Home

Operating Manual

1. Fig 05 Installation location of the radio controller Fig 06 Installation location of the display 6 3 Installation DAMAGE TO ESSENTIAL VEHICLE COMPONENTS Essential vehicle components or wiring can be damaged when drilling mounting holes or screwing in self threading screws Please make sure there is always sufficient space behind the screw holes and drilled holes 5 138 in 6 3 1 Mounting the electronics box Installation consoles for a number of car models are available from your dealer These are designed to contain all eee the system components including the Fig 07 electronics box When it is not possible Assembly dimensions to use an installation console please gt BOX proceed as follows ce Define the mounting points Making sure that there is at least 2 8 In space for the plug and socket connectors Mark the positions for the fixing screws Mounting the electronics box For mounting the electronics box use four self threading screws and appropriate washers We recommend size ST 2 9x25 DIN 7981 self threading screws These are ideal for the fixing of the electronics box Pre drill the holes with a 0 08 in drill 6 3 2 Mounting the microphone Define the mounting location The microphone holder has a self adhesive strip on the back The mounting
2. window next to the driver s sun visor on the dashboard Unsuitable for the microphone Close to the speakers less than 31 in under the dashboard in the air stream from open windows or air vents Fig 03 Installation location of the electronics box Fig 04 Installation location of the microphone The illustration shows one of the potential microphone mounting locations Alternatively the microphone may be attached to the sun visor with the clip provided 10 11 EGO LOOK 6 2 amp Selection of site for installing the radio controller The following locations are suitable for the radio controller In the area above the DIN installation slot in the vicinity of the steering wheel at a location within the driver s reach The following locations are unsuitable for the radio controller Airbag deployment area possible head impact area beyond the reach of the driver 6 2 5 Selection of site for installing the display The following locations are suitable for the display In the space above the DIN installation shaft close to the steering wheel in an easily accessible and visible position Note the position of sunlight to avoid reflection on the display The following locations are unsuitable for the display Airbag inflation space potential head impact zones out of reach of driver s reach
3. 1 this device may not cause harmful interference and 2 this device must accept any interference received including interference that may cause undesired operation NOTICE Changes or modifications made to this equipment not expressly approved by manufacturer name may void the FCC authorization to operate this equipment NOTICE This Class A digital apparatus complies with Canadian ICES 003 14 Hotline Any questions comments or suggestions Would you like some more detailed information Do you need an adviser or service in your area Just give us a call Our service hotline is there to help you during the following times Monday Friday from 8 00 a m to 5 00 p m PST Before you call us with your problem please check first with the following steps gt Check whether you can solve your problem with the Troubleshooting checklist in Chapter 9 gt Make sure you have your hands free system and holder set type available gt Try to explain your problem as precisely as possible You can contact our service hotline by dialing Phone 1 858 566 2170 Fax 1 858 566 2179 eMail support degohandsfree com 60 61 RAYTEL Corporation A partner of Funkwerk Dabendorf GmbH 8820 Kenamar Drive Ste 50 San Diego CA 92121 Telephone 1 858 566 2159 funkwerk Fax 1 858 566 2179 dabendorf eMail support degohandsfree com Internet www egohandsfree com A Funkwerk AG company Funkwerk Dabendorf rese
4. Ends the dialogue without carrying out a function gt Help Calls up Help and an explanation of possible commands Read notes recording With this command it is possible to listen to the recorded memos Only one memo is played With the correct command you can listen to the next note The following commands are available gt Next Continue To play the next note Repeat To replay the note gt Delete To delete the note gt No Back To return to the main menu gt Abort Cancel Ends the dialogue without carrying out a function gt Help Calls up Help and an explanation of possible commands 50 51 EGO LOOK As with Cancel this command may be used at any time If the Help command is selected the EGO LOOK explains which commands are possible for specific functions at the time they are called up I Redial call again This command you provides you with the simplest way to redial the most recently dialed phone number No further dialogue follows Dialing is only possible when the mobile phone is logged in An announcement will then inform you when dialing begins Abort Cancel With his command the current dialogue is ended immediately without any function being carried out 8 Software update The software for your EGO LOOK can be updated to the latest version via Bluetooth In order to receive the most current software pleas
5. English 1 Table of contents EGO LOOK 1 TABLE OF CONTENTS lll AY YN 2 LIST OF ILLUSTRATIONS lll aaa 3 INTRODUCTION FOREWORD oii 4 SAFETY NOTES iii 5 SCOPE OF DELIVERY PACKAGE CONTENTS 6 INSTALLATION INSTRUCTIONS _e l ll l J aa 6 1 Required configuration a 6 1 1 Vehicle 6 1 2 Mobile phone 6 1 3 Muting radio mute switch 6 1 4 Converting the EGO LOOK into a previously installed Funkwerk hands free car kit 6 1 5 Add on speakers Car audio telephone connection 6 1 6 Car radio line in 6 2 instalation OCCU Sate ea eterna tea ea omni 6 2 1 Checking cable lengths 6 2 2 Selection of site for installing the electronics box 6 2 3 Selection of site for installing the microphone 6 2 4 Selection of site for installing the radio controller 6 2 5 Selection of site for installing the display 6 3 Installation UU rra 6 3 1 Mounting the electronics box 6 3 2 Mounting the microphone 6 3 3 Inserting the battery in the radio controller 6 3 4 Mounting the radio controller 6 3 5 Mounting the display 6 4 Connection scheme 6 9 6 9 1 6 5 2 6 5 3 6 6 7 1 7 1 1 T2 7 3 7 4 7 4 1 7 4 2 7 4 3 7 4 4 7 4 9 7 9 7 6 7 6 1 7 6 2 7 6 3 7 6 4 7 6 9 7 6 6 7 7 7 7 1 7 7 2 7 7 3 Installing the ISO connection cable ttn Checking the mute inputs Checking the installation Additional external speakers Connecting the components to the electronics box OPERATING INSTRUCTIONS
6. The controller controls the EGO LOOK using the rotary knob In addition the rotary knob is used for confirmation The C button is used to go one step back or to exit the menu The Speller allows you to compose telephone numbers from individual digits or names from individual letters It is available for various functions of the EGO LOOK for example for dialing a telephone number or for creating a contact list entry Operating the Speller is explained in the following gt Entering numbers By rotating the rotary knob navigate to a digit and accept this digit by pressing the rotary knob You can delete the last digit of the number by selecting the symbol Once the number has been completely entered you can confirm it by selecting the symbol To cancel the process at any time press the Him button gt Entering names or text Similar to the method used for entering numbers you can enter names or even entire texts using the Speller Navigate to a character by rotating the rotary knob and accept it by pressing the rotary knob You can delete the last character by selecting the symbol Once the name has been completely entered you can save it by selecting the symbol To cancel the process at any time press the Him button You can switch between upper case letters lower case letters numbers and special characters using the symbols described in Chapter 7 2 3 You select these symbols using the rotary knob 7 6 Getting started Take enough time to
7. 6 5 1 Checking the mute input Fig 08 Connection for the mini ISO connection cable 6 5 Installing the ISO connection cable The battery must be disconnected before starting cable installation Disconnect the grounding cable from the negative pole of the battery The cable installation procedure is shown in the illustrations Disconnect car wiring Connect 14 pin ISO Connect EGO LOOK ISO harness from car radio connecting cable to connector to car radio EGO LOOK Car audio gt lt O Q D O z L 2 F z z LLI Fig 09 Installation procedure Connect EGO LOOK ISO connectors to car Connect yellow mute lead to wiring harness ISO connectors one of the three mute inputs see table When the installation is completed reconnect the grounding cable to the negative pole of the battery 6 5 1 Checking the mute inputs The mute inputs 1 3 can be seen in Fig 5 of Illustration 09 The yellow mute cable of the hands free equipment is connected to one of these inputs The table below shows which mute input is to be used 16 17 ee O Socket contact housing m Wiring of power supply connectors PEE Radio model Pin Wire colour Function g P PPly Gia 2 C to device type 3 Audi Socket wiring from Plug wiring from i i nate Permanent positive 30 8 brown Ground Socket contact housing Radio model
8. Call functions such as incoming outgoing calls call waiting alternate between calls conference calling and redial Integrated voice control Intuitive voice dialing directly from your mobile phone s contacts list without training Allows users to read and reply to SMS messages Voicemail Dictation function Contacts list and call lists Music player replay of music files on mobile phones iPodsIM or MP3 players via Bluetooth Audio Streaming A2DP Automatic radio muting Can be buddied with up to 10 mobile phones VV V H H V V Vv V EGO LOOK 7 2 Controls The EGO LOOK controller has three buttons Rotary knob J The picture to the right gives a brief overview of the device s buttons This section explains the functions of the Individual buttons Red button Green button Button functions You use the rotary knob to navigate through the menus and to select the active menu Another function is the Voice control which is activated by holding down the rotary knob Numbers and letters can be selected using the rotary knob in the Speller You will find more information on the Speller and Voice control in the corresponding chapters Brief description Menu navigation starting Voice control entering numbers and letters selecting the active menu stopping the screen saver The green button is used for accepting an Incoming call Additional functions of the green button In the mai
9. If the name is recognized you will be asked if the name should really be dialed The following commands are available to you gt Yes Call Dial Dials the number stored under that name gt No Back The number for the recognized name is not dialed gt Abort Cancel Ends the dialogue without carrying out a function gt Help Calls up Help and an explanation of possible commands Dial number You will be prompted to enter the number to be dialed This may be done with individual numerals as well as groups of numbers If you insert a pause the last number group of numbers entered is repeated for checking In addition you will be notified if you exceed the maximum telephone number length In addition to continuing with the entry of numerals the following additional commands are available gt 0 1 9 For entering the number gt Delete all To delete the entire phone number entered Delete Correct Change To delete the last number group of numbers entered gt Repeat To announce the entire phone number entered up to this point gt Yes Call Dial To dial the phone number entered gt No Back To not dial the number entered gt Abort Cancel Ends the dialogue without carrying out a function gt Help Calls up Help and an explanation of possible commands Show dialed numbers This requires that numbers names are included in the call li
10. _ FealUreS miu Overview of features CI OLS 5 L u L Getting started with the EGO LOOK controller n Symbols _ UU ee Symbols in the status bar Speller symbols Symbols for menu options Contact list number types Music player symbols buttons Speller ene enn ere Getting Started iin About Bluetooth technology Activating the controller On Off function Entering the Bluetooth PIN Hands free mode Automatic coupling The menus User management Calling Contacts list 17 19 19 20 22 22 22 23 24 25 25 26 27 2l 27 28 28 29 29 29 30 30 30 31 34 35 38 EGO LOOK 7 7 4 7 7 9 7 7 6 7 7 7 7 7 8 7 7 9 7 8 10 11 12 13 14 Call history 40 Voicemail 40 SMS 40 Music player 41 Dictation function 42 Settings 43 VOICeCOH rO UU IIIa 46 SOFTWARE UPDATE l Ua 53 SERVICE ele 54 ACCESSORIES AND SPARE PARTS _ UU 56 TECHNICAL SPECIFICATIONS lll 58 CERTIFICATION 2 ii 58 CONFORMITY STATEMENT a 59 HOTLINE i iujijliuiiuiilifjuiniuu4nuiunuiiuuuu 61 List of illustrations Fig 01 Scope of delivery aaa 8 Fig 02 Signal direction of the Bluetooth antenna omni 10 Fig 03 I slallalion location ol the electronics DOK uuu u acne ee sinner EREE 11 Fig 04 Installation location of the microphone nnn 11 Fig 05 Installation location of the radio controller iii 12 Fig 06 Installation location of the display oii 12 Fig 07 Assembly dimensions of the electron
11. been speaking with can then no longer hear you Pressing again deactivates the muting of the microphone Private mode You can also switch into Private mode during a telephone call by selecting the Private mode item and confirming with the rotary knob The call now only uses the mobile telephone Communication by way of the EGO LOOK is not possible at this moment and anyone else in the vehicle cannot listen to the conversation Pressing the rotary knob again ends Private mode Important note In most countries phoning while driving is only allowed when using a hands free system Record If the need to record an important call arises this can be achieved with the Record function The person you are LOOKing to is then informed that the conversation is being recorded The recording can then be retrieved from the Voicemail folder 36 37 EGO LOOK Call waiting If the call waiting feature In your mobile phone and the EGO LOOK is switched on while you are LOOKing to another person incoming calls from third parties are signaled The name or number of the third calling party is displayed if possible You can accept the call with the EER key or reject it with the Him key If you accept the call of the third party the active caller is automatically put on hold If you reject the third calling party the conversation with the active caller Is continued Call switching You can switch between two callers by pressi
12. if the microphone is located too far from or too close to the driver The EGO LOOK has 10 possible sensitivity settings available The sensitivities are shown to the right of the display as bars There are a total of five bars where one bar indicates two steps The sensitivity can be adjusted using the rotary knob Do not set the microphone to be too sensitive because this may result in over modulation and poor audio quality for the other party gt Line in In this menu item you may activate the line in and vary the input volume of the audio device connected to the line in of the electronics box Note Please note that only the connection of an audio device with line level is allowed If the electronics box s line in is overamplified through an excessively high signal from the line out of the audio device the volume must be reduced on the audio device Volume The base volume of the line out as well as the ringtone and call playback through the speaker output of the electronics box can be adjusted within this menu item in 5 steps Line out The channel for call playback can be set under this menu item The items right left and right left are available Voicemail Voicemail functions can be switched on and off here The user still has the option to record and listen to messages and to playback recordings For more information see the Voicemail chapter 44 45 EGO LOOK Power down The current Bluetoot
13. the PIN is incorrect the menu jumps back to device selection and you must repeat the process If an iPod or MP3 player with an A2DP adapter is used these devices couple automatically with the EGO LOOK For this the Couple from device menu item must be selected during the search for devices After coupling all playback functions are available to the user Playback The following functions are available for playback and are shown in the display Play Pause Stop Forwards by title Reverse by title Volume setting playback volume adjustable in 10 steps j V V V V V Return to the symbols using the rotary knob For a description of these keys please see the Symbols chapter 40 41 EGO LOOK 7 7 8 Dictation function Symbol EX Se Recording The Dictation function allows you to make your own voice recordings This function is particularly useful when you do not have pencil and paper at hand while driving the car You now have the potential of storing important information as a voice recording To do this select the New recording item and confirm using the rotary knob If you manually stop recording this recording is stored in the list to be played back later If the recording memory is full a signal Is given New recording is not possible again until old recordings have been deleted Playback To play the recordings select the appropriate recording and press the rotary knob twice The recording is playe
14. the components within the deployment area of the airbags Insulation damage Damaged insulation can lead to equipment and wiring damage The cables and leads may not be under tension when installed Install the cables and leads in such a way as to avoid pinching or abrasion Polarity and shorting damage Cables connected with reversed polarity or in such a way as to produce a short circuit can lead to serious damage to your equipment Before commencing installation make sure that the car battery is disconnected Damage to essential vehicle components Essential vehicle components or wiring can be damaged when drilling mounting holes or screwing in self threading screws Please make sure there is always sufficient space behind the screw holes and drilled holes Interference with on board electronics Despite the extreme protection against interference incorrect installation can lead to interference with the vehicle electronic systems Please read the vehicle manufacturer s notes to this effect Appropriate use The EGO LOOK is intended exclusively for use in vehicles with Bluetooth mobile phones and A2DP devices Damage caused by inappropriate replacement parts Inappropriate spare or replacement parts may lead to malfunctions Please use only the approved parts listed in the section Spares parts and accessories Road safety risk For your own safety never initiate the coupling procedure while your vehicle Is in
15. this telephone call is maintained The EGO LOOK does not power down until the telephone call has been completed 7 6 4 Entering the Bluetooth PIN After a few seconds you will be prompted to enter your Bluetooth PIN Enter the PIN shown on the EGO LOOK display onto your mobile phone 7 6 5 Hands free mode In some cases coupling with your mobile phone in the hands free mode does not work when using the method described above If you are sure that your mobile phone supports the Bluetooth hands free profile proceed as follows In the list of detected devices select couple from phone Now you need to search for Bluetooth devices using your mobile phone The procedure for this can be found in the operating instructions for your mobile phone The mobile phone will then start searching for devices Select the EGO LOOK from the list of devices found by your mobile phone During the coupling process your mobile phone will prompt you to enter a PIN or password At this point please enter the series of numbers shown on the display of the EGO LOOK After a short time the mobile phone should inform you that coupling was successful You may also cancel the coupling at any time by pressing the EE key If coupling fails please read the section on Troubleshooting 7 6 6 Automatic coupling If the phone Is already connected with the EGO LOOK the EGO LOOK will try to couple to this phone If the search is successful a connection is automat
16. to radio communications However there is no guarantee that interference will not occur in a particular installation If this equipment does cause harmful interference to radio or television reception which can be determined by turning the equipment off and on the user is encouraged to try to correct the interference by one or more of the following measures 58 59 EGO LOOK Reorient or relocate the receiving antenna Increase the separation between the equipment and receiver Connect the equipment into an outlet on a circuit different from that to which the receiver is connected gt Consult the dealer or an experienced radio TV technician for help WARNING Changes or modifications made to this equipment not expressly approved by FWD may void the FCC authorization to operate this equipment FCC Radiation Exposure statement This equipment complies with FCC radiation exposure limits set forth for an uncontrolled environment End users must follow the specific operating instructions for satisfying RF exposure compliance This transmitter must not be co located or operating in conjunction with any other antenna or transmitter FCC IC statements for radio controller FwD FBT The labels for the radio controller according to FCC IC can be found inside the battery lid NOTICE This device complies with Part 15 of the FCC Rules and with RSS 210 of Industry Canada Operation is subject to the following two conditions
17. 5 Mounting the display Determining the mounting location The display is mounted to a smooth surface using the supplied adhesive pad The optimal position for this is facing directly at the driver Keep the effect of lights and sunlight in mind in order to minimize possible reflections Cleaning and degreasing the mounting location The mounting location must be clean and free from grease and dirt dust Prior to installation clean the area with a cleansing product containing ethyl alcohol Only use cleansing products that do not damage plastics or varnished wood finishes and are themselves free of oils or grease Unsuitable cleansers are for example lighter fluid acetone turpentine trichloroethylene and similar products Gluing the display in position Pull the protective foil from the adhesive strips Hold the display a few millimeters over the desired installation position Check the position again It is not possible to correct the display after it has been glued in place Place the display on the adhesive location and briefly apply moderate pressure Changing the base position As supplied the display base is intended for vertical mounting in the vehicle To change to the horizontal mounting position unlatch the base rotate 180 and re latch the base on the underside of the display 14 15 EGO LOOK 6 amp Connection scheme Installation for call reception for a car audio system with a mute input but without a phone input Wit
18. Various templates are available for this purpose Here you have the possibility to modify the templates as you wish under the Edit item To send press the Send key and select a name from the contacts list or enter the telephone number directly If for some reason the text message is not sent the EGO LOOK informs the user and jumps back to Edit text mode If the mobile phone does not support the sending of SMS messages via Bluetooth then the SMS menu item cannot be selected in the EGO LOOK 7 7 7 Music player Symbol The music player is activated through the main menu The music player may also be activated without a mobile phone being couple to the EGO LOOK In order to play back music the EGO LOOK must be coupled to an A2DP capable device such as a mobile phone with A2DP an iPod or an MP3 Player with A2DP adapter Connection coupling Under the Option menu item a New device may be coupled or an already coupled device may be connected A total of 10 devices may be coupled whereas only one device may be active If a New device is selected a Bluetooth device search Is performed The desired device can be selected from there If the music device does not support coupling from other devices it is also possible to couple the EGO LOOK from the music device via the Couple from device menu item In both cases a four digit PIN code is displayed by the EGO LOOK which must be entered into the music device Is
19. ation on this in the Voice control chapter Take paragraph into account The following methods may be used to Initiate a call from the menu by selecting from the contacts list and the mobile phone by direct outward dialing of a number with the number speller dialing from the call list on your mobile phone through the call back feature for received SMS messages And lastly you may also dial a number directly on your mobile phone IMPORTANT NOTE Please observe your country s regulations on in car telephone use Call ended Once a call is ended the menu jumps back to the main menu If an incoming call is rejected with the EE key the menu Jumps to the previous menu Setting the volume You can regulate the volume during a call and during active speech recognition using the rotary knob TIP If the person you re speaking with cannot hear you well consider increasing the sensitivity of the microphone in the Audio management menu under Settings There is a risk however that this may produce annoying echoes Options during phone calls During a phone call the following options can be carried out once the rotary knob has been turned DIMF tones Mute mic Private mode Record Alternate between calls DIMF tones Here touch key tones are selected and then sent by means of the speller Mute mic With this option the microphone can be switched to mute The person you have
20. by means of switch contacts These are designed for a peak power handling of 35 W Sinus Loudspeaker power handling exceeding 35 W leads to premature wear on the switching contacts For higher outputs use the telephone connection of the car audio or a 5 W 4 Ohm satellite speaker This port is only designed for voice reproduction 6 1 6 Car radio line in A car audio with a line in input option is required for music reproduction in stereo As an alternative to line in the car audio may have a mini ISO port block connector C a 0 14 in jack socket or a RCA input socket An appropriate adapter lead is required for the connection between the EGO LOOK line out and the line in version of your audio system If your car audio system has no line in option you can employ the optionally available Stereo Mute Box for stereo reproduction in combination with your car s front speakers 6 2 Installation locations RISK OF INJURY Unsuitable installation locations may become a source of injury in an accident or emergency braking Situation or may inhibit the correct functioning of essential safety equipment 6 2 1 Checking cable lengths Before you ve securely installed the components check that the installation locations have been selected In such a way that the cable length Is sufficient to connect the individual components Fig 02 Signal direction of the Bluetooth antenna 6 2 2 Selection of site for installing the electronics box The Bluet
21. ced Audio Distribution Profile is a technology that enables the wireless transmission of stereo audio signals via Bluetooth to a compatible receiving device Please take a look at our homepage for information about compatible mobile phones 7 6 2 Activating the controller You can read how to activate the radio controller with the EGO LOOK in Chapter 7 3 Getting started with the EGO LOOK controller in Activating the controller with the EGO LOOK 7 6 3 On Off function The first time you use your EGO LOOK you need to start it by switching on the ignition You will see the start logo followed by the main screen If the EGO LOOK is not connected to a mobile telephone or if no user is found the functionality of the main menu Is limited To establish a connection to the EGO LOOK you need to select the menu item Manage users using the rotary knob There you select New user The EGO LOOK then searches for mobile telephones in its reception range If your mobile telephone is not found you can start a search again or read the Troubleshooting section If the name of your mobile telephone Is displayed select it by pressing the rotary knob Once connected with the EGO LOOK complete functionality 28 29 EGO LOOK is available in the main menu Capabilities not supported by the mobile telephone cannot be selected Once the ignition is switched off the EGO LOOK powers down If the ignition is switched off during a telephone call
22. d for you Deleting If you want to delete a recording select the recording to be deleted and confirm using the rotary knob and go to the Delete item The recording is deleted by pressing the rotary knob 7 7 9 Settings Symbol A The Settings menu is highly complex since many settings for the EGO LOOK can be carried out under this menu item The following settings can be carried out Ringtone Brightness gt Call settings Direction of rotation Follow up time Factory settings Software update Information Help Language Voice control Audio management Voicemail j V V V V V V V V V Power down Ring tone The Ring tone menu is divided into Melody and Volume Several ring tones are available under Melody You may set these according to your personal tastes You can set the Volume of these ring tones using the rotary knob Brightness The brightness of the display can be adjusted here to the needs of the user Call settings Send number The Send number feature can be switched on or off here This setting is dependent on the network Call waiting The call waiting feature can be switched on or off here If this feature is activated calls from a third party will be signaled during an active phone call Automatic call answer If this option is activated incoming calls are automatically answered after three rings Direction of rotation gt Clockwi
23. device gt Direction of rotation Device 1 gt Delay Connect gt Factory settings Disconnect gt Software update Delete gt Info Device 2 gt Help Connect gt Language Disconnect gt Voice control Delete Start Device Recognition language gt Audio management Mic sensitivity Line in Volume Line out gt Voicemail On off Record text Listen to text Listen to recording gt Switch off gt New recording gt Recording 1 Listen Delete gt Recording 2 Listen Delete gt Recording 3 Listen Delete gt gt Recording gt Search gt Entry 1 gt Entry 2 PF sis gt Entry gt Options Direct dial Synchronize SIM Telephone SIM telephone gt Missed call gt Calls received gt Number dialed 1 gt Number dialed 2 gt gt Number dialed gt Read message Call back Answer Send Edit gt New message Send Edit 32 33 EGO LOOK 7 7 1 User management Symbol a The EGO LOOK allows you to manage up to 10 user profiles you can quickly and easily switch between these profiles while using the EGO LOOK Individual information saved for each user includes the following Contacts list Display brightness Ringtone Display language Volume settings Voicemail Dictation device Call lists v V V V V V V V Starting the Manage users function To reach the Manage users
24. e visit our website at www fwd online de A detailed description of the update procedure is included with the software EGO LOOK Service FAQ A list of frequently asked questions 1 Is it possible to dial directly without voice control with the EGO unit Yes with all EGO units except EGO TALK under the menu item Contacts list Options Direct outward dialing What are the exact dimensions of the EGO LOOK components You can find the dimensions in the operating instructions under the Technical data section Are EGO units suitable for all types of vehicles Yes EGO units are suitable for all types of vehicles See installation instructions Is there a list of optional charging cradles Yes A list of optional cradles is available on our website Are software updates for the units free Yes Where can EGO be purchased From authorized specialty dealers You can find a specialty dealer in your area through our website under the link Dealers Dealer search What is the procedure for transferring data in order to playback music Data transfer is possible with the EGO LOOK in two ways Bluetooth and Line in It is possible to make an MP3 player and iPod Bluetooth capable with a dongle adapter If an MP3 player without A2DP is used a jack cable can be used to connect it to the EGO LOOK Do EGO units have an external antenna port In combination with the optional charging cradle and the associated ba
25. ee i Mercedes 3 C se Porsche Becker Fig 11 EE Connector assignments x Socket contact housing Radio model Wire colour slsupuald F Permanent positive 30 Ignition 15 Ground 31 Car audio Vehicle wiring harness Le Socket contact housing Radio model Wire colour u ae Electronics box Ground 31 Connection system EGO LOOK Fig 13a View of original connection 6 5 2 Checking the installation When the ISO connection cable is correctly installed a call remains active until the call is ended even if the ignition has already been turned off beforehand The system switches off automatically when the call has been ended If the system switches to off immediately switches off then exchange the ignition lead blue with the power supply lead red as shown in Fig 13b Fig 13b View after changing cables PLEASE NOTE the fuses should remain in place when opening the fuse compartment make sure that they are not inadvertently exchanged 6 5 3 Additional external speakers In the following cases additional speakers 4 0 min 5 W must be used when the car audio system speakers should not be used when the output rating of the speaker channel is greater than 35 W Sinus and the car audio system has no phone connection option when the car audio system Is used with active speakers and has no phone connection option Feedback
26. electronic box line in 3 The electronics box line out must be connected to the car audio line in Depending on the car audio line in configuration one of the following cables Is required Connection cable 0 14 in stereo jack to 0 14 in stereo jack I 4 92 ft Connection cable 0 14 in stereo jack to RCA plug I 4 92 ft Connection cable 0 14 in stereo jack to Mini IS0 l 4 92 ft 4 The display must be connected to one of the two Jacks 5 The 14 pin plug of the ISO connecting cable must be connected with the electronics box 6 The base plate for the charging cradle may also be connected to the charger output socket udr ODDS Fig 15 Connecting electronics box 1 2 3 20 21 7 Operating instructions Co ROAD SAFETY RISK Failure to pay attention can lead to dangerous situations in traffic You must always direct your complete attention to current traffic conditions even when speaking with a hands free device It is advisable to avoid phone calls while driving in difficult traffic situations Co NOTE Depending on the software version and the mobile telephones used certain functions may not be available For more information visit www fwd online de 71 Features 7 1 1 Overview of features The hands free EGO LOOK system supports the Bluetooth hands free profile The EGO LOOK is the convenient system for phoning in your car It provides the following capabilities gt
27. elp and an explanation of possible commands Some mobile phones may not support a call list via Bluetooth If this is the case the EGO LOOK cannot show any entries with this command Show received calls This requires that numbers names are included in the call list If there is no entry the EGO LOOK informs the user The announcement can be stopped at any time by pressing the gg button Afterwards the following commands are available to you Call dial lt name gt To dial the name in the call list gt Call dial entry number lt 1 20 gt To dial a numbered entry in the call list gt Yes Call Dial To confirm the selection of the number name gt No Back To not dial the number name in the call list Abort Cancel Ends the dialogue without carrying out a function gt Help Calls up Help and an explanation of possible commands Some mobile phones may not support a call list via Bluetooth If this is the case the EGO LOOK cannot show any entries with this command Store note recording This command initiates recording of a spoken note The EGO LOOK checks if enough memory is available The user can save the message and end the recording with the EE key There is no command for ending the recording Afterwards the following commands may be given gt Yes Store To save the memo gt No Back Discard To reject the memo gt Abort Cancel
28. ere is no Bluetooth phone connected to the EGO LOOK voice activated dialing cannot be activated The following voice commands are possible Call dial lt name gt gt gt gt gt gt gt gt gt gt gt gt Call dial lt name gt at home at work in the office on business on the cell phone Dial number Show dialed numbers Show missed calls Show received calls Store note recording Read notes recording Help Redial call again Abort f Call Dial lt name gt This command may be used to select a name from the contacts list The name must be contained in the contacts list for this command to function If the name is not recognized or found the EGO LOOK responds with Please repeat and offers you the chance to repeat the command If the name is recognized you will be asked if the name should really be dialed The following commands are available to you gt Yes Call Dial Dials the number stored under that name gt No Back The number for the recognized name is not dialed gt Abort Cancel Ends the dialogue without carrying out a function gt Help Calls up Help and an explanation of possible commands 46 47 EGO LOOK Call Dial lt name gt at home on the cell phone With this command you may dial a specific type of number from a contacts list entry
29. familiarize yourself with the use of the EGO LOOK in combination with your mobile phone First of all make a few calls to determine the ideal volume and the best voice pickup direction before using the EGO LOOK in traffic When getting started your car should be parked in a quiet place It is also helpful if the person you will be calling can take time to let you make some test calls 7 6 1 About Bluetooth technology Bluetooth technology is a wireless technology and as such it allows communication between individual devices without the need for cables Data and voice information can be transmitted simultaneously It is unnecessary to have line of sight routing between the devices The transmission reception range in the open is typically 33 feet Interference from other electrical or electronic equipment or obstacles may however reduce this range The frequency band in which Bluetooth operates is reserved virtually worldwide This coupled with the fact that each Bluetooth product is tested and approved for compatibility with other Bluetooth devices ensures the highest possible levels of compatibility with devices from a wide range of manufacturers The EGO LOOK system supports the Bluetooth hands free profile This means that it is fully compatible with all phones supporting the Bluetooth hands free profile If you are uncertain read the operating instructions for your mobile phone to see which profiles are supported A2DP Advan
30. firmation of the connection setup security prompt see operating instructions for the mobile phone I Delete the other device from both devices One ofthe devices no longer has a valid link key i list of coupled devices and perform a new coupling System frozen Press the reset button on the back of the display using a No reaction to user input U not responding thin object e g a paper clip The system restarts 04 55 10 Accessories and spares parts You can find out more about supported mobile phones on our website at www fwd online de Your dealer will also be happy to advise you if you have any questions Accessories Stereo Mute Box Relax and listen to music or phone from your car The Stereo Mute Box provides smart sound management This compact box plays your calls or music over the car s speakers of course in superb stereo sound The car radio is muted during calls or when listening to music Features Radio muting during calls or music playback Audio Streaming Stereo music reproduction in combination with the car s front speakers Phone audio over the front speakers Base plate with charging cradle The charging cradle is a practical accessory for Bluetooth hands free systems by Funkwerk Dabendorf The charging cradle holds your mobile phone firmly and allows you to recharge its batteries in your car and is an ideal accessory for drivers who are constantly on the road and often need the
31. function go to the P symbol on the main screen and press the rotary knob Then you will see the users linked to the EGO LOOK and the New user item If no users are linked only the New user item is present Create a new user To activate a new user you must select the New user item using the rotary knob and then press the rotary knob All further steps are similar to those in the Getting started chapter Change user initials Open Manage users Then select a user and press the rotary knob This brings you into a submenu From there select the Change initials item Using the Speller you can now edit the name of the user Change icon color In this item the user can change the color of the user symbol Ten colors are available Reset user To delete all user data open Manage users Select the user to be reset Confirm your selection by pressing the rotary knob A menu opens In this menu select the Delete item All user data is now deleted from the EGO LOOK Change users To change users move into Manage users and select the desired user Confirm your selection by pressing the rotary knob A submenu opens Select the Activate item The previous user is deactivated and the new user activated If the selected user can be found the change in users takes place immediately If the user cannot be found the program returns to Manage users Log out user You can disconnect the current Bluetooth connect
32. h connection is severed under this item and the EGO LOOK is switched off The EGO LOOK may be switched back on by pressing a single key 7 8 Voice control The dialogue guided voice control of the EGO LOOK allows you to select a name or number via voice input While numerical selection allows you to directly announce a number you also have the option to select the name directly from the contacts list Switching the recognized language Depending on the country version of your EGO LOOK the voice recognition system supports up to three languages One of these may be activated To change the active recognized language select the item Setting Voice control Recognized language inthe menu A list of available languages is now displayed Select the desired language and confirm by pressing the rotary knob The EGO LOOK will now save your settings and begin updating the recognized language The status of this process is displayed for you using a progress bar Activation and sequence Voice control Is only possible if you are not making a telephone call By pressing the rotary knob for longer than a half a second while not engaged in a telephone call the status text Main menu is heard and the message Please speak appears in the display You may cancel each voice dialogue at almost any time with another prolonged pressing of the E key If the EGO LOOK is waiting for a voice command you may end the dialogue by saying abort If th
33. h this connection option voice playback is is emitted from the front right car speaker During calls the mute Input blocks the car audio signal NOTE Please observe the information in section 6 5 1 Checking the mute inputs on connecting the mute lead of the ISO connecting cable Installation for voice playback with a car audio system with phone and mute input options With this connection option voice playback comes through the car audio system speakers During calls the car radio output Is switched to the phone input by the mute input In order to access the phone input of your car audio system the speaker output of your EGO LOOK must be connected to the phone Input of your car audio system The purple and green leads of the ISO cable must be connected to the car audio phone input for this option The purple and green leads must be disconnected from the ISO connector The green lead pin 14 of the 14 pin plug should be connected to Phone Out and the purple lead pin 7 of the 14 pin plug to Phone In of the Mini ISO socket For information on the phone connection options of your car audio system please consult the manufacturers user manual NOTE If your car audio system has different phone connection options from those mentioned here please consult a qualified professional for installation of the system Furthermore please read the section with information on connecting the mute lead of the ISO connection cable
34. he synchronized entries are deleted and the program returns to the Contact list menu If you answer No synchronization continues 7 7 4 Call history Symbol In the Call history menu item you may view Numbers dialed Missed calls and Calls received After selecting the 38 39 EGO LOOK Call list menu item a list of numbers dialed is downloaded from the mobile phone Missed calls and Calls received may also be viewed by selecting the corresponding upper list entries Some mobile phones do not support access to the call list in this case a call list is maintained within the EGO LOOK 7 7 5 Voicemail The Voicemail item can be found under the Settings menu It may be activated or deactivated here It is also possible to record a message that will be played when voicemail is launched The recorded message can be played back in order to check it Information left by a caller within voicemail can be replayed under the Listen to messages item 7 7 6 SMS Symbol K lt The EGO LOOK supports the sending and receiving of text messages The menu Is structured in same form users are familiar with from their mobile phones Messages received can be viewed under the Incoming SMS item The sender of the message can be called back by phone using the Call back function You may also reply to the sender with a text message SMS In addition new messages may be recorded
35. ically established A search is always performed for the most recently connected mobile phone If the search process was unsuccessful it s possible that Bluetooth or the mobile phone is not turned on or that you were not the last user If you would like to select another user activate user management and log this user in 7 7 The menus Using the rotary knob navigate to a menu item Select a menu item using the rotary knob or exit the menu by pressing the Hg button By pressing the rotary knob again you select the submenu of the current menu You can select from the following menu items listed in the menu overview below am User management User specified settings such as change initials log in log out etc can be set out under this menu item New users can also be logged on For details please see the User management chapter A Settings General settings for the EGO LOOK can be entered under this menu item These range from Ringtone to Software update to Voicemail The exact breakdown can be found in the following overview which depicts the menu structure You can find more information in the Settings chapter JJ Music player The Music player menu allows you to playback songs and to control them as usual with Play Pause Stop Forward and Reverse The playback device can be coupled to the EGO LOOK under Options For details see the Music player chapter Es Dic
36. ics DOX eee tater aamasasmsnasnanasamaapussssqaqsqsaqaqupasssasqhasshuk 13 Fig 08 Connection for the mini ISO connection cable iii 16 Fig 09 installation Procedure uUUU Su sssussssssssmasishamamasmsqsakas gt asmkussqassqkassaakanassausasanpuniunsassaqanamaunsaskahaupadaniatsatisasssshusassunasasqa 17 Fig 10 Setting the PIN according to device type cette 18 Fig 11 Connector assignments u UL u aE a i aa EASRA aE aaeain 18 Fig 12 Connection SyS eM i aa 18 Fig 13 a b Voltage supply cable exchange titi 19 Fig 14 Connecting external loudspeakers iin 20 Fig 15 Comieco SleCirOnitS 010 u s 2 21 Fig 16 Status Dar uuu a wasasasumaassnskashanasaanuaapskanatussasqawkasnqsasaaaspamwssaqasmaqasaanqannqanqasscieswkashasaaasuaaasasaqsunqssqahi 25 EGO LOOK Introduction foreword Congratulations on your new EGO The EGO LOOK combines functionality with a brilliant visual effect This is evident in its beautiful design in the numerous functions and primarily in its color display The high resolution display is generously sized and provides you with all the important information such as contact list entries SMS text messages and more Intuitive menu prompting and wireless remote control ensure that you always have an overview The installation of your EGO LOOK in your car requires specialized knowledge and skills We therefore recommend that the installation be performed by a qualified professional Before installation in your car
37. interferes with the clarity of calls Mount additional speakers at a distance of at least 31 in from the microphone When mounting additional speakers please observe the manufacturer s installation instructions Speakers can be connected to the green pin 14 and the purple pin 7 leads of the connection cable First of all the purple and green leads must be disconnected from the ISO connector see Fig 14 18 19 EGO LOOK G TT View of the plug side Connection option for additional speakers on pin 7 from which the wiring is purple lead and pin 14 green lead of the 14 pin plug fed in the plug housing with pin allocation Car audio speaker output front right Permanent positive 30 Ignition 15 Car audio speaker output front right Fig 14 Connecting external loudspeakers 6 6 Connecting the components to the electronics box The individual components are connected to the electronics box as follows 1 Plug the microphone Jack into the jack socket with the microphone symbol 2 The electronic box line in can be used to connect an optional MP3 player with line out To do so a connection cable 0 14 in stereo jack plug to 0 14 in stereo jack plug I 4 92 ft is required IMPORTANT Only connect the device MP3 player iPod etc to the electronics box line in with a jack cable when it is being powered by battery alone without the recharger as interfering impulses may otherwise cause damage to the
38. ion within User management under the current user with the Log out menu item 7 7 2 Calling If there is a Bluetooth link between the EGO LOOK and a mobile telephone you can use the hands free capability of your EGO LOOK You can dial a number using voice dialing the menu or directly on the mobile telephone Incoming call If the mobile phone is available over the Bluetooth connection the call is signaled with the ringtone on your mobile phone Otherwise a signaling tone Is generated by the EGO LOOK If the caller has not blocked his number and if the mobile telephone supports this function the number or the name of the caller if a corresponding entry is found in the contact list is displayed You can decide to accept the call EER button or reject it GZ button If you accept the call you can regulate the volume using the rotary knob The setting is stored You may end the call by pressing the mg button 34 35 EGO LOOK Call setup Call setup from the EGO LOOK is only possible if there is an existing Bluetooth connection between the EGO LOOK and the mobile phone You may set up a call with voice activated dialing or through the menu To activate voice dialing press the rotary knob for longer than a half a second With the command Dial number you can announce the telephone number to be dialed or with the Dial lt Name gt command you can dial an entry in the contact list directly You can find more inform
39. ir phones In addition the external antenna connection ensures outstanding reception and transmission Features Intelligent charging circuit for mobile phones Mobile phone safely and securely held in the charging cradle External antenna connection for excellent call quality EGO LOOK Replacement parts 1 2 3 4 5 Electronics box Display Controller Microphone Set of connecting cables Adapter cable LOOK 5 3 06 57 EGO LOOK 11 12 Technical specifications Outer dimensions of the electronics box External dimensions Display without base External dimensions Controller Control unit cable lengths Operating voltage Quiescent current consumption ignition off Steady plus fuse protection Ignition fuse protection Temperature range Interfaces Supports Bluetooth profiles Certification C 0681 9 138 in x 2 126 in x 0 886 in 3 039 in x 3 039 in x 0 906 in 1 843 in x 1 843 in x 1 244 in 6 56 ft 11 V to 15 V max 0 1 mA 2A 1A 10 C to 55 C Microphone connection line in line out accessory port power supply terminal and charging connection Hands free A2DP AVRCP Fully compliant with the EU R amp TTE Directive 1999 5 EC e1 03 5074 Model certifi cation according to EU Directive 72 245 EWG 2006 28 EC Electromagne
40. le you will require a model specific mounting that may be purchased from a specialist dealer 6 1 2 Mobile phone Operation of the EGO LOOK requires a Bluetooth compatible mobile phone You can find a list of supported Bluetooth telephones online at www fwd online de 6 1 3 Muting radio mute switch The muting function Radio Muting ensures that the audio sound is turned off during telephone calls The system supports the muting function Your car s audio documentation will show whether your car audio has a mute option If your car audio Is not equipped with a muting option you can install the optionally available Stereo Mute Box to facilitate speaker muting 6 1 4 Converting the EGO LOOK into a previously installed Funkwerk hands free car kit An adapter cable is available for customers who already own a Funkwerk hands free car kit including the Audio 2000 3000 Audio blue Audio com and Audio compact and who would like to easily convert the EGO LOOK The adapter cable connects the EGO LOOK with the ISO cable already installed in your car with your Funkwerk hands free car kit NOTE This simple converting option is only possible when installing the EGO LOOK without a stereo mute box To install the EGO LOOK with the stereo mute box the stereo mute box s ISO connecting cable should be used to connect to the vehicle EGO LOOK 6 1 5 Add on speakers Car audio telephone connection The car sloudspeakers are transferred to the system Is
41. location should have the same form and area 12 13 EGO LOOK as the self adhesive strip on the microphone holder The location selected must allow the microphone cable to reach the electronics box Position the microphone with the head facing towards the direction of speech Cleaning and degreasing the mounting location The mounting location must be clean and free from grease and dirt dust Prior to installation clean the area with a cleansing product containing ethyl alcohol Only use products that do not damage plastics or varnished wood finishes and are themselves free of oils or grease Unsuitable cleansers are for example lighter fluid acetone turpentine trichloroethylene and similar products Attaching the microphone holder Peel off the protective backing from the self adhesive strip Hold the microphone holder at a distance of several millimetres about a quarter of an inch above the desired mounting location Re check the positioning Re positioning after mounting Is no longer possible Place the microphone holder on the mounting location and fix by applying short and light pressure Attaching the microphone Attach the microphone by sliding it into the holder and position the microphone head towards the direction of speech 6 3 3 Inserting the battery in the radio controller Rotate the lower portion of the controller clockwise and the upper portion counterclockwise to open the controller Lift the upper portion Insert the s
42. motion 5 Scope of delivery package content 1 Electronics box 2 Display and base 3 Radio controller including battery CR2477 type 4 Microphone 5 ISO cable for connection to the car electrical system 6 Adhesive pad for the base 7 Quick Guide 8 Safety manual ELA 1 Cal B45 2 mmrWwdD CES funkwerki 3 EGO LOOK Fig 01 Scope of Delivery 3 Personal injury Material damage Wh gt k en you remove coveri F Don t submit the conn suite SHES OF a ecting cables to pres 6 8 PLEASE MAKE SURE THE CONTENT OF THE PACKAGE is complete If any parts are missing please don t hesitate to contact our service hotline team 1 858 566 2170 Mon Fri 8 AM to 5 PM PST EGO LOOK Installation instructions 6 1 Required configuration Before installation of your EGO LOOK please note which features and connection options are provided by your car audio system It is advantageous when your audio has the following a muting function phone input and line in You can find out which of these Input options your audio system has in the documentation provided 6 1 1 Vehicle The EGO LOOK may only be installed in vehicles with 12 V with the negative terminal connected to the chassis If no car audio is installed an add on speaker will be required For the installation of the optional charging crad
43. n screen Selecting the active menu In the menus Selecting the active menu In the contact list and the contact history Starting a call to the currently selected number Brief description Accepting selecting a menu starting a call to the currently selected number stopping the screen saver 22 23 EGO LOOK The red button is used to reject an incoming call The red button can also be used to end a current call Additional functions of the red button In the menus Returning from the current submenu In edit mode Returning from the current submenu Brief description Rejecting hanging up returning from the current submenu stopping the screen saver NOTE The EGO LOOK has a screensaver After 60 seconds of inactivity the brightness of the display is reduced The display becomes brighter again after any button is pressed At the same time the button pressed performs the associated function 7 3 Getting started with the EGO LOOK controller Battery type Only use CR2477 type lithium batteries Other batteries can cause the unit not to operate properly or may even damage it The manufacturer assumes no liability for damage caused by the use of incorrect batteries The battery is not rechargeable Inserting the battery While looking at the Him and EER buttons rotate the lower portion of the controller clockwise and the upper portion counterclockwise to open the controller Lift the
44. ng the Ea button Then you select the context menu item Call switching The active caller is shown in the display as the top entry You can switch back and forth between the callers by pressing the Emm button again In the Call switching mode the volume of the active caller can be changed using the rotary knob Voicemail If you are unable to answer a call voicemail is activated and information left by the caller is accepted When the call is ended or when the allotted recording time is exceeded voicemail is switched off When voicemail is activated the call is accepted in the background and the user can listen along to the message the message Is recorded If voicemail is activated by a caller in the call waiting system the call can not be heard by the user Important note In most countries phoning while driving is only allowed when using a hands free system 7 5 3 Contacts list Symbol s The mobile phone s contacts list can be read via the Contacts list menu item In addition to dialing numbers from the contact information with the EER key entries can be found more quickly with the search function You may also download the contacts list from the mobile phone under the Option menu item or enter the number via direct outward dialing Read To read numbers from the contacts list please select the gt menu item After opening the contacts list all entries contained in the list are displayed Select the numbe
45. ooth antenna for the connection to the mobile phone is installed in the electronics box The antenna transmits directionally towards the front For this reason during installation ensure that the antenna faces into the passenger cell see Fig 02 Vertical mounting is ideal Metallic screening between the front panel and the passenger cell such as metal or metallised plastic panels are unsuitable and may interfere with the Bluetooth connection Locations behind the dashboard or ina metal lined glove compartment are also unsuitable A covering in plastic fabric or wood presents no problems whatsoever Suitable locations for the electronics box Passenger side next to the middle console under the paneling model specific installation console dealer Our suggested installation locations are shown in the illustration on the right Further unsuitable locations are Leg and knee height potential head impact zone airbag inflation space engine compartment 6 2 3 Selection of site for installing the microphone Suitable for the microphone Where voice can reach the microphone unhindered distance between the speaker and the microphone should be approx 13 78 in on the A column between windshield and driver s side
46. please make sure that your mobile phone is fully compatible with EGO LOOK If you are uncertain please consult your dealer or a qualified workshop Our service team will also be happy to help you with any information you may require Further information on compatibility between EGO LOOK and various mobile phones can be found on our website amp Safety notes 1 10 11 12 Incorrect installation Incorrect installation may lead to damage to the units and or your car Specialized knowledge and skills are required for installing the system We strongly recommend that the system be installed by a qualified professional Risk of injury Unsuitable installation locations may become a source of injury in an accident situation or may inhibit the correct functioning of essential safety equipment Please carefully read the notes in the Installation chapter carefully Risk of injury material damage the removal of vehicle lining with sharp or pointed objects may lead to injuries or material damage Road safety risk Diverted attention can lead to dangerous situations in traffic Even when using hands free phone systems your complete attention must be paid to the current traffic conditions It is always advisable to avoid phone calls while driving in difficult traffic situations Damage to airbags An incorrect installation location may cause damage to or inhibit the correct function of your airbags Do not install
47. r or name you want to call and press the EER key The numbers stored under this name are then displayed By pressing the EER key once again the number is dialed Search If searching for a particular name becomes difficult due to a large number of entries the search function may be used With this function entries may be searched for a specific name or specific first letters The desired name or first letters can be entered by using the speller By pressing the Ea key the contacts list will be searched for this name or letter Direct dial Direct dialing is possible in addition to voice activated dialing As described under the Speller and Call setup items a number can be entered here by hand using the speller The call is set up after confirming the number with the EER key Synchronizing In the Synchronize item you can download the contact lists of the mobile telephone or from the SIM card into the EGO LOOK memory Both contact lists can be synchronized too Once you have selected a contact list you confirm this with the rotary knob Now a loading bar appears in the display This bar indicates the instantaneous progress of the synchronization process If the download has been completed successfully the entries are now found in the EGO LOOK contact list In addition you can cancel the download manually using the Hig button If you decide to cancel you must reconfirm this by answering the Yes No question If you answer Yes t
48. ronics store 7 4 Symbols 7 4 1 Symbols in the status bar Could 45 2 am KSH CES Fig 16 Status bar The status bar Is a located at the top of the display and shows the symbols described in this section 24 25 EGO LOOK Field strength symbol indicates the current strength of the reception field SMS symbol indicates text messages received Arrow symbol indicates missed calls FWD Indicates the user s Initials Battery symbol indicates the battery capacity of the mobile phone 7 4 2 Speller symbols Symbol for confirming input Symbol to delete the last character Symbol for changing to numeric input Symbol for changing to lowercase letters N Symbol for changing to uppercase letters Symbol for changing to special characters Symbol for exiting the speller FFE 7 amp 3 Symbols for menu options Deactivated option This symbol appears in front of a menu item when it may be activated as an option 5 Activated option This symbol appears in front of an activated menu item 7 4 4 Contact list number types a gt Symbol for personal telephone numbers 1 a Symbol for mobile telephone numbers Symbol for business telephone numbers 7 4 5 Music player symbols buttons SSN Symbol for selecting the device a Symbol for setting the volume 2 Play pause Stop gt gt Track skip forward lt lt Track skip reverse 26 27 EGO LOOK 7 5 Speller
49. rves the right to modifi cations in the course of technological progress and deviations from the delivery scope All rights reserved Reproduction in whole or in part is only permitted with the prior written consent of Funkwerk Dabendorf GmbH
50. se If this option is activated rotating the knob clockwise signifies advancing in the menu or the contact list 42 43 EGO LOOK Counterclockwise If this option is activated rotating the knob counterclockwise signifies advancing in the menu or the contact list Delay time You may determine how long the EGO LOOK should remain active after switching off the ignition The delay time may be set in steps between 0 and 30 minutes Factory settings This resets all settings back to the standard factory settings In doing so all user settings including the contacts list are lost Software update The software for your EGO LOOK can be updated via Bluetooth For more details please see the section Software update Info Provides information about the various software and hardware versions of your EGO LOOK Use this information when you contact our service department with questions and problems Language The EGO LOOK supports multiple display languages You can change the display language within this menu item Voice control gt Start Carrying out this item launches voice control Control is performed with specific commands For more information see the Voice control chapter Recognition language If your EGO LOOK features multiple languages you may select the language here Audio management Microphone sensitivity Under certain circumstances it may be necessary to adjust the microphone sensitivity For example
51. se plate the mobile phone can be connected to the external antenna port Troubleshooting No supply voltage Replace fuse if needed and check cable and connections Ignition line interrupted Check line and 1A fuse The person you are having a phone Connect the microphone to the electronics box If the The microphone is not plugged in conversation with cannot hear you cable is defective replacement is necessary Ais sss TE EEE E s Mount the microphone in another place or The person you are 3 P reduce air flow If needed having a phone conversation with complains of interference The mobile phone is very close to Increase the distance between your mobile parts of the EGO LOOK or the car radio phone and the EGO LOOK or radio Too little space between di d I The person you are E nn sneaker ncrease distance or decrease volume having a phone conversation The mobile phone cannot I Reduce the distance between the mobile phone and Sond isinzzy or scratchy POE i EGO LOOK or remove metallic obstructions if needed The mobile phone is not within range Place the mobile phone within the range of the EGO LOOK After switching on The Bluetooth interface is Switch your mobile phone s Bluetooth the ignition the connection deactivated in the mobile phone to On Automatic option is not sufficient to the coupled mobile phone The mobile phone requires Confirm the connection on the mobile phone Deactivate the is not produced con
52. st If there is no entry the EGO LOOK informs the user The announcement can be stopped at any time by pressing the E button Afterwards the following commands are available to you Call dial lt name gt To dial the name in the call list gt Call dial entry number lt 1 20 gt To dial a numbered entry in the call list gt Yes Call Dial To confirm the selection of the number name No Back To not dial the number name in the call list Abort Cancel Ends the dialogue without carrying out a function gt Help Calls up Help and an explanation of possible commands Some mobile phones may not support a call list via Bluetooth If this is the case the EGO LOOK cannot show any entries with this command Show missed calls This requires that numbers names are included in the call list If there is no entry the EGO LOOK informs the user The announcement can be stopped at any time by pressing the Ea button Afterwards the following commands are available to you Call dial lt name gt To dial the name in the call list gt Call dial entry number lt 1 20 gt To dial a numbered entry in the call list gt Yes Call Dial To confirm the selection of the number name gt No Back To not dial the number name in the call list 48 49 EGO LOOK gt Abort Cancel Ends the dialogue without carrying out a function gt Help Calls up H
53. tation function The dictation function allows you to record and playback memos All voice recordings are listed under the menu item The dictation function Is described in detail under the chapter of that name s Contacts list The contacts list contains the entries downloaded from the mobile phone Each number in an entry can be accessed In addition direct outward dialing is possible here without voice control You can find more information in the Contacts list chapter 30 31 EGO LOOK Call history This contains lists of the last dialed numbers accepted calls and missed calls You can mark an entry using the rotary knob and start a call using the EER button You will find more information in the Call history chapter Messages Contains the list of text messages SMS Unread messages are marked accordingly The messages menu is divided into Read messages and New message More information can be found in the Messages chapter Main menu structure for the EGO LOOK dh gt New user gt User 1 Change initials Change icon color Log in Log out Delete gt User 2 Change initials Change icon color Log in Log out Delete gt gt User 10 gt Ringtone gt Playback Melody Play Volume Pause gt Brightness Stop gt Call settings Forwards Send number Reverse Call waiting gt Options Automatic answer New
54. tic compatibility in motor vehicles 9 Bluetooth is a registered brand name of Bluetooth SIG Inc 13 Conformity statement This equipment employs Bluetooth wireless technology In some countries the use of this equipment may be restricted or forbidden Please make sure you are familiar with such restrictions and do not use your equipment if you are unsure whether its use is permitted in particular countries you may be visiting Bluetooth is a registered brand name of Bluetooth SIG Inc Funkwerk Dabendorf GmbH Markische Stra e D 15806 Dabendorf Confirms that the hands free system EGO LOOK complies with the fundamental requirements and other relevant regulations of the EU Directive 1999 5 EC C 0681 FCC IC statements This device complies with part 15 of the FCC Rules Operation is subject to the following two conditions 1 This device may not cause harmful interference and 2 this device must accept any interference received including interference that may cause undesired operation NOTE This equipment has been tested and found to comply with the limits for a Class B digital device pursuant to Part 15 of the FCC Rules These limits are designed to provide reasonable protection against harmful interference in a residential installation This equipment generates uses and can radiate radio frequency energy and If not installed and used in accordance with the instructions may cause harmful interference
55. upper portion Push the battery with the positive terminal facing downward at an angle into the battery compartment and latch it in place When inserted you should not be able to see the labeled side of the battery Place the upper portion on the bottom so that the contacts of the bottom of the controller touch the contact surface in the upper portion Place the latching tabs in the notches and rotate opposite the opening direction Removing the battery gt While looking at the Hag and Emm buttons rotate the lower portion of the controller counterclockwise and the upper portion clockwise to open the controller Lift the upper portion Remove the battery from the battery compartment and then put the controller back together again Activating the controller withthe EGO LOOK The controller must initially be activated withthe EGO LOOK Switch onthe EGO LOOK gt Within the first 10 seconds after switching the EGO LOOK on indicated by the display backlighting being turned on press the Zim and Em buttons simultaneously for at least one second until the LED between the buttons is Illuminated The controller has now been activated with the EGO LOOK and can be used After changing the battery it is unnecessary to perform the activation again Disposing of used batteries Do not discard used batteries in household garbage gt Return used batteries to a designated collection point e g your dealer or an elect
56. upplied battery with the positive terminal downward into the lower portion until it latches Now place the upper portion on the bottom so that the contacts from the bottom of the controller touch the contact surface in the upper portion Position the latching tabs in the notches and rotate opposite the opening direction 6 3 4 Mounting the radio controller Define the mounting location The control console is mounted on a smooth service by means of the self adhesive pad provided Make sure that the user can easily reach the controller Cleaning and degreasing the mounting location The mounting location must be clean and free from grease and dirt dust Prior to installation clean the area with a cleansing product containing ethyl alcohol Only use cleansing products that do not damage plastics or varnished wood finishes and are themselves free of oils or grease Unsuitable cleansers are for example lighter fluid acetone turpentine trichloroethylene and similar products Gluing the radio controller in position Remove the protective foil from the adhesive pad on the underside of the controller Hold the radio controller a few millimeters over the desired installation position Check the position again when doing so keep the position of the red and green buttons In mind It is not possible to correct the controller after it has been glued in position Place the radio controller on the adhesive location and briefly apply moderate pressure 6 3

Operating Manual

Contents

Download Pdf Manuals

Related Search

Related Contents