels are displayed in yellow If unselected channels are also displayed they will not be included in the submaster Press Rec Sub to indicate that you want to save selected channels in an inhibitive submaster Press the bump switch of the submaster you want to record Red LED in a bump switch indicates that you have recorded an inhibitive submaster Chapter 4 Learning the basics 4 45 Recording inhibitive submasters on a different page You may record an inhibitive submaster to a page other than the one currently loaded or loading For example if you have page one loaded you can create an inhibitive submaster and record it to page two To do so follow these steps 1 Select the desired channels 2 Press Rec 3 Press Sub 4 Press Pagel 5 Enter the page number on which you want to record the inhibitive submaster 6 Press the bump switch of the submaster you want to record as an inhibitive submaster Modify
121. ions Menu select 10 and press Enter Enter the first macro you want to print or enter O if you want to print all macros Press Enter If you are selecting a range of macros to print Expression prompts you for the last macro Enter the last macro you want and press Enter Exoression sends the report to the printer To cancel the print operation press Clear EXPRESSION LIGHTING CONTROL SYSTEM ELECTRONIC THEATRE CONTROLS INC MACRO OPERATION S CHAN 1 THRU AT FULL AT 00 FULL M2 SETUP 6 ENTER 6 ENTER Chapter 6 Using print and disk options 6 9 Real time programs From the Print Options Menu select 8 and press Enter Expression prints a report of all recorded real time programs on one sheet EXPRESSION LIGHTING CONTROL SYSTEM ELECTRONIC THEATRE ONTROLS INC PROGRAM START CUE TIME ON TIME OFF DAYS OF WEEK TR SA TR FR SA 6 10 Softpatch Expression 2 0 The softpatch report lists current dimmer to channel patches When you select the Print Softpatch option Expression sends the report to the printer immediately No options are available for this report From the Print Options Menu select 6 and press Enter EXPRESSION LIGHTING CONTROL SYSTEM DIMMER LEVEL PROFILE 110 136 55 6 88 4 109 60 6 121 60 6 120 8 117 137 60 6 122 60 6 145 8 128 ELECTRONIC THEATRE CONTROLS INC Chapter 6 Using print and disk options 6 11 St
122. layed 1 Press Chan 2 Enter the channel number you want to display Expression displays levels settings for the channel you select Examples Stage Chan 1 Thru 5 selects channels 1 through 5 Track Sheet Chan 2 displays channel 2 on Track Sheet Chapter 8 Reference 8 13 Clear The gray Clear s primary function is to delete cues and tracks and clear submasters You can also delete channel tracks using Clear Occasion ally an error message may prompt you to press Clear You can also use Clear to clear an incorrect level setting and reset it to zero To do so select channels and press At Clear Deleting a cue submaster or group To delete a cue or clear a submaster follow these steps 1 Press Blind You must be in Blind to delete cues or clear submasters 2 Press Cue Sub or Group 3 Enter the cue submaster or group number you want to delete If you are deleting a group press Enter after you enter the group number 4 Press Clear 5 Press Record to delete cue submaster or group Or press Cue Sub or Group to restore it Expression 2 0 Clearing channel to extend a track Clear allows you to clear levels from selected channels in a cue so that levels from the previous cue will be pulled into the displayed cue If the selected channels were providing new levels that were tracking through subsequent cues levels from the previous cue will now provide those lev
123. le channels and dimmers before you begin custom patching To do so follow these steps 1 2 Press Set Up Select 6 System Settings and press Enter Select 4 Customize Channels and press Enter Enter the total number of required channels up to 250 and press Enter Select 7 Customize Dimmers and press Enter Enter the total number of required dimmers up to 512 and press Enter Or 1 024 dimmers if you have the optional second DMX512 connector 3 6 Expression 2 0 Patching dimmers to channels Each dimmer can only be patched to one channel at a time Follow the steps below to create a custom softpatch 1 Press Patch Expression displays the following screen GRAND MASTER 180 SOFTPATCH l DIMMER CHH TIMMER LEYEL FROFILE 1 251 361 751 i681 252 2 752 i682 253 583 753 1003 254 3 754 i884 255 086 1005 256 386 i666 BL Bz B3 m4 6 6 a 2 SLOH BOTTOM T PREHEAT 5 HEM PRESS ENTER LEVEL OR PRESS 2 Select dimmers to assign to a single channel To select a single dimmer a Enter the dimmer number b Press Enter To select a range of consecutive dimmers a Enter beginning dimmer number b Press Thrul c Enter the ending dimmer number d Press Enter To select a discontinuous set of dimmers a Enter dimmer number b Press And c Enter additional dimmer numbers pressing And between each d Press Enter after you have selec
124. leasttemporarily experiencedacommu nicationserror Suchanerrorisusuallycausedbyapowersurgeor intermittentlinevoltage tmightalsoindicateahardwareproblem Themessageisdesignedtohelpusdiagnoseaproblemifitrecurs Normally youcanpress Clearlandcontinueusingconsolewithoutany problems Consolememoryisnotaffectedwhenmessageisdisplayed Ifthismessageoccursfrequently yourmainconsolepowersupply mightbeoutofadjustment PleasecallETCfieldserviceifthismessage occursoften Expression 2 0 YoucandisablethismessagebysettingDIPswitchB6inthedown position FormoreinformationaboutDIPswitch settings see AppenaixA DIP switch settings Optional feature not installed on this system Theoptionyouselectedisnotinstalledonthisconsole Contactyour authorizeddealerforinformationaboutinstallingoptions Printer is not ready Yourprinterisnotacceptingdata Verifythatprinterisproperlyinstalled andisturnedon _ Reselectthepropersystemsetting parallelorserial foryourprinter Forprinterinstallationinstructions see Chapter2 Installation Record is locked out Recordswitchissetat Lock WhenrecordswitchisintheLockposi tion youcannotadd changeordeleteshowinformationinorfrom memory Toenablerecordfunctions insertthekeyprovidedwith console andturnRecordswitchtothe Onposition Selected show not recorded Theshownumberyouselectedisnotrecordedonthediskindrive Verify failed Showrecordedondiskisdifferentfromtheshowinconsole smemory Ifyoujustrecordedsho
125. lit LED s to take manual control of the fade Once you do this you can control the upfade and downfade levels by manually moving the faders The left A and C faders control the upfade levels the right B and D faders control the downfade Once you have completed the fade you can not reverse it In proportional rate override move the faders below 5 to take control of the fade rate Once you do this the upfade and downfade rate are modified by the position of the faders The left A and C faders control the upfade rate the right B and D faders control the downfade rate You can set the fade rate between 0 Stop and 100 Instantaneous Note You can return to level override by pressing Hold Hold Chapter 8 Reference 8 71 Fader pair function for linked cues effects subroutines and autoloads When you playback linked cues effects subroutines or autoloads containing linked cues the left fader controls intensity levels The right fader controls the playback rate When you begin the cue fade Expres sion plays it back at the recorded rate the LED strip indicates a playback rate of 100 on the right fader To manually control the playback rate move the fader to 5 then move the fader up or down to adjust the rate If right fader is set at a level other than 10 when you start the cue Expression plays it back at an adjusted rate Expression 2 0 The Track feature provides a simple method of tracking channels through several
126. llfade allpart Allfade forces all unused channels to zero intensity and clears the other fader When you press Go for an allfade cue all channels except those set at a level above 00 percent in the selected cue are downfaded to 00 Allfade is useful for forcing an end cue when tracking channels For more information on using allfade for tracking see page 5 15 Subroutine A subroutine is a cue that controls the playback of a series of recorded cues Subroutines are similar to linked cues except that you have more playback options See Chapter 5 Learning advanced techniques for more information Effects Effects are cues that include a series of steps Each step includes a set of channels For more information on effects see Chapter 5 Learning advanced techniques Plusfade Plusfade is available only for subroutines Only channels included in the subroutine are affected all other channels remain at previous levels Example Cue 1 Type 2 Rec Enter records cue 2 with an allfade Chapter 8 Reference 8 75 Update In Stage mode Update allows you to modify or add channel levels to a recorded cue or cue part submaster or group without recording the entire stage look Follow these steps to use Update to modify a cue 1 Press Stage to display Stage mode 2 Select channels and set levels you want to add 3 Press Update 4 Press Cue Sub or Group then enter cue number Note You need not ent
127. master memories each of which can hold up to 24 recorded submasters 250 control channels Proportional control channel softpatch that accommodates up to 512 dimmers or 1 024 if you have the optional second DMX512 connector 400 cue capacity per show Disk drive used to store shows on 3 5 inch disks Two independent timed fader pairs used to play back recorded cues Multipart cues macros subroutines and effects to help automate complex tasks and key sequences Support for optional features Designer s Worksheet Remote Focus Unit MIDI Real Time Clock Serial Button Protocol Redundant Tracking Mode Infrared Remote Focus Unit and Remote Submas ters and Macros Optional expanded memory allows these additional features Alphanumeric keyboard capability Flexichannel display option Group sheet Submaster sheet Expanded macro capacity Chapter 1 Introduction Using this manual 1 3 This manual provides instructions for Expression s features and optional accessories The following chapters are included Chapter 1 Introduction Chapter 2 Installation Chapter 3 Entering softpatch and system settings Chapter 4 Learning the basics Chapter 5 Learning advanced techniques Chapter 6 Using print and disk options Chapter 7 Accessories Chapter 8 Reference Appendix A DIP switch settings Expression capabilities console and manual conventions getting help and customer support Ins
128. mer As long as dimmers are selected highlighted on monochrome monitor or displayed in yellow on a color monitor you can adjust their levels with and Dimmer intensity levels set in softpatch function at full level on all other screens For example if you enter a level of 60 for a dimmer on the softpatch screen when you set that channel to full in a cue or submas ter the dimmer will output at 60 percent Chapter 3 Entering softpatch and system settings 3 9 Dimmer profiles Dimmer profiles allow you to select a specific output curve for a dimmer over the range of a fade This can compensate for nonlinear light outputs from certain types of fixtures or incorporate a preferred response in a fade If you do not select a dimmer profile the console defaults to a linear output To select a dimmer profile for a specific dimmer follow these steps ule 2 Press Patch Press Dim and enter dimmer number or a range of dimmer numbers using And and Thru Press Type Enter profile number Profile numbers are listed on menu at the bottom of the softpatch screen Each is also described below For illustrations of dimmer profiles see page 8 24 0 Linear 1 IES square 2 Slow bottom 3 Fast bottom 4 Slow top 5 Fast top 6 Full at 1 7 Preheat 5 8 Preheat 10 9 Hot patch Dimmer intensity jumps from 0 to 100 at 1 output t Dimmer at 5 or 10 whenever console power is on
129. ms from memory It does not clear macros regions softpatch or system settings To use the option follow these steps 1 Press Set Up 2 Select 8 Clear show from memory and press Enter Expression deletes show except macros regions softpatch and system settings Example Set Up 8 Enter clears show Chapter 8 Reference 8 17 Cue Cue allows you to select a cue to display in Blind mode or to playback in Stage mode or to modify from Track Sheet Pressing Cue indicates that the next number entered will be a cue number Displaying cues in Blind To display in Blind mode follow these steps 1 Press Blind 2 Press Cue 3 Enter cue number you want to display Expression displays the channel settings for the cue Channels are not live Channels that were used in the previous cue but are not included in current cue are displayed with a zero level to indicate a downfade from the previous cue Example Bind Cue 1 displays cue 1 in Blind 8 18 Expression 2 0 Selecting cues in Stage To select a cue to playback in Stage follow these steps 1 Press Stage 2 Press Cue 3 Enter cue number you want to playback next Expression moves the cue you enter to the top of the cue sheet and highlights it 4 Press either Go key Cue plays back To avoid fade times pull fader pair controls down to 0 and back to 10 Example Stage Cue 1 Go plays back cue 1 Chapter 8 Reference 8 19
130. n you should see the message DWS On on the screen Expression 2 0 Using the digitizer To use the digitizer to control console keys touch the corresponding button on the worksheet with the stylus To use submaster pots or the fader wheel drag the stylus along the corresponding control strip The remaining area of the tablet is available for user definable regions Within each of these regions you may assign a sequence of up to 32 console key presses Each region is a special type of macro that you can use to execute cues manipulate channel levels or execute any series of keystrokes Once you have programmed a region you can start the macro by touching the region on the tablet For example you might draw a picture of the stage and outline regions corresponding to various instruments or fixtures on stage or in a studio You might program each region to select the channels for that area of the stage You can then touch that region to select channels and then enter desired level Or you might program more abstract regions on the worksheet For example you might program several areas on the worksheet each representing a song in a band s play list Chapter 7 Accessories 7 7 Programming regions Before you begin programming design your worksheet regions by drawing them on the worksheet tablet provided Place your drawing under the clear plastic cover sheet and you re ready to start To create new or edit existing regions and macros
131. nce readthefirstshowintotheconsole Whenyoureachtheendofshowone readshowtwofromdiskintothe consolefortherestoftheperformance Note Loading a show from disk stops all fades therefore make sure all fades are finished before you load second show No disk in disk drive Thereisnotadiskindrive oritisimproperlyinsertedindrive Insertor reinsertdisk Pressdiskgentlyuntildisksnapsintoplace Diskejection buttonpopsoutwhendiskisproperlyinserted Error messages Not used Consoledoesnotusethismenuoptionnumber Pressanykeyto continue Notice The console has detected an error in the initial boot tests Please note the error indicated below and consult your user manual To continue press Clear Consoleconductsvariousselftestswhilethesystemisbootingup fit detectsanyerrors theconsoledisplayswhichchipsorprocessorsare affected Pleasenotetheerror s indicated lfthismessagesoccurs pleasecallETCfieldserviceat 608 831 41 16 Notice The main processor has experienced a time out in its communication with the face panel processor This may indicate a hardware problem but should not affect the show memory Please notify ETC field service at 608 831 4116 or notify your authorized service center This message can be disabled by setting DIP switch B6 in the down positioRlease consult your User Manual for further information Press clear to continue Thismessageindicatesthatthefacepanelcircuitboardandthemain processorcircuitboardhave at
132. nd press Enter To clear a range of macros enter the first macro number you want to clear and press Enter Then enter the last macro number you want to clear and press Enter To clear all macros press 0 Press Enter to complete the command or press Clear to cancel it Expression 2 0 Sample macros Channel check At 00 Full This macro brings each channel up to full for a channel check Before you begin you ll probably want to bring up at least one channel for working light then clear all other channels from stage Press Stage and start macro Press macro key again to check each subsequent channel Auto channel check At 00 Full Macro Wait 00 02 Mn n macro number This macro automatically runs through each channel with a two second wait in between each channel To pause the automatic check press Macro Wait To resume macro press macro key again Turn off all lights except work lights Chan 1 Thru At 00 Chan n Full n work lights channel This macro captures all channels and sets them to zero This overrides all faders and submasters Then the macro sets work lights at full You can easily return to previous settings by pressing Rel to release captured channels Clear faders and turn work lights on Clear AB Clear CD Chan n Full n work lights channel chapter 6 using print and disk options This chapter includes instructions for using Expression s print and disk options Each of the following
133. ndicates if the shows are identical or not You may want to use this option to verify that your disk is not damaged and that your show was copied to disk without any errors You might also use it to compare backup copies of a show with the current version in memory When using the verify option any fades being executed are interrupted fades resume when read is complete To compare a show recorded on disk with the show in memory follow these steps 1 Insert disk in disk drive 2 Press Set Up 3 Select 3 Verify show on disk and press Enter Expression displays the screen illustrated below TO VERIFY DISH SELECT SHOW NUMBER THEN PRESS ENTER TO ABORT PRESS LEAR EHOW 1 RECORDED SHOH 2 RECORDED CUSE DOUBLE SIDED DOUBLE DENSITY DISH ONLY If either show one or two is currently recorded on disk the screen displays the message Recorded or the date recorded if you have the Real Time Clock option If no show is recorded on disk Expres sion displays the message Not recorded 4 Select either show one or two and press Enter Exoression com pares the show you selected from disk with the show in memory If show on disk matches show in memory Expression displays the message Show on disk matches system memory Expression 2 0 If you receive the Verify failed message you may have any of the following problems e Show on disk is not the same as show in memory e Disk is damaged e Console did not rec
134. nels nor can you use macros or effects Using Redundant Tracking Backup To use Redundant Tracking Backup follow these steps 1 Configure consoles as described in the section titled nstalling Redundant Tracking Backup on page 2 17 2 Turn both consoles on If the master console does not receive any input from the slave console within one minute of initial power up the following mes sage appears on the screen Backup unit is not responding Backup tracking link has been disabled automatically Presss Clear to continue Pressing Clear removes the message and allows you to use the master console in normal single console operation Chapter 7 Accessories 7 23 3 Insert disks into both consoles The show you load into consoles must be identical and must be recorde on the disks as the same show number as either show one or show two 4 Read show into master console All keystrokes on the master console are mimicked on the backup Therefore show is read into both consoles at the same time Continue using master console normally If there is a failure in the slave console during operation or if the communications link between the two consoles is interrupted the following message appears on the screen Backup unit is not responding Check DIP switches and power for Backup unit Check serial communications cable Stand by until communica tion is established or press Clear to break the backup tracking link Clear remo
135. ng groups Expression s expanded memory features an optional alphanumeric keyboard option With the keyboard you can name cues submasters groups and shows Follow these steps to use the keyboard to assign a name to a group 1 Make sure the keyboard is properly connected See instructions in Chapter 2 Installation Press Stage or Blind Press Group then enter the number of the group you want to name Press F1 on the keyboard then enter the desired group name See Chapter 7 Accessories page 7 3 for more information on naming conventions Press Enter on the keyboard to record the group name Press Esc on the keyboard to quit and return to the original display screen Chapter 8 Reference 8 41 Group Sheet Group Sheet is a feature of Exoression s expanded memory option It is available only when expanded memory is installed The group sheet allows you to display all recorded groups on screen To display Group Sheet press Blind Group Page Group Sheet displays the first 32 recorded groups To display additional groups press Blind Press to return to Blind or press another stage display button to move to another display mode Group Sheet also displays group names if you have an alphanumeric keyboard 8 42 Expression 2 0 Help Help provides a brief explanation for all key functions To display help screens 1 Press Help 2 Press any key on the console Expression displays
136. ng modified cues The difference between Record and Track is apparent when you modify a cue or insert a new cue between two existing cues Record and Track produce different results The following keys were pressed to release captured channels and play back cue 1 Stage Rel Rel Release captured channels Cue 1 Go Play back cue 1 Chan 1 At 5 0 Modify channel 1 to 50 percent With cue 1 in a fader pair channel 1 is modified to 50 percent To change a channel level that affects only the cue you modify use Rec Modify the cue press Rec enter the cue number and press Enter Only the current cue is modified The track that encompasses the channel is interrupted but continues in the following cues at the origi nally tracked level The results of modifying cue 1 and using Rec are illustrated in Figure 2 Cue2 Cue3 Cue4 Cued5 Channel 1 FF FF 25 00 Channel 2 FF FF FF 00 Channel 3 FF FF 00 Channel 4 FF 00 Channel 5 Figure 2 Note that channel 1 is not affected in cues 2 and 3 Also note that when you record a modified cue that is in a playback fader pair the changes are reflected in the fader That is when you release the channels you have modified they remain on stage Expression 2 0 If you change the level in the beginning or middle of a track you may want the change to continue through the remainder of the original track To track the level modification we just recorded in the example above u
137. nnels may be in any of the following modes Each mode responds differently to your commands Captured channels Captured channels are channels that you have selected and are live on stage They remain live until you press Rel to release them Captured channels override all other channel settings For example if a chan nel is in a fader at 100 percent and you capture it and set it to 50 per cent Expression reads the 50 percent setting from the captured channel You can capture channels while in either Stage or Fader mode but not Blind or Track Sheet modes since they are not live Exoression displays captured channels in red and yellow on a color monitor Red channels are captured yellow channels are captured and selected see below Selected channels Selected channels are channels that you have immediate keyboard control over You can modify selected channels with Full At or the fader wheel Selected channels are highlighted on a monochrome monitor and are displayed in yellow on a color monitor You can select channels in all display modes Selected captured channels are live channels that are under immediate keyboard control Channels can be selected and captured only in live modes You can select channels in Blind but they won t be captured since Blind mode is not live Chapter 4 Learning the basics 4 7 Recorded channels Recorded channels are channel levels that have been recorded in a cue group or submas
138. nt and is reset to 100 percent after a diagnostic system clear When you set the default full level below 100 percent you can still set channels above the Full level setting by using At or the fader wheel To set Full at a level other than 100 percent follow these steps 1 Press Set Up 2 Select 6 System Settings and press Enter 3 Select 1 Default Full Level and press Enter 4 Either enter a two digit intensity level or press Full to set level at 100 percent Note When you set dimmer levels on the softpatch screen Full enters 100 percent regardless of the default full level setting Setting default up and down fade times Expression automatically enters default up and down fade times unless you specifically change them A diagnostic system clear resets the defaults to five seconds To customize default fade times follow these steps 1 Press Set Up 2 Select 6 System Settings and press Enter 3 Select 2 Default Up Down Times and press Enter 4 Enter upfade time in minutes and seconds or as a fraction of a second in decimal format then press enter Fade times can be from 1 second to 99 59 minutes 5 Enter downfade time in minutes and seconds or as a fraction of a second in decimal format then press Enter Fade times can be any length of time from 1 second to 99 59 minutes Chapter 3 Entering softpatch and system settings 3 15 Setting default fader clear times The
139. ny type of cue in an autoload For example you might want to run a regular crossfade cue in one fader and an effects cue in the other Autoloads also let you playback the same effects cue at different rates during different times in the show Expression lets you store up to 25 autoloads they are not cues and are not included in the 400 cue limit To record an autoload from Stage you will first load and playback a cue or effect in each fader set Then you can make manual adjustments to playback rates or intensity levels for linked cues or effects if necessary When you save the autoload Expression records any manual adjust ments you have made Expression 2 0 Recording autoloads from Stage To record an autoload from Stage follow these steps 1 2 8 9 Press Stage Press Cue and enter one of the cue numbers you want to record in the autoload Press the AB fader Go to start the first cue Press Cue and enter the second cue you want to record in the autoload Press the CD fader Go to start the second cue Make any rate and intensity adjustments necessary to linked cues or effects while they are running For linked cues and effects faders A and C control intensity levels faders B and D control playback rates See page 5 44 for more information on taking manual control of autoloads When you include crossfade or allfade cues you cannot adjust their fade times Press Rec Press Autoload
140. o cancel operation and leave clock at previous setting Chapter 7 Accessories 7 21 Serial Button Protocol Serial Button Protocol lets you use a host device such as a personal computer to send keyboard commands to Expression In effect the protocol lets you push all the console buttons from the host device Serial Button Protocol can be used in architectural applications or any computerized lighting control system For more information about the protocol contact ETC 7 22 Expression 2 0 Redundant Tracking Backup Redundant Tracking Backup allows you to connect two Expression consoles one as the master console and the other as the slave backup The slave console mimics all key presses from the master If the backup console detects an interruption in the master console s operation the slave takes over Both consoles begin the performance with the same show loaded As the performance proceeds all keystrokes entered on the master console are mimicked on the backup console Therefore the backup console is not only synchronized with the performance but all last minute updates are recorded on both consoles Redundant Tracking Backup is a standard feature on Expression Note You can use a Concept or Impression to backup an Expression However the show cannot include features that are not included on both consoles For example if you backup an Expression console with an Impression console you cannot use more than 150 chan
141. o printer 5 ground 7 8 CTS 20 Console connector pins 1 4 6 7 and 9 are not used Printer connector pins 1 4 through 6 8 through 19 and 21 are not used Clear to send CTS signal allows printer to interrupt the flow of data when printer s buffer is filled Console only transmits data to printer when this line is held low 12 VDC Chapter 2 Installation 2 13 Installing Designer s Worksheet Designer s Worksheet is one of the remote units available for use with Expression Refer to Kurta digitizer tablet documentation if you need more information Designer s Worksheet operation instructions begin on page 7 5 Follow these steps to install your Designer s Worksheet 1 Insert the 6 pin XLR connector of the Designer s Worksheet cable assembly into Expression s connector labeled DWS RFU 2 Insert the plug end of the pointing device pen or stylus in the worksheet connector labeled Pen Cursor 3 Attach the pen holder to the upper left or right hand corner of the worksheet by removing the protective paper from the base and pressing the adhesive to the tablet 4 Place one printed template sheet under the clear plastic flap on the digitizer 5 Set the voltage selection switch to match your electrical outlet In the US set the voltage switch to 110 6 Insert the power cord into the back of the worksheet and into a grounded 120V AC outlet Note Additional pads of Designer s Worksheet templates are av
142. o record the name or press Esc to quit and return to Setup display Chapter 7 Accessories 7 5 Designer s Worksheet Designer s Worksheet gives you control of the console from any remote location such as in the house on the set or backstage The Designer s Worksheet is a digitizer tablet that emulates the console face panel in addition to providing user definable regions All functions may be se lected using a stylus Three digitizer templates are available The correct template for your worksheet depends on your digitizer s size and your console s memory 12 x 12 inch digitizer If you own a 12 x 12 inch digitizer and do not have expanded memory you can program up to 125 regions and you can use the digitizer to control submasters and faders 12 x 12 inch digitizer with expanded memory If you own a 12 x 12 inch digitizer and have expanded memory you can program up to 640 regions and you can select one of two digitizer layouts One layout provides control of submasters and faders while the other deletes the submasters for increased workspace area 17 x 12 inch digitizer tablet requires expanded memory You must have expanded memory to use 17 x 12 inch digitizer The larger digitizer allows you to program up to 640 regions you cannot control submaster pots with the 17 x 12 inch digitizer If you have not yet installed your Designer s Worksheet see Chapter 2 Installation When your worksheet is installed and turned o
143. on Cue submaster description line The cue submaster description line displays information about the currently selected cue group or submaster The summary includes cue group or submaster number up and down fade times wait and delay times fade or submaster type and link information if applicable Fader windows Fader windows display fade time information for cues loaded in fader pairs The window displays the cue number a running clock of the fade and the percentage of the fade time that has run Cue sheet The cue sheet lists up to nine stored cues Each cue listing includes fade wait and delay times and cue name and link information Q Operator prompt line The operator prompt line displays messages to guide you through Expression operations For example when you press Chan this line displays the message Select channel numbers If you are having problems look here for information or help Page display The page display indicates which submaster page is currently loaded If any submasters from the previously loaded page are still active the message Page 2 loading is displayed The message changes to Page 2 loaded when all submasters are loaded from the new page Submaster window The submaster window displays the current level settings for submas ters On a color monitor pile on submasters are displayed in green and inhibitive submasters are displayed in red 4 6 Expression 2 0 Channel modes Cha
144. on must float Verify compatibility with your dealer if you are not sure 3 Insert the key into the power switch and turn it to the Off position 4 Insert the female end of the power cord in the connector labeled Power in on the console s back panel 5 Insert the male end of the console power cord in a grounded 120 VAC outlet For 220 VAC operation consult ETC 6 Insert the female end of the monitor power cord in the monitor connector and the male end of the monitor power cord in the console connector labeled Power out 2 4 Expression 2 0 7 Insert the video cable in the monitor Connect the other end of cable in the appropriate console connector listed below Digital RGB color monitors DB 9 connector Digital grayscale monitors DB 9 connector Composite monochrome monitors BNC connector 8 Turn console and monitor power switches to their On positions Expression performs a series of self tests and displays the options enabled on your console Installing two monitors You may want to install two monitors at the same time one next to the console and one at a remote location Install one monitor using the color video connector and the other using the monochrome video connector The color monitor should be located next to the console because the length of the color cable is limited to about 10 feet The monochrome cable RG59U can be as long as 150 feet Therefore use the mono chrome monitor at the remote location W
145. or consequential damages damages to property damages for loss of use time profits or income or any other damages The owner s obligations during the warranty period under this warranty are to notify ETC at ETC s address within one week of any suspected defect and to return the goods prepaid to ETC at their factory or authorized service center THIS WARRANTY IS CONTINGENT ON THE CUSTOMER S FULL AND TIMELY COMPLIANCE WITH THE TERMS OF PAYMENT SET FORTH IN THE TERMS AND CONDITIONS THIS WARRANTY IS EXPRESSLY IN LIEU OF ANY AND ALL OTHER WARRAN TIES EXPRESSED OR IMPLIED INCLUDING THE WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE AND OF OTHER OBLIGATIONS AND LIABILITIES ON OUR PART THE OWNER ACKNOWLEDGES THAT NO OTHER REPRESENTATIONS WERE MADE TO HIM OR RELIED UPON HIM WITH RESPECT TO THE QUALITY AND FUNCTION OF THE GOODS SOLD This written warranty is intended as a complete and exclusive statement of the terms thereof Prior dealings or trade usage shall not be relevant to modify explain or vary this warranty Acceptance of or acquiescing in a course of performance under this warranty shall not modify the meaning of this agreement even though either party has knowledge of the perform ance and a chance to object table of contents Chapter 1 Introduction iio ccccceccccecesevvseeeseevevesvnvevnevnenenteseeeenneeee ea Expression TEATULOS oee e r Er EA EE EE TER A E 1 2 USING this M
146. ord show to disk correctly Retry recording or reading show if you receive this message If it recurs try a new disk The message Configurations differ cannot verify indicates one the following e Show on disk was saved on a different type of ETC console or a different software version e Show on disk has different system settings such as softpatch numbers of dimmers and channels than show in console Erase show from disk If you want to erase a show from a disk use the Erase show from disk option Once a show is erased from a disk you cannot retrieve it When using the erase option any fades being executed are interrupted fades resume when erase is complete To erase a show from disk follow these steps 1 Insert disk in disk drive 2 Press Set Up 3 Select 4 Erase show on disk and press Enter 4 Select either show one or two and press Enter Or press 0 and Enter to erase both shows chapter F GCCESSONMES This chapter includes instructions for working with the following Expression optional accessories Alphanumeric keyboard Designer s Worksheet Infrared Remote Focus Unit IRFU Remote Focus Unit RFU MIDI Real Time Clock Serial Button Protocol Redundant Tracking Backup Remote Submasters and Macros For accessory installation instructions see Chapter 2 Installation For purchase information please contact your local dealer or ETC 7 2 Expression 2 0 Alphanumeric keyboard The
147. ot screen e Options installed e Dimmer installation type To reach Electronic Theatre Controls customer service department call 608 831 4116 Monday through Friday from 9 00 AM to 5 00 PM Central Standard Time For emergency service after hours and weekends call 608 831 4773 Your call will be answered electronically and automatically forwarded to a service representative who will contact you as soon as possible Address all correspondence about Expression to Electronic Theatre Controls Customer Service Department 3030 Laura Lane Middleton WI 53562 chapter 2 installation This chapter includes set up instructions that you need to install Expres sion and any optional accessories Chapter 3 Entering softpatch and system settings includes instructions for entering the software settings that you will probably update before you begin a new show This chapter includes the following installation procedures Installing your Expression console and monitor Entering system configuration Installing dimmers Installing printer Installing Designer s Worksheet Installing Remote Focus Unit RFU Installing MIDI Installing Redundant Tracking Backup Installing Infrared Remote Focus Unit IRFU Installing Remote Submasters and Macros Installing alphanumeric keyboard An illustration of Expression s back panel is included on the next page Operating instruction for optional accessories are included in Chapter 7 Accessories 2 2
148. ou do not enter an upfade wait time Expression assumes you want an upfade wait time of zero 11 Enter downfade wait time Downfade wait time is the length of time after the multipart cue starts before the downfade If you do not enter a downfade wait time Expression assumes you want an downfade wait time of zero 12 Repeat steps 2 through 11 for each part you want to create Note You do not need to rerecord the part to add fade and wait times 5 6 Expression 2 0 Converting a standard cue to a multipart cue If you have already created a single part cue Expression allows you to reconfigure it as a multipart cue You can convert a standard cue to a multipart cue in either Stage or Blind mode As you break the cue into parts to convert it to a multipart cue Expres sion automatically creates cue part number eight Any channels not included in the first recorded part are automatically assigned to part eight As channels are assigned to new parts they are automatically deleted from part eight Follow these steps to convert a standard cue to a multipart cue 1 Press Blind or Stage to display the Blind or Stage mode screen 2 Enter the cue number 3 Press Chan then select the desired channels for a specific part 4 Use the numeric keypad level wheel or keys to enter the desired level setting 5 Press Rec Step Part then enter the part number with the nu meric keypad 6 Press Enter 7 Repeat steps
149. oup on stage follow these steps 1 2 3 Press Stage Press Group and enter group number Move fader wheel to adjust channels in their proportional recorded levels or press Full to set them at 100 percent of recorded level or press At and a two digit number to set them at a percentage of recorded levels Chapter 5 Learning advanced techniques 5 23 Modifying groups Expression allows you to modify groups in Blind or Stage modes though the process is different Modifying groups in Blind Follow these steps to modify a group in Blind 1 2 Press Blind Press Group to indicate that you are entering a group Enter the group number you want to modify Press Enter Warning If you do not press Enter after Group Expression displays the current look as it is being modified by the group To modify the group you must press Group enter the group number and then press Enter Set or modify channel levels Use Full to set levels to their full recorded levels At to set them at a percentage of the recorded levels or the fader wheel to have incremental control of levels Press Rec Enter 5 24 Expression 2 0 Modifying groups in Stage To add the look on stage to a group in Stage follow these steps 1 2 Press Stage Press Group to indicate that you are entering a group Enter the group number you want to modify Set or modify channel levels Use Full to set le
150. ps as described above and using the following editing keys 14 Step Part Selects steps numbers Selected steps are highlighted Cue Select Style Type Arrow keys And Thru At Full Time Rec on a monochrome monitor or displayed in yellow on a color monitor Allows you to enter a cue number for the selected step Displays the style menu Allows you to select from the following fade types Crossfade All increasing levels fade during upfade time all decreasing levels fade during downfade time Allfade All channels fade to black Plusfade Increasing levels fade during upfade time adding to current look no channels downfade Use the arrow keys to move from one field or line to the next For example press arrow down to select the next step or press right arrow to enter information one field to the right of the current field Selects steps Selects steps Sets intensity level Sets level at full Sets upfade downfade and delay times Records the subroutine as a cue Press Rec enter cue number and press Enter to record subrou tine cue 5 40 Expression 2 0 Deleting a step Press Step Part and enter the step number Then press Clear Expres sion deletes the selected step and renumbers the remaining steps Inserting a step Press Step Part and enter the step number where you want to insert the new step Press Step Part again Expression inserts a blank step
151. r 5 Learning advanced techniques 5 3 Lesson 1 Working with multipart cues A multipart cue is a cue that consists of up to eight parts each of which is essentially an independent cue A multipart cue allows you to control the levels and timing of more than one group of channels at a time Each part of a multipart cue may consist of any number of channels but a channel may only be included in one part of a given multipart cue If you record a channel that was previously included in a different part the channel will appear in the new part and will be removed from the previously created part Multipart cues are stored like normal cues in the console s memory and on disk but each multipart cue takes up the same memory space as three standard cues Wait times in multipart cues Upfade and downfade wait times allow you to program upfades and downfades that do not start immediately when you start the multipart cue When you run a multipart cue with wait times some parts may start immediately and others may start up to 99 59 minutes later depending on the assigned wait time The total duration of a multipart cue is measured from when the Go button is pressed to when the last fade ends Note Fade and wait times cannot be assigned to a part until the part is recorded Either record a part and then assign times to it or record the entire multipart cue then assign times to all its component parts at once 5 4 Expression 2 0 Crea
152. r out regardless of its current condition The last two options are most useful for submasters with a long or infinite wait time To enter a bump switch that functions normally that is starts a timed submaster or changes the direction of a running fade just press the bump switch Expression enters the message SUBW where Nis the submaster number To enter a bump switch that fades the submaster to full press and hold the bump switch and press Enter Exoression enters the message ON SUBWN where N is the submaster number To enter a bump switch that fades out submaster press and hold the bump switch and press Clear Expression enters the message CLEAR SUBWN where N is the submaster number Running a macro To run macros one through five press the appropriate blue macro key For example to run macro one press M1 To run macros six and beyond press M the number of the macro and Enter For example to run macro 10 press M 1 0 Enter Putting a macro on hold You can put a running macro on hold by pressing Macro wait To release the macro from hold press the macro button again or M and the macro number for macros 6 and beyond Chapter 5 Learning advanced techniques 5 51 Cancelling a macro To cancel a running macro press the macro key again or press Macro wait twice Deleting a macro To delete a macro follow these steps 1 2 Press Setup Select 11 Clear macro buttons a
153. r profiles see page 3 9 You will find instructions on the following pages for one to one soft patch customized softpatch and additional softpatch features If you are patching dimmers in a Strand CD80 dimmer rack see page 3 12 for special instructions Chapter 3 Entering softpatch and system settings 3 3 Entering one to one softpatch If you have the same number of dimmers and channels you may want to use a one to one softpatch A one to one patch assigns dimmer one to channel one dimmer two to channel two and so on If you have more dimmers than channels the default setting assigns the first extra dimmer to channel one the second extra dimmer to channel two and so on To use Expression s default softpatch setting follow these steps 1 2 Press Set Up Select 6 System Settings and press Enter Select 4 Customize Channels and press Enter Enter the total number of required channels up to 250 and press Enter Select 7 Customize Dimmers and press Enter Enter the total number of required dimmers up to 512 and press Enter Select 8 Default softpatch and press Enter Press Rec to assign the default softpatch settings Or press Clear to cancel the operation See instructions in this chapter titled Proportional patching for instructions on inhibiting individual dimmer levels within a channel Note For instructions on performing a dimmer check from the patch screen withou
154. rase show 6 20 Error messages A 2 Except 8 28 Expand 8 31 Expanded memory features alphanumeric keyboard 7 2 flexichannel 4 3 8 35 Group Sheet 5 28 group sheet 6 7 8 41 keyboard 2 18 7 2 naming cues 4 9 7 3 naming groups 7 3 8 40 naming shows 4 49 7 4 naming submasters 4 37 4 48 7 3 Submaster Sheet 4 48 8 65 Extending tracks 8 14 F Fade times 4 15 submasters 4 41 Fade types 8 74 Fader clear time default setting 3 15 Fader display 8 32 Fader override modes 4 2 4 30 8 70 selecting 4 31 Fader pairs clearing 4 35 Fader wheel 8 33 Fader windows 4 5 Faders 4 30 8 70 Index level override 8 70 manual 4 29 proportional rate override 8 70 using to run autoloads 8 71 effects 8 71 linked cues 8 71 subroutines 8 71 Features 1 2 Flash 8 34 Flexichannel 4 3 8 35 removing channels from display 4 3 Formatting disks 4 50 6 16 Full 8 36 setting default 3 14 G Getting help 1 6 Go 8 37 Goto cue 4 28 Grand master 8 38 Group Sheet 6 7 8 41 Groups 5 2 5 21 6 6 8 39 creating 5 22 deleting 5 25 displaying 5 22 modifying 5 23 modifying cues or submasters with 5 27 naming 7 3 numbering 8 39 H elp 8 42 customer service 1 6 old 8 43 l nfinite submaster wait times 5 50 8 44 8 69 nfrared Remote Focus Unit IRFU 7 10 enabling 2 19 installing 2 19 pinout 2 19 Inhibitive submasters 4 43 modifying 4 45 Inserting cues 4 21 5 13 Installation console 2 3 Designer s Worksh
155. re set Setting a fader at 0 stops the fade setting it at 5 sets the fade rate at 100 percent of the recorded rate If you set a fader at 10 the fade is instantaneous You can set the level before you start the cue running or move the faders once the fade starts Chapter 4 Learning the basics 4 31 Selecting fader operating mode Follow these steps to select the desired fader mode 1 2 Press Setup Select 6 System Settings Menu and press Enter Select 6 Level Proportional Rate Override and press Enter Press 0 to select level override mode or press 1 to select propor tional rate override mode Manual control of linked cues When you play back linked cues the left fader in each fader pair controls intensity levels the right fader controls the playback rate When you begin a linked cue sequence with the right fader at 10 Expression plays it back at the recorded rate The LED strip on the right fader indicates that playback is at recorded rate by holding at 5 To take manual control of the playback rate move the fader down to 5 then move it up or down to adjust rate Moving the fader control to 10 makes playback instanta neous moving it to 0 stops playback If right fader is set at anything other than 10 when you start the autoload the linked cues or effects playback at the rate set on the fader 4 32 Expression 2 0 Modifying cues on stage To modify and record a cue on stage follow these steps
156. recorded cues to one another so that they playback automatically in the sequence you link them Each cue in the link counts as one cue in the 400 cue limit Link also allows you to link macros to cues When you link a macro to a cue it begins as linked cues do after the duration of the delay time To link cues to cues or cues to macros follow these steps 1 2 In either Stage or Blind press Cue Enter number of first cue you want in linked sequence and press Enter Press Link To link cue to another cue press Cue Then enter number of second cue in linked sequence and press Enter To link cue to a macro press Enter Macro Then enter the number of the macro you want linked to the cue and press Enter Enter desired delay time and press Enter The delay time is the length of time between the beginning of a cue and the beginning of the cue or macro to which it is linked Expres sion calculates and enters a default delay time The default delay time is the total running time of the previous cue in the sequence The total running time is whichever is longer of the upfade time and the sum of the wait and downfade times The default delay time plays the entire first cue and then plays the second cue immediately afterward To link more than two cues repeat steps two through five for each link Note To change the delay time for a cue that is already linked to anther cue or macro select the first
157. red Remote Focus Unit Diagnostic system clear Designer s Worksheet options Enable disable Flexichannel Chapter 3 Entering softpatch and system settings page 3 14 Chapter 3 Entering softpatch and system settings page 3 14 Chapter 3 Entering softpatch and system settings page 3 15 Chapter 3 Entering softpatch and system settings page 3 3 Chapter 7 Accessories page 7 15 Chapter 4 Learning the basics page 4 30 Chapter 3 Entering softpatch and system settings page 3 3and3 5 Chapter 3 Entering softpatch and system settings page 3 3 Chapter 3 Entering softpatch and system settings page 3 10 Chapter 2 Installation page 2 10 Chapter 2 Installation page 2 6 Chapter 2 Installation page 2 7 Chapter 7 Accessories page 2 20 Chapter 3 Entering softpatch and system settings page 3 15 Chapter 7 Accessories page 2 19 Chapter 8 Reference page 8 27 Chapter 2 Installation page 2 15 Chapter 7 Accessories page 3 16 8 68 Expression 2 0 Thru Thru allows you to select a range of channels or cues You can then enter an intensity level for the entire range at one time For example you can select channels 1 through 10 You can also use Thru in conjunction with And to select a set such as 1 through 10 and 15 through 20 To select a range of cues or channels follow these steps 1 Press Chan or Cue whichever you are selecting 2 Enter a c
158. rent page ccceeeesceeeeeteeees 4 40 Adding fade times to SUDMASTEMS eeeeeececeeeeteceeesesseeeesestseeeees 4 41 Controlling submaster fades Manually c cccccceeceeesseeeeeeesees 4 42 Modifying pile On submasters cccceecesececeeeeeeceeseeeeeeeesteaeeees 4 42 Creating inhibitive SUDMASTELS c cc ceeeeeeceeeeesteeeeeeesteeeeeeeeaees 4 43 Recording inhibitive submasters on a different page 4 45 Modifying inhibitive SUDMASTETS ccccccccceeeeteceeeeeeeeeeetteeeees 4 45 Using Update to modify SUBMASTETS cceeecceceeeeteeeeeeteeeees 4 46 COPYING SUBMASTEMS Anere aaee EATS bans 4 46 Deleting SUDMASTETS 2 0 0 ceccecc cece cceeeeeceeceeeeeeteeeeteeseeceesaeeeeeeenens 4 47 Submaster SHECt oo cece cece ccc a a R da 4 48 iv Expression 2 0 Lesson 5 Saving your SHOW ON ISK oneinieenreonss iaie Nis 4 49 Naming SHOWS kiirni eae hie es eee ee 4 49 Formatting GISKS osiin ennaa aeee eas 4 50 Recording a show on ISK c ccceceeeeeeeeceeeeeeeteeeceeeeeeeneeeeeeeeeeees 4 51 Verifying a SHOW Ondek csempe odi EE eed 4 52 Chapter 5 Learning advanced techniques 5 1 Lesson 1 Working with multipart CUCS cccccceeeecceeeeteeeeeeeeeeeeees 5 3 Wait times in multipart CUCS 2 0 0 0 ceececececeeeeeeeceeeeeceeeeeeeeeeeeeeenees 5 3 Greatingia Multipart Cue cerea ee E 5 4 Converting a standard cue to a multipart CUC sss iissse
159. reports is explained and illustrated on the following pages Cues Cue sheet Designer s Worksheet Groups Group Sheet Macro buttons Real time programs Softpatch Stage display Submasters Submaster Sheet Track Sheet Expression is equipped with a 3 5 inch disk drive on the right side panel of the console It allows you to save backup copies of shows on disk Disk options and disk management are discussed in the section titled Disk management on page 6 15 The following options are described Format disk Record show on disk Read show from disk Verify show on disk Erase show from disk 6 2 Expression 2 0 Print options Before you begin printing verify that your printer is installed correctly and that it is turned on For instructions on installing printers see Chapter 2 Installation Fades in progress pause when reports are printing All print options are located on the Print Functions menu To display the menu press Set Up select option 7 Print Functions and press Enter Expression displays the Print Functions screen illustrated below GRAND MASTER Lea PRINT FUNCTIONS SELECT FUNCTION PRINT STAGE DISPLAY PRINT CUES PRINT GROUPS PRINT SUBNAST ERS PRINT TRACK SHEET PRINT SOFTPATCH PRINT CUE SHEET PRINT REAL TIME PROGRAMS PRINT DESIGNERS WORKSPACE PRINT MACRO BUTTONS E 1 2 3 4 E 6 7 g 3 a ja SELECT FUNCTION NUMBER THEN PRESS TER CPRESS CLEAR TO RETURN TO SETUP MENNI
160. resented in the Submaster Sheet Submasters with recorded levels are displayed in blue those with no recorded levels are displayed in green Inhibitive submasters are dis played in red If a submaster is recorded with specified upfade and downfade times the times are displayed Submaster names are also displayed if alohanumeric keyboard is installed 8 66 Expression 2 0 System Settings Menu The System Settings Menu includes options for setting default values softpatch customizing options system configuration options and access to the Designer s Worksheet options menu The chart on the next page indicates where each menu option is described in this manual To display the System Settings Menu follow these steps 1 Press Set Up 2 Select 6 System Settings and press Enter The System Settings Menu is displayed below GRAND MAETER 1804 EYSTEM SETTINGS SELECT 1 2 3 4 3 6 7 g 3 A 1 2 3 4 a 6 7 8 Bee Bee pon pant pa HUMBER THEN PRESS ENTER TO RETURN TO SETUP MENU Chapter 8 Reference System setting options Default full level Default up down fade times Default fader clear time Customize channels Select MIDI channel Level proportional rate override Customize dimmers Default softpatch Default dimmer profiles Serial parallel printer Color monochrome monitor Fast ull boot test Enable disable remote submasters Enable disable bump switches Enable disable Infra
161. ress Set Up Select 6 System Settings and press Enter Select 18 Enable disable Flexichannel and press Enter Select 0 to enable or 1 to disable bump switches Press Enter chapter 4 learning th basics This chapter includes lessons on working with Expression s basic features cues and submasters When you complete the lessons you will have a short sample show to run Each lesson is described briefly below e Lesson 1 describes display and channel modes and record functions e Lesson 2 includes instructions for creating several cues using several different methods e Lesson 3 includes instructions for playing back cues and submasters e Lesson 4 includes instructions for creating submasters using several different methods e Lesson 5 includes instructions for saving your work on disk If these lessons seem too elementary for you but you want some guidance on advanced features read Chapter 5 Learning advanced techniques For an alphabetical listing and explanation of all features keystrokes and menu options see Chapter 8 Reference 4 2 Expression 2 0 Lesson 1 Display channel and record modes This lesson describes display and channel modes and record functions available in Expression Display modes show channel and level settings for cues submasters groups and fader pairs Channel modes indicate how channels respond when they are in different situations Expression s record functions create cues d
162. ressing and Press Rec Enter to record the modified part Expression 2 0 Modifying fade and wait times If you do not assign fade and wait times to a part Expression automati cally assigns five second upfade and downfade times to it No wait time will be recorded Follow these steps to assign fade and wait times to parts in a multipart cue 1 Press Blind Expression displays the Blind mode screen The Cue LED lights prompting you to enter a cue number Enter the cue number Press Step Part then press or until the part you want to edit is displayed Press Time Enter an upfade time between 1 second and 99 59 minutes and press Enter You can enter time either in minutes and seconds or as a fraction of a second in decimal format For example all of the following are acceptable 2 00 12 5 5 5 30 Enter a downfade time if different from the upfade time you se lected If you do not enter a time Expression assumes you want the same time Enter upfade wait time Upfade wait time is the length of time after the multipart cue starts before the upfade begins If you do not enter an upfade wait time Expression assumes you want an upfade wait time of zero Enter downfade wait time Downfade wait time is the length of time after the multipart cue starts before the downfade begins If you do not enter a downfade wait time Expression assumes you want a downfade wait time of zero Chapter
163. rogrammablefadetimes e Manualoverrideofupfadeanc ordownfade e _Levelorproportionalrateoverride e Crossfades e Pile onfades e Splittimefades e Manualfades e Userselectabledefaultfadetimes e Eightpartcues e Backfunction e Clearfunctionwithuserselectabledefaultfadeouttimes Specifications 24submasterpotentiometers 2pagesof24recordedsubmasterlooks Fullyoverlappingchannelassignments Proportionalchannellevels Bumpswitchonall24submasters Recordablefadeandwaittimes 12submastersprogrammablefor inhibitiveoperation Updateandrestorefunction Optionalreadbackfromanalogconsole RealTimeClocktoprogramupto10eventsforplaybackonpre scribeddaysoftheweek optional Grand Masteron 100mmpotentiometer Blackoutfunction Keyboard functions Cuefunctions e Cuefunctionselectionforcuenumbers 1to999 9 e Clearcuesfunction e Fadetypeselection e Fadetimes Discreteupfadeanddownfade times 00 00 99 59 foreachcue e Linkedcuesequences e Waittime Updateandrestorefunction Optionalalohanumerickeyboard Channel functions Channelfunctiontoallowchannelstobeselectedbykeypad Groupfunctiontoallowchanneltobemanipulatedasproportionally balancedgroups Andland ThroughIfunctionsforselectionofchannels cuesand dimmers Fulllfunctionwithuserselectabledefaultlevel Dimmerfunctiontoselectdimmersinsoftpatch Releasefunctiontoreleasecapturedchannels Expression 2 0 Macro function e 125macroselectionsfortheprogr
164. rst group number you want to print or enter 0 if you want to print all recorded groups Press Enter If you are selecting a range of groups to print Expression prompts you for the last group number to print Enter the last group number you want and press Enter Expression sends the report to the printer To cancel the print operation before Expression sends the report to the printer press Clear EXPRESSION LIGHTING CONTROL SYSTEM ELECTRONIC THEATRE CONTROLS INC GROUP 3 1 2 3 4 15 16 17 18 19 20 21 22 23 24 31 19 27 28 29 39 43 44 45 46 47 48 28 51 52 53 63 67 68 69 70 71 72 31 FF 75 76 77 87 91 92 93 94 95 96 Chapter 6 Using print and disk options 6 7 Group Sheet Group Sheet is a feature of Exoression s expanded memory option Expression will only the print group sheet report when the expanded memory option is installed The group sheet report lists all recorded groups If you have named the groups using the optional alohanumeric keyboard the group name is also included in the printout To print group sheet select 11 from the Print Options menu then press Enter EXPRESSION LIGHITNG CONTROL SYSTEM ELECTRONIC THEATRE CONTROLS INC GROUP SHEET BLUE CYC RED CYS BLUE BACKS PINK FRONTS AMBER DOWN LIGHTS 6 8 Expression 2 0 Macros The macro buttons report lists all recorded macros It also prints Designer s Worksheet regions since they are specialized macros From the Print Opt
165. s and the new cue begins from the levels at which the previous cue was interrupted 4 28 Expression 2 0 Go to a different cue To playback a cue other than the selected highlighted cue on the cue sheet follow these steps 1 Press Cue 2 Enter the cue number you want to play next 3 Press Go Hint If you want to force a cue to its recorded levels immediately without waiting for the recorded fade times when fade starts pull faders down to meet lit LEDs then push them to 10 100 percent Chapter 4 Learning the basics 4 29 Controlling fades manually Expression provides two fader modes to take manual control of cue playbacks with the AB and CD fader pairs level override and proportional rate override In both fader modes setting faders at 10 before pressing Go plays cues back as recorded setting faders at 0 before you press Go gives you manual control of fade from the beginning of cue In level override mode if you start a cue and want to take manual control slide faders down to meet the lit LEDs Expression gives you control of the fades In proportional rate override mode you must move the faders below 5 to take manual control Hint If you start a cue and the performers skip ahead to the next cue you have two options for speeding up to the next cue If you do not need the current cue to reach its full intensity level settings press Go to interrupt the current cue and begin the next one However if
166. s Captured channels are live channels that you have selected in Stage or Fader modes Captured channels may or may not be under direct control of the keyboard When you press Rel Expression first releases captured channels that are under direct keyboard control selected channels If you press Rel again Expression releases all remaining captured channels Captured channels always take precedence over other controls For example assume a channel is included in a submaster which sets it at 75 percent If you capture the same channel and set it to 50 percent the 50 percent setting takes precedence When you release it it returns to the level determined by other outputs Note You can release a subset of all captured channels by selecting the channel s and pressing Rel Other channels remain captured Chapter 8 Reference Setup Setup displays the Setup Menu which is illustrated below The Setup Menu provides access to disk options System Settings Menu print options clear cues option real time clock option macro options and Designer s Worksheet options Each of these features is described in detail elsewhere in this manual The following table indicates where each is located GRAND MASTER 100x SELECT ABFA Jorgo m memm SSeS DDD 1 2 4 5 7 Eid 3 a i 2 4 Peer Disk options System settings Print functions Clear show from memory Edit Real time programs Set Real time clock Ma
167. s EE AE E E eee nce ees 8 62 EPPA a REEE E R ELI EE 8 63 SUD P viet E AE AE EE E AAEE ESEE E O EEE ESEN 8 64 S bmaster Sheet tanisin eein e a a a N aea 8 65 viii Expression 2 0 Syete s sting Op IONS ne iE T EE E R OT ade 8 67 STP se cases E ed rar borate atta elated ora ein ect 8 68 TIME en eanne eh a aleae a ee E a E le contest ated 8 69 Troed tader Pal Sie wees de cacesette ce devia A TA A t 8 70 TAC Ks cslosasicig ates rig eta ade vale ese pth nent ghee Nea cola St eta EAE vines GEEA 8 72 TACK SNES E saian ini tae ines ean en Ghee dae 8 73 TY PG ehee pean at areal ia an needa ri ra e E 8 74 Update eien e eer a vo are Say es See 8 75 Appendix A DIP switch settings iiiioaoooioeoeeoes ees esessesssessssssssssnstntntttee A 1 Appendix B Error messages nnn B 1 Appendix C Specifications nnan Exi MOE aa a a a a l 1 Appendix D Keyboard illustration i cesecsssseseessecsssssvee D 1 chapter 1 introduction Welcome to ETC s Expression ETC is excited about Expression and hopes you are as pleased with its performance as your audiences are with yours This chapter includes information to orient you to the console and the manual It includes the following sections Expression features Using this manual Text conventions Pile on convention Getting help Customer support 1 2 Expression 2 0 Expression features Expression includes the following features 24 manual faders that control programmed submasters Two pages of sub
168. s cues two through five Indicates that you are going to enter intensity level Enters 50 percent intensity level Records tracked channel in selected cues Chapter 5 Learning advanced techniques 5 21 Lesson 4 Using Group If you have combinations of channels you use often to create looks you can save time by using Group to record them at a proportional levels Once it is recorded a group can be combined with other channels to create cues submasters or effects Unlike a cue a group cannot be played back through a fader or potentiometer Group numbers are independent of cue numbers however each group stored is included in the 400 cue memory limit Therefore the sum of cues and groups cannot exceed 400 You can use numbers from 1 to 999 Naming groups with expanded memory If you have installed the expanded memory and alphanumeric keyboard options you can assign names to groups See page 7 4 for more information 5 22 Expression 2 0 Creating groups You can create groups in Stage Blind and Fader modes To create a group follow these steps 1 Select channels You can use any of the following to select chan nels recorded submasters recorded cues Chan And and Thrul other groups Set desired intensity levels with At and keypad fader wheel or and Press Rec Press Group Enter the group number you want to save Press Enter Displaying groups on stage To view a recorded gr
169. s recorded on disk with the show in memory Expression indicates if the shows are identical or not You may want to use this option to verify that your disk is not damaged and that your show was copied to the disk without any errors You might also use it to compare backup copies of a show with the current version in memory To compare a show recorded on disk with the show in memory follow these steps T 2 Insert disk in disk drive Press Set Up Select 3 Verify show on disk and press Enter If either show one or two is currently recorded on disk the screen displays the message Recorded or the date recorded if you have the Real Time Clock option If no show is recorded on disk Expres sion displays the message Not recorded Select either show one or two and press Enter Expression compares the show you selected from disk with the show in memory If you receive a Verify failed message you may have any of the following problems show on disk is not the same as show in memory disk is damaged console did not record show to disk correctly If you receive this message repeat the read or record operation immediately If it recurs try a new disk The message Configurations differ cannot verify indicates one of the following show on disk was saved on a different type of ETC console or different software version show on disk has different system settings such as softpatch numbers of dimmers and channels than
170. s set at any level less than 10 channels included in the submaster are limited to that percentage Submasters 13 through 24 can be programmed as either pile on or inhibitive submasters All other submasters always function as pile ons Inhibitive submasters override channel levels produced by all other faders Captured channels are unaffected by inhibitive submasters Each channel can be included in only one inhibitive submaster If you assign a channel to an inhibitive submaster that is already included in another Expression removes it from the first one and adds it to the submaster that you most recently recorded To save a group of channels in an inhibitive submaster follow these steps 1 Select desired channels 2 Press Rec Sub 3 Press the bump switch of an available submaster only numbers 13 through 24 may be used for inhibitive submasters If you select a bump switch of a recorded submaster the new inhibitive submaster overwrites the old one A lit red LED on a bump switch indicates that an inhibitive submas ter is recorded Impression has two pages of submasters Follow the procedure on page 4 40 and 4 45 to record submasters to a specific submaster pages Note Leave inhibitive submasters at 10 100 percent until you want to inhibit channels Otherwise channels may be missing from your cues If you seem to be missing some channels check your inhibitive subs Expression 2 0 Link joins two or more
171. se Track instead of Rec to record channel one as on the previous page Press Track enter cue number and press Enter If you use Track rather than Rec to record the changes made to the cue illus trated in Figure 1 the results will be as illustrated in Figure 3 versus the results from using Rec illustrated in Figure 2 Cue2 Cue3 Cue4 Cue5 Channel 1 50 50 25 00 Channel 2 FF FF FF 00 Channel 3 FF FF 00 Channel 4 FF 00 Channel 5 Figure 3 The modified level is recorded in the current cue and carries through the entire track cues 1 through 3 Chapter 5 Learning advanced techniques 5 13 Inserting cues If you insert a cue in this sequence Record and Track produce different results Record saves changes only in the cue you insert Track saves the changes you make and tracks them through the following cues The following keys were pressed to release captured channels and play back cue 1 With cue 1 in a fader pair channel 4 is added at 50 percent The new look is inserted as cue 1 1 Stage Rel Rel Release captured channels Cue 1 Go Play back cue 1 Chan 4 At 5 0 Add channel 4 at 50 percent Rec 1 1 1 Enter Inserts new look as cue 1 1 Figure 4 displays the result inserting the cue using Rec Notice the new channel is not added to the cues that follow it Cue 1 Cue 1 1 Cue2 Cue3 Cue4 Cued Channel 1 50 50 50 50 25 00 Channel 2 FF FF FF 00 Channel 3 FF FF 00 Channel 4 FF
172. see which cues have tracking levels for that particular channel You can also use the Track Sheet to add or modify a tracked channel through recorded cues Track Sheet screen The Track Sheet is illustrated and described on the next page To display it press Track Sheet Step by step instructions for using the Track Sheet are on the following pages Ov MIAR 180x SHEET QE coanner 32 ANNEL 2 CUES 2 amp 24 25 27 28 31 43 46 1 a8 38 FF FF aa 20 fi 98 8 98 9 J1 3i 31 f 124 126 123 SUBR SUBER 178 1 i76 170 3 170 4 u 308 2 300 dea 4 3005 301 3 3B1 Jal 5 301 6 305 4 305 5 385 6 385 7 FF aa 306 4 356 5 J05 6 306 7 sccecr CHANNEL TO BE TRACKED If more cues are recorded than fit on one screen press Track Sheet again to display the next screen of cues Expression 2 0 Track sheet description Grand Master setting The Grand Master setting displays the master dimmer intensity level With it you can control the maximum level of all channels The Grand Master overrides all other settings Y Channel display line This line displays the current channel number and the range of cues displayed Keypad prompt window This window indicates how the console will interpret the next number you enter from the keypad For example if you press Chan the keypad prompt window displays the message Channel indicating that the console will read the next number you enter as a channel number
173. setup screen The softpatch setup screen allows you to assign dimmers to channel numbers The softpatch screen is illustrated below For complete instructions on softpatching see Chapter 3 Entering softpatch and system settings GRAND MASTER 1007 SOFTPATCH l DIANER CHN DIMMER LEVELS PROFILE 1 251 50L 751 1601 2 252 382 752 1682 253 563 753 1003 254 34 754 1664 255 585 755 1685 256 966 756 1686 Bl az a Lad I 6 a Chapter 8 Reference 8 53 Plus The plus key increases the value of a highlighted number by one The value could be a channel number a cue number a level setting or any other type of number that is highlighted on the screen The minus key decreases the value of a highlighted number by one For example when the LED on Chan is lit and you are selecting chan nels press to highlight the next channel or to highlight the preced ing channel Or once you have selected the channels you want press At to indicate that you are entering levels Then use and to adjust the level one point at a time Example Chan 1 At increases channel one s intensity level one point at a time 8 54 Expression 2 0 Potentiometers Pots Potentiometers commonly referred to as pots are sliding fader controls The AB and CD fader pairs and the Grand Master are potentiometers These pots have special functions on Expression and are described in separate
174. ssteeeeesenteeeeeeeees 7 10 Remote Focus Unit REU aieeaa eaaa lee eaaa a i decedent 7 12 VIN os tects eden Ni ais Mets hue hacen ina A Seas aiatecas A 7 14 Interfacing WIth MIDI ccscacdccciehccdeeriacieecshiuneeen a 7 15 Message formats eerie eieae r er E AREE R Eia 7 16 Message definitions naues a a e E iiaaieie aie 7 17 Padl Time ClOC e EA E EE AR 7 18 Creating or editing real time programs cecccceeseesseeeeeeeeneees 7 18 Setting Real Time ClOCK eee cceeccececceesseeeeeesseeeeesessseeeseneaes 7 20 Serial Button Protocol aae e a a A nied E R 7 21 Redundant Tracking Backup 0 ccccccccceeceeececeeceeeeceeteeeeeestteteeeees 7 22 Remote Submasters and Remote MacroS cccccccccccseseeesssteeeeeees 7 24 Chapter 8 Reference nnn 8 1 PAI ies aea aaa thane O NE E E Wits ON Nihon E is ha 8 2 AS GRRE RRP perce eer ORE cee eae er ope ar eS eae er 8 3 Autoloader enaa ethno atacieel AA E E E 8 4 EE AAE E E EA E ma teat Bw AE EAAS 8 5 Black Olt cae ea a e A AA O A 8 6 IAG PTEE E NE OE E E E AEE E E O S 8 7 BUMIDSWITCNE Srana ni a coh ee R 8 8 Capt red channels es iatea r a enaa ea Ea Aa aea anA 8 10 Table of Contents vii CNAs bese ecctea tere iai Na E cig T aie E E E ON 8 11 EEr e aie in ETEEN EAA EE EEEE E E 8 13 CleartadEr iran tanien n a a E EA tid 8 15 Clear SHOW frOM MEMOTY aa a a E A A EE 8 16 CUr e Ada OEA AO A A A RT a 8 17 Delay tIMG E E ee A E 8 20 Diagnostic SySteEM eleal niio asiera ea EEA EE iEn
175. stem Enter the MIDI channel you will use and press Enter Verify that your MIDI equipment is also set to the same channel Expression will ignore MIDI commands on other channels Expression 2 0 Message formats The following table lists MIDI message formats used to control Expression All numbers are in Hex format Note off message format lt 8n gt lt kk gt lt vv gt 8 Note off status n MIDI channel number 0 7 kk Key number 0 7F vV Note off velocity 0 7F Note on message format lt 9n gt lt kk gt lt vv gt 9 Note on status n MIDI channel number 0 7 kk Key number 0 7F vV Note on velocity 0 7F 00 Note off Control change message format lt Bn gt lt kk gt lt w gt B Control change status n MIDI channel number 0 7 kk Control number 0 79 vv Control value 0 7F Program change message format lt Cn gt lt kk gt C Program patch change status n MIDI channel number 0 7F kk Program number 0 7F Chapter 7 Accessories Message definitions Submaster bump switch execution C5 B5 C6 B6 Submasters 1 12 Submasters 13 24 Note C5 MIDI note 60 or middle C Cue execution in AB fader pair Next cue Cues 1 127 Cues 128 255 Cues 256 383 Cues 384 511 Cues 512 639 Cues 640 767 Cues 768 895 Cues 896 999 Program change 0 Program change 1 127 Controller change 70 parameters 0 127 Controller change 71 parameters 0 127 Controller chang
176. t 13 Edit macro buttons and press Enter Expression displays the following screen EDIT MACRO BUTTONS MACRO OPERATIONS SELECT MACRO NUMBER THEN PRESS ENTER Press the number of the macro you want to create then press Enter Enter keystroke sequence by pressing desired keys Use the arrow keys as described below to edit macro if necessary Chapter 5 Learning advanced techniques 5 49 Left and right arrows Moves highlight to left or right Up arrow Inserts keystroke before highlighted keystroke Down arrow Deletes highlighted keystroke Macro wait To program a pause in the macro press Macro wait Expression displays Macro wait 00 00 You can enter time either in minutes and seconds or as a fraction of a second in decimal format For example all of the following are acceptable 2 00 12 5 5 5 30 7 Press Enter Macro to save the macro 8 Press another macro number and press Enter to create or edit another macro Or press another mode key to exit macro screen Hint If you exceed the 32 command limit link another macro to the end by entering another macro number as the last command and finish entering commands in the linked macro Expression 2 0 Using submasters in macros You can enter a submaster bump switch in a macro to function in three different ways to act as a normal bump switch to fade a submaster to full regardless of its current condition or to fade a submaste
177. t of the current channels displayed 2 Press Solo All unselected channel levels are removed from the screen 3 You can now save the selected channels as a cue group or submas ter 4 Press Solo again to delete all remaining channel settings Or press Cue to restore original settings Examples Stage Chan 1 Thru 5 Solo removes all channels except 1 through 5 from the Stage Solo again restores the original look Blind Cue 3 Chan 1 Thru 5 Solo removes all channels except 1 through 5 from screen Solo again removes all channels from screen Expression 2 0 Stage mode gives you live control of all channels The Stage mode screen displays the final output level for all channels The levels dis played in Stage take into account recorded submaster levels pile on submaster settings inhibitive submasters settings cues loaded in fader pairs captured channels and grand master setting A Stage mode screen is displayed below GRAND MASTER 1007 L CHAMHEL HOT RECORDED i GAL 2 G3 64 BS BBE U7 20 821 22 23 24 B25 26 27 28 29 30 B31 32 45 846 47 46 49 58 51 52 53 54 55 B56 7 78 O71 72 73 74 O75 O76 77 7B 79 BR Bl 2 95 8596 97 96 3959 150 1 1 z G3 64 B a7 26 i121 22 23 24 125 CUE 1 XFAD B0 05700 0535 HT BA GG A FADER E FABER C FADER b FADER UET E CLEAR CLEAR 1il 2 3 4 3 6 7 UE DOHH HAIT LINK DELAY RECORDED SELECT CHANNEL HUMBERS Chapter 8 Reference 8 63 Step
178. t returning to Stage mode see the section titled Captur ing channels in softpatch ater in this chapter Or 1 024 dimmers if you have the optional second DMX512 connector 3 4 Expression 2 0 Creating custom softpatch The following sections include information about creating a custom softpatch e Using channel zero e Entering numbers of channels and dimmers e Patching dimmers to channels Hint If you use the same softpatch for several shows create the softpatch and record it on a disk before you record any cues Label the disk Standard patch When you start your next show read the Standard patch show into the console then begin writing cues to avoid reentering the patch Using channel zero Channel zero works as a holding area for unused dimmers Channels assigned to channel zero are listed at the end of channel list under These dimmers are not assigned to any channel but remain on the softpatch screen To assign dimmers to channel zero enter dimmer numbers press Chan then 0 Enter Hint You may choose to begin softpatching by assigning all dimmers to channel zero Then select dimmers or dimmer groups from channel zero and reassign them to other channels This lets you start with a clean softpatch screen You can then display all unused dimmers by selecting channel 0 Chapter 3 Entering softpatch and system settings 3 5 Entering numbers of channels and dimmers You may want to enter the number of availab
179. tch on the remote panel Pressing the panel s take control switch activates the remote panel controls and deactivates the panel previously in control When remote panels are installed the main control console and remote panels are equipped with Take Control switches The Take Control switches can be disabled with optional locking key switches You can activate a panel and lock it in the on position or deactivate it and lock it off When a remote panel is locked on pressing another remote s Take Control has no effect The main control console s take control switch always overrides remote Take Controls even if they are locked on When a remote control panel is active the console operates normally except for its submaster pots which are disabled Submaster bump buttons operate normally For remote submaster and macro panel installation instructions see Chapter 2 Installation chapter 8 reference This reference chapter lists all Expression keys features and menu options in alphabetical order Listings include a description of the feature and instructions for using it For more instructions on using Expression to create shows you may find the tutorials in Chapter 4 and Chapter 5 helpful For step by step instructions on working with cues and submasters see Chapter 4 Learning the basics For step by step instructions on tracking groups subroutines autoloads effects and macros see Chapter 5 Learning advanced techniques And
180. ted all desired channels Chapter 3 Entering softpatch and system settings 3 7 Shortcut Combine And and Thru commands to select any combi nation of dimmers For example press 1 Thru 5 And 1 0 Thru 2 0 to select one through five and 10 through 20 3 Enter the channel number to which you want to assign selected dimmers then press Enter 4 To patch remaining dimmers repeat steps two and three 5 See instructions in this chapter titled Proportional patching for instructions on inhibiting individual dimmers 3 8 Expression 2 0 Additional patching features The following patching features are described below Proportional patching Dimmer profiles Capturing channels in softpatch Unpatching individual dimmers Softpatching to Strand CD80 dimmer rack Proportional patching Expression lets you proportionally inhibit individual dimmer levels from the softpatch screen You may want to inhibit an individual dimmer to balance the wash in a channel or to limit a particular lamp Dimmers default to a full level setting unless you inhibit them To inhibit individual dimmers levels follow these steps ls 2 If Softpatch screen is not displayed press Patch Press Dim to indicate that next number entered will be a dimmer Enter desired dimmer number or select a group of dimmers by using And and Thru in conjunction with dimmer numbers Press At and enter desired intensity level for dim
181. ter In live modes Stage and Fader recorded levels appear on the screen only when they are in a fader pair or in an active submaster On a color monitor in Stage mode recorded levels are displayed in blue Recorded channels may be either moving or tracked in Blind mode see below Moving channels Moving channels are channel levels that change from one cue to the next In Blind mode on a color monitor moving channels are displayed in blue On a monochrome monitor they are not displayed differently than tracked channels Tracked channels A tracked channel is a channel whose level is unchanged from the preceding cue On a color monitor tracked channels are displayed in green in Blind mode and on Track Sheet Tracked channels are not distinguished in Stage mode 4 8 Expression 2 0 Record functions Expression has two record functions Record and Track Record saves all channels as they appear on the screen what you see is what you get in the cue group or submaster you specify When you use Record to record a cue levels are recorded in only the cue you specify Track is a record function that works only for cues It allows you to build a new cue from the previous cue s channel settings Tracked channels are channels whose levels do not change from one cue to the next A track often runs through several cues for the length of a scene or an act Track also allows you to add tracked channels through existing cues For example i
182. ter to accept the displayed setting Chapter 5 Learning advanced techniques 5 31 7 10 11 12 13 14 Enter a delay or fade time between 00 00 and 99 59 This is the length of time before the effect moves to the next step You can enter time either in minutes and seconds or as fraction of a second in decimal format For example all of the following are acceptable 2 00 12 5 5 5 30 Press Enter Press Step Part and enter next step number Then press Enter Repeat steps four through eight to create remaining steps Press Time to specify a duration time for the effect Enter a duration time of between 00 00 and 99 59 This is the length of time the effect runs after pressing Go You can enter time either in minutes and seconds or as a fraction of a second in decimal format For example all of the following are acceptable 2 00 72 5 5 and 5 30 Entering zero assigns an infinite duration time Effect will run until it is cleared from the fader Press Style and enter one of the following codes to select a playback style Playback styles are described on page 5 29 1 Loop 2 Bounce 3 Random 4 Ripple For each style some or all of the following modifiers are available Modifiers are listed at the top center of the screen Use the left and right blue arrow keys to move the asterisk next to the modifier you want then press Enter to select the modifier If you do not select any modifiers
183. ter a range Note If you are entering a range of channels in Flexichannel mode you must press Thru Thru to indicate a range 1 5 Full Rec Enter Marks end of range Channels 1 through 15 are selected Enters full intensity level for selected channels Indicates you want to record the cue Records cue Chapter 4 Learning the basics 4 15 Cue 3 Modifying up and down fade times You may also want to modify cue up and down fade times When you create a cue Expression assumes you want to use the default fade times However you can easily change fade times using Time See page 3 15 for instructions on changing default fade times is 2 Press Blind if the Blind mode screen is not already displayed Add channels using numeric keypad and And or Thru then enter intensity levels Press Rec to indicate that you want to record the cue Enter cue number and press Enter Press Time Enter upfade time between 1 and 99 59 You can enter time either in minutes and seconds or a fraction of a second in decimal format For example all of the following are acceptable 2 00 12 5 5 5 30 Press Enter Enter downfade time if different from upfade time Enter a time between 1 and 99 59 If you do not enter a time Expression assumes you want the same downfade time as upfade time Press Enter Enter wait time Wait time is the length of time after beginning the upfade before the do
184. then enter the number of the group you want to copy Or if you are working in Stage mode press Group enter the number of the group you want to dcopy then press Go 3 In either Stage or Blind once the group is displayed press Rec Group the number of the new group and Enter The new group will be recorded the original group will not be affected Copying group keystrokes Key Action Blind or Stage Selects operating mode Group 1 or Displays selected group Group 1 Go Rec Group 2 Copies Group 1 as Group 2 Chapter 5 Learning advanced techniques 5 27 Using groups to modify cues or submasters in Blind When you modify a cue or a submaster using a group in Blind follow these steps 1 2 Press Blind Exoression prompts you for a cue number Enter cue number or press Sub and enter a submaster number to display the cue or submaster you want to modify Press Group to indicate that the next number entered will be a group Enter group number Press Full to set group channels to their full recorded levels or press At and enter a level to set them at a percentage of the group s look Or press Enter to impose only the group s proportions on the currently set levels The fader wheel adjusts levels in group s proportions Press Rec Enter to record the modified cue or submaster 5 28 Expression 2 0 Using Group Sheet to display groups Group Sheet is an expanded m
185. ting a multipart cue Follow these steps to create a multipart cue 1 Press Stage Expression displays the Stage mode screen and prompts you to enter a channel number Enter channel number s for the first part with numeric keypad Set intensity levels by pressing At and entering a two digit level moving the fader wheel or pressing and Press Rec then enter the number of the cue you wish to record with the numeric keypad Press Step Part then enter the number of the part you wish to create with the numeric keypad Parts can be assigned numbers one through eight and can be created in any sequence you like Press Enter Press Time if you want to assign upfade downfade and or wait times to the part Note If you do not assign times to a part Expression will automati cally assign five second upfade and downfade times to it No wait time will be recorded Enter an upfade time between 1 second and 99 59 minutes and press Enter You can enter time either in minutes and seconds or as a fraction of a second in decimal format For example all of the following are acceptable 2 00 12 5 5 5 30 Enter a downfade time if different from the upfade time you se lected If you do not enter a time Expression assumes you want the same time Chapter 5 Learning advanced techniques 5 5 10 Enter upfade wait time Upfade wait time is the length of time after the multipart cue starts before the upfade If y
186. tions 6 17 Recording a show on disk We recommend that you keep at least one backup copy of each show ona disk Keep disks in a dry safe place When using the record option any fades being executed are interrupted during the record operation fades resumes when record is complete To record a show from memory to a disk follow these steps 1 Insert a formatted disk in disk drive 2 Press Set Up 3 Select 1 Record show on disk and press Enter Expression displays the screen illustrated below 10 RECORD ONTO DISK SELECT SHOH NUMBER THEN PRESS ENTER T ABORT PRESS CLEAR SHOH 1 RECORDED SHOW Z RECORDED CUSE DOUBLE SIDED DOUBLE DENSITY DISH ONLY If either show is currently recorded on disk the screen displays the message Recorded or the date recorded if you have the Real Time Clock option If no show is recorded on disk Expression displays the message Not recorded 4 Select either show one or two and press Enter If the show num ber you select is already recorded the new show will overwrite the old show Or press Clear to cancel the operation Note We recommend that you verify the show immediately after recording it to ensure that is was recorded with errors See page 6 19 for instructions 6 18 Expression 2 0 Reading a show from disk When you read a show from a disk and load it into memory the new show overwrites the current show in the board Therefore if you want to keep the
187. to record a current look To record a pile on submaster using a bump switch follow these steps 1 In either Stage or Blind mode create a look on the screen 2 Press Rec to indicate that you want to save the look 3 Press the bump switch of the submaster in which you want to record the look A lit LED indicates that the submaster is success fully recorded To record an inhibitive submaster follow these steps 1 In either Stage or Blind mode select channels you want to include in the submaster 2 Press Rec Sub to indicate that you want to record an inhibitive submaster 3 Press the submaster bump switch where you want to record the inhibitive submaster 8 10 Expression 2 0 Captured channels Captured channels are channels that you have selected and that are live on stage They remain live until you press Rel to release them Cap tured channels override all other channel settings except the Grand Master For example if a channel is in a fader at 100 percent and you capture it and set it to 50 percent Expression reads the 50 percent setting You can capture channels while in either Stage or Fader mode but not Blind or Track Sheet modes since they are not live Expression displays captured channels in either red or yellow on a color monitor Red chan nels are captured yellow channels are captured and selected Selected channels are channels that you have immediate keyboard control over You can modify sel
188. trols upfades The right fader in each pair B and D controls downfades You can playback cues one at a time through a single fader pair or you can playback a different cue in each fader pair at the same time You can also play a cue in one pair leave it there and then play another cue in the second fader pair This is one way to put two looks on stage at the same time For example you may want to play a 10 minute sunset cyc cue in one fader pair while you play several cues during the same period downstage in the other fader pair This lesson includes the following sections Selecting cues Timed fader pair and LED displays Playing back cues Go to a different cue Controlling fades manually Back key 4 26 Expression 2 0 Selecting cues There are three ways a cue can be selected to playback on stage 1 when a cue is playing Expression automatically selects the next cue 2 you select a cue manually or 3 Expression automatically selects linked cues You must be in Stage mode to select cues to playback When one cue is playing Expression assumes that you want the next consecutive cue to play next To play the next cue press either Go key If you are working in Stage mode you see the cue running on the monitor You can also run cues from Blind by pressing Go To select a cue out of sequence press Cue and enter the cue number Then press either Go to start playing the cue Linked cues begin playing automatic
189. tructions for installing Expression monitor and optional accessories Instructions for entering system settings that you are likely to change before using Expression for the first time or before beginning a new show Tutorial on working with cues and submasters includes an overview of display channel and control modes Tutorial on working with more advanced Expression features including multipart cues track record function Track Sheet groups autoloads effects subroutines and macros Instructions on using printer and disk options Instructions on using Expression s optional accessories Description of console keys and menu options listed in alphabetical order List of Expression DIP switch settings 1 4 Appendix B Error messages Appendix C Specifications Appendix D Keyboard illustration Expression 2 0 List of Expression error messages and an explanation of each Technical specifications for Expression console Pull out illustration of Expression keyboard Chapter 1 Introduction 1 5 Text conventions Pile on In this manual console keys are indicated by square brackets such as Enter System messages are printed in boldface such as Select channel References to other sections of the manual are printed in italic such as Chapter 1 Introduction convention Expression uses a pile on convention rather than last action convention to determine levels for channels that are acted on by s
190. ue only 4 8 8 56 Cue sheet 4 5 6 4 Cue submaster description line 4 5 Cues 4 9 6 3 blackout 5 15 converting regular to multipart 5 3 deleting 4 22 8 13 displaying in Blind 8 17 displaying in Stage 8 18 goto 4 28 inserting 4 21 5 13 modifying 5 11 modifying on stage 4 32 2 Cues continued multipart 5 3 creating 5 3 definition 5 3 wait times 5 3 naming 7 3 8 19 numbering 8 19 playing back 4 25 4 27 selecting 4 26 viewing 4 23 D Delay time 4 17 8 20 Deleting cues 4 22 8 13 groups 5 25 submasters 4 47 Designer s Worksheet 6 5 7 5 7 6 installation 2 13 programming regions 7 7 Diagnostic system clear 8 21 Digitizer 7 5 Dim 8 22 Dimmer profiles 3 9 8 23 default 3 10 graphs 8 24 Dimmers AMX 192 2 9 analog multiplex 2 9 analog wire per dimmer input 2 9 analog wire per dimmer output 2 8 CD80 2 9 customizing 3 5 D192 2 8 DMX512 2 8 ETC LMI 2 8 installing 2 8 unpatching 3 11 Disable bump switches 3 15 Disk management 6 15 Disk options erase show from disk 6 20 formatting disk 4 50 6 16 reading a show from disk 6 18 recording a show to disk 4 51 6 17 verifying a recorded show 4 52 6 19 Display modes 4 2 Expression 2 0 Displaying groups 5 28 submasters 4 48 E Effects 5 2 5 29 8 74 bounce 5 29 8 26 inserting steps 5 34 keys 8 26 loop 5 29 8 26 modifiers 5 31 playing back 8 71 random 5 29 8 26 ripple 5 29 8 26 styles 5 29 Enable bump switches 3 15 Enter 8 27 E
191. ue or channel number 3 Press Thru If you are using Flexichannel press Thru twice 4 Enter another cue or channel number Expression selects the entire range Example Chan 1 Thru 5 And 1 0 selects channels 1 through 5 and 10 Chapter 8 Reference 8 69 Time Time lets you modify the upfade downfade and wait times for indi vidual cues and submasters To modify fade and wait times follow these steps 1 Press Cue or Sub and enter the cue or submaster number you want to modify 2 Press Time 3 Enter upfade time in seconds and minutes or as a fraction of a second in decimal format Cue fade times can range between 00 00 and 99 59 minutes Submaster fade times are limited to a maximum of two minutes Then press Enter 4 Enter downfade time for a cue or a wait time for a submaster Then press Enter You can enter time in minutes and seconds or as a fraction of a second in decimal format 5 Enter wait time for a cue or a downfade time for a submaster You can enter time either in minutes and seconds or as a fraction of a second in decimal format Cue wait time is length of time between the beginning of upfade and the beginning of the downfade Submaster wait time is the length of time between the end of the upfade and the beginning of the downfade You can set an infinite wait time for submasters for more informa tion see page 8 44 Example Cue 1 Time 5 Enter Enter 1 0 ent
192. ures to turn on a work light or to focus a single dimmer from the channel You must be in Stage mode to unpatch a dimmer To unpatch a dimmer follow these steps 1 Determine which dimmer you want to unpatch You may want to display the softpatch screen to display the current dimmer to channel patching To display the softpatch screen press Patch 2 Press Stage 3 Press Dim 4 Enter the dimmer number you want to unpatch Unpatching does not affect the level that other dimmers in the channel are set at If you want all other dimmers in the channel off set the channel at zero 5 To set the unpatched dimmer at full intensity press Enter Or to set the unpatched dimmer at less than full press At and enter a two digit level then press Enter 6 Press Dim Clear to restore dimmer to patch You can perform most other console tasks with dimmer unpatched then restore the patch at any time Entering the softpatch screen also restores patch Note When you unpatch a dimmer and set it to full intensity the output is 100 percent of the potential output not 100 percent of the level at which it is softpatched Hint To perform a dimmer check from Stage press Dim 1 Enter Then use and to step through remaining dimmers for dimmer check 3 12 Expression 2 0 Softpatching to a Strand CD80 dimmer rack Strand CD80 dimmer racks have 48 dimmer slots Each dimmer slot holds either two 2 4 kw dimmers or one
193. vel settings in all recorded cues This display is useful when you need to add or modify a single channel in several cues Track is a blind mode it does not give you live control of channels Track Sheet mode is included in Chapter 5 Learn ing advanced techniques You can modify existing cues but you cannot create cues in Track Sheet Flexichannel Flexichannel is a feature of Expression s expanded memory option It is available only when expanded memory is installed When the Flexichannel mode is enabled Expression s monitor displays only selected channels and channels that are part of a recorded cue submaster group or effect other channels do not appear on the display screen This simplifies console operation by eliminating unused channels from the display screen Once you have selected a channel the only way to remove it from the display is to repeat the procedure for enabling Flexichannel See Chapter 8 Reference page 8 35 for information on enabling and using Flexichannel 4 4 Expression 2 0 Stage Blind and Fader screens Stage Blind and Fader screens look very similar The Stage mode screen is illustrated below to familiarize you with the screen format SPND MASTER 100 amp cannel a HOT RECORDED B5 G6 87 26 21 22 23 24 B25 30 B31 32 45 646 47 49 658 55 B56 57 76 071 72 74 875 Be BBL 2 96 97 29 158 B3 106 7 121 22 24 125 CHE i XFAD B0 6500 63 HT BU GG E FADER C FADER D FADER CUE TYPE UP DO
194. vels to their full recorded levels At to set them at a percentage of the recorded levels or the fader wheel to have incremental control of levels Press Rec Group Enter the group number you are modifying Press Enter Modifying groups using Update Update allows you to modify a group in Stage mode by adding to or modifying only those live channels you specifically select Unselected live channels will not be included in the group The levels of channels already included in the group but not selected are not affected Follow these steps to use Update to modify a group 1 2 Create a look on stage Select the channels you want to record or modify then set channel levels Press Update Group the desired group number and Enter Chapter 5 Learning advanced techniques 5 25 Deleting groups To delete a group in Blind follow these steps 1 Press Blind 2 Press Group to indicate that you are entering a group 3 Enter the group number you want to delete 4 Press Enter 5 Press Clear Rec to delete the group 5 26 Expression 2 0 Copying groups Once you have created a group you may copy it and give it a name This can be helpful if you want to create a group based on one you have already recorded You can copy groups in Stage or Blind modes Follow these steps to copy a group 1 Press Blind or Stage You can copy a group in either mode 2 If you are working in Blind mode press Group
195. ves the message and allows you to use the master console in normal single console operation 5 If itis necessary to use the backup console you must disconnect the dimmer cables from the master console and insert them in the identical cable connectors in the backup console You must also connect monitor cables to the slave console if you do not have monitors connected to both consoles You may want to use A B switch boxes for the dimmer and monitor cables to facilitate switch over If a disk drive error occurs on either console the master displays an error message To resynchronize the two consoles after an error message press Clear on the master Print options work only on the master console Note You can force the backup console to take over by turning the master console s power off 7 24 Expression 2 0 Remote Submasters and Remote Macros Remote submasters and macros are small portable control consoles that control submasters and macros from locations up to 1000 feet from your main control console You can have up to four remote control stations each one consisting of a remote submaster panel or a remote macro panel or one of each The remote submaster panel contains twelve submaster potentiometers that control the console s first 12 submasters The remote macro control panel contains twelve macro control buttons that allow you to control the first 12 recorded macros To activate a remote panel press the Take Control swi
196. want to enter a range of channels Note If you are entering a range of channels in Flexichannel mode you must press Thru Thru to indicate a range 7 5 Full Rec 4 Enter Link 5 Enter 1 0 Enter Marks end of range of channels at 75 Sets captured channels at full intensity Indicates you want to record the cue Enters cue number Records cue Indicates that you are going to link another cue to cue 4 Selects cue 5 to link cue 4 Note that in this example we have not created the link to cue yet Enters cue link information Sets delay time to 10 seconds Enters delay time Chapter 4 Learning the basics 4 19 Cue 5 Creating a cue using Solo Often you will create cues by adding to subtracting from and modifying previously recorded cues Solo lets you select a subset of displayed channels and delete all others alt Press Chan to indicate that the next number entered will be a channel number Enter channel number to mark the beginning of the subset to select Press And or Thru to indicate you are selecting a range of chan nels Enter another channel number with numeric keypad to mark the end of the range Press Solo Expression deletes all unselected channels Move the fader wheel press At and or use At and numeric keypad to set desired level Press Rec to indicate that you want to record the cue Enter cue number with numeric keypad Press
197. wnfade starts If you do not enter a wait time Expression assumes you want a wait time of zero Note If you modify fade times after you record the cue you do not have to rerecord the cue Fade and wait times are automatically added to cue information Press Enter Expression 2 0 Cue 3 keystrokes If you did not press Rel after you saved the last cue channels 1 through 15 should still be selected on the Blind mode screen Key Action Chan Indicates next number entered will be a channel 2 6 Marks beginning of range Thru Indicates that you are entering a range Note If you are entering a range of channels in Flexichannel mode you must press Thru Thru to indicate a range 5 0 Marks end of range Full Enters full intensity for selected channels Rec Indicates you want to record cue 3 Enters cue number Enter Records cue Time Indicates that you want to change fade times 1 0 Enters ten second upfade time Enter Enters upfade time and prompts you for downfade time Enter Enters same fade time as for upfade 5 Enters half second wait time Enter Records time settings Chapter 4 Learning the basics 4 17 Cue 4 Linking cues Expression lets you link cues to create a sequence that runs automati cally You can link a string of cues or you can create a loop to produce a chase You can also link cues to macros For more information on linking cues to macros see page 8 46
198. wtodisk rerecordit fyougetthesameerror messageafterthesecondrecording recordshowonanewdisk Write protected Consolecannotrecordtodisksthatarewriteprotected Insertanother diskorclosewrite protectionwindowoncurrentdisk andretry operation GODENAIX c Specifications Internal interfaces Inputoptions e Upto1920 10VDCanaloginputsforreadbackfrommanual consoles e 028VDCalsoavailable Analogoutoutoptions e Upto1920 10VDCdimmeroutputs e 028VDCalsoavailable Digitaloutout e Upto512DMX51 2digitalorotocoloutouts 1 024 0ptional e ColortranD192output e LMldigitalprotocol e KlleglK96cigitalprotocol requiresoptionaldimmerinterface unit AMX192outputoptions e Upto384AMXx192dimmeroutputs Parallelprinterinterface RS 232Cseralport RemoteFocusUnitinterface MDlinterface InfraredRemoteFocusUnitinterface RemoteSubmasterpanelandiViacropanelinterfaces RemoteGOoption Opticallyisolatedswitchinputsforremotecontroloflast8macros Expression 2 0 Cue capacity 400cuespershow 2showsperdisk 250controlchannels Proportionalsoftpatchingofupto1 024DMX512dimmers Multipartcues 10selectabledimmerprofiles Display functions OneRGBvideooutput OnemonochromeRS 1 70CRT videooutput Displaymodes e Alexichannel withexpandedmemoryoption Stage Bind Fader Submaster TrackSheet Softpatch SetUp Helo Submastersheet Groupsheet Playback controls Autofaderpairs 2 0n100mmpotentiometers e 1secondto99 59p
199. y one fader pair you need only press Back to replay the previous cue If you have cues loaded into both fader pairs you must press Back then the Go button below the desired fader pair If you play cues one two and three in the AB fader pair and cues six seven and eight in the CD fader pair pressing Back then the AB Go plays back cue two pressing Back then the CD Go plays back cue seven Cues are played back using the fade and wait times recorded with the cue When using both fader pairs if you press Back then decide not to use the function press Back again to exit Back mode Note Each time you press Back Expression resets the cue sheet The cue replayed with Back becomes the first cue in the cue sheet If you then press Go without first pressing Back the next numerical cue will play Example Cue 1 Go plays cue one Go plays cue two Go plays cue three Cue 2 2 Go plays cue twenty two Cue 1 6 Go plays cue sixteen Back Go plays cue twenty two Back Go plays cue twenty one Back Go plays cue twenty 8 6 Expression 2 0 Black out Black out forces all channels to a zero intensity level All dimmers immediately black out Expression displays the message Black out in flashing letters when Black out is active To restore channel settings press Black out again All stage fixtures remain off until you release the black out However you retain control of th
200. you need the current cue to reach its full level settings push the slides down to the lit LEDs and then back up to 10 immediately Then press Go to Start the next cue Expression 2 0 Level override Level override is Expression s default operating mode In level override you can use the faders to take manual control of fade levels When you take manual control the movement of the faders controls the comple tion of the fade When you move the faders to a point lower than 10 in level override mode the cue runs until it reaches the fader level setting You can set the level before you start the cue running or move the faders once the fade starts The fade stops when it reaches the level at which the faders are set and you then have manual control of fade rates For example if you set faders at 8 the cue will play back to 80 percent of its recorded levels Proportional rate override If you prefer you can select proportional rate override from the System Settings Menu In proportional rate override the position of the faders determines the rate at which a fade progresses The left fader controls the upfade rate the right fader controls downfade rate The fader setting determines the percentage of the recorded rate at which the cue plays back To take manual control of the fade rate move the faders to a point below 5 then move the faders to the desired position The percentage is determined by the level at which the faders a
201. ys back at that adjusted rate Chapter 5 Learning advanced techniques Effects keystrokes Key Blind Type 3 Chan 1 Thru 1 0 Enter 7 5 Enter 2 5 Enter 1 Step Part 2 Enter 2 Enter Enter Enter 1 Enter Time 1 4 5 Enter Rec 6 Enter Action Displays Blind mode screen Displays Cue Type Menu Selects effects cue type Indicates next number entered will be a channel number Selects channels one through 10 Assigns channel one to step one Enters 75 as high level Enters 25 as low level Enters delay time of a tenth of a second Indicates next number entered will be a step number Selects step two Enters channel two Accepts current high level Accepts current low level Enters delay time of a tenth of a second Indicates next number entered will be effect duration time Enters duration time of one minute 45 seconds Records effect as cue 6 Expression 2 0 Inserting and deleting steps To insert a step select the step after which you want a new step inserted and press Step Part To delete a step select it and press Clear Editing steps To edit effects steps follow these steps 1 2 Press Step Part and enter the step number you want to edit Use the arrow keys to highlight the field in the step you want to edit Enter the new time or number in the field To add a channel to a step enter the chann
Download Pdf Manuals
Related Search
Related Contents
File Nokia 6230i UG PX4FMU – Flight Management Unit Lien PDF - Conseils de la jeunesse Table des Matières - Editions Ellipses Taurus Group Juicer TCC3 User's Manual Manual - DFI Inc. 通知 - 福島県薬事工業協会 Copyright © All rights reserved.
Failed to retrieve file