Home

PNY GeForce 8200 Motherboard User Guide

1. Installation Procedure Refer to the following to install the memory modules 1 This motherboard supports unbuffered DDR2 SDRAM only 2 Push the latches on each side of the DIMM slot down Align the memory module with the slot The DIMM slots are keyed with notches and the DIMMs are 3 keyed with cutouts so that they can only be installed correctly 4 Check that the cutouts on the DIMM module edge connector match the notches in the DIMM slot 5 Install the DIMM module into the slot and press it firmly down until it seats correctly The slot latches are levered upwards and latch on to the edges of the DIMM 6 Install any remaining DIMM modules fe best performance and compatibility we recommend that users install DIMMs in the sequence of DIMM3 DIMM4 DIMM1 and DIMM2 Recommend configuration for best performance and compatibility Single Single Mode BENE na j n N Dual Dual Mode Channel Single Single Mode _ 3 jJ o x V fema Dual Table B DDR2 memory module QVL Qualified Vendor List The following DDR2 1066 AM2 800 667 533 400 memory modules have tested and qualified for use with this motherboard Type Size Vendor Module Name 256MB asalan Gawea e DDR2 533 x i x S12MB EL am Baka a aT a mee mes aa x CORON a ee E 2GB Kama aa KANG aaa EN r Module Name 256 MB HYS64T32000HU 25F B M20AD6G3H316011E53 AET
2. 2 3 pin rather than 1 2 pin as default if you want to wake up the computer by USB PS2 KB Mouse Connecting Case Components After you have installed the motherboard into a case you can begin connecting the motherboard components Refer to the following 1 Connect the CPU cooling fan cable to CPU_FAN 2 Connect the system cooling fan connector to SYS_FAN 3 Connect the standard power supply connector to ATX_POWER 4 Connect the auxiliary case power supply connector to ATX12V 5 Connect the case switches and indicator LEDs to the F_PANEL 6 Connect the power cooling fan connector to PWR_FAN 7 Connect the northbridge cooling fan connector to NB_FAN 8 Connec the case speaker cable to SPK ATX12V CPU FAN HA ATX_POWER E AELE mip to be ierik hg w a li J i I LF a F w 1 gt a 8 y J km t 42 ik f Pa Py 4 r a i ETE E E JA pat L A E A 5 iy i Le P gi area rea Fr lt I kaanan kamal Ka l a iH ae ay _ E i ge a z w z aa T j aw Le T i KE aa i Ain J i L 4 7 T 1 kan i Tht i i Mi a Halt i es r w z 2 l Gani Hoo AA B j T ie z r ak i aB Phenom TPI h aa ig j oe 4 Choree Koes E lt L f Hi a i i Pere PHH Giga LAN Dayi Connecting 24 pin power cable Users please note that
3. Power Management SCID we u u ata aga a pa aa waqa aa Ba a gina aapa aan daana bian Y PCI PNP Configuration 2 TM Ji IIN u uuu ous aaa aana a a aana kalang Taken E eg S BE aaa aaa aga ai 39 Frequency Voltage Control 41 Load Doli SENG agak aia kag ana pan Wg Kg pan a aaa Ag Ka abah pd aan arang ana anana a Aa aa 42 Supervisor POSS WONT saa gana eaaa an ain wa 2 xian nid na wae Sie iga eag aaa a d 2 User Pass a MANG NG A KNA KENA EE A NG KAR A NR E DANG TNI 581 D z asaquaeawhuakaypanyikawyaphiqawpuswkiawsus nukhasaqawhiwapupwiQkaspa 43 TERE WO 0 n us ssssuucushummqsqaywaappussqaypiyapaqaiqpkuspuqaykaqaqaqkaywpuqqus 43 Chapter 4 Using the Motherboard Software About the Software CD ROM 45 Auto installing under Windows XP V1sta 45 i AA uuu usus sqasausiwsssassakassstessksssswapasanasytpaqusapstaseyqaysayci 46 Manual Installatlon O0 Utility Software Reference Chapter 5 Setting Up NVIDIA RAID Configuration Setting Up a Non Bootable RAID Array 51 Setting Up a Bootable RAID Array 51 Chapter 1 Introduci
4. Setting Jumpers Use the motherboard jumpers to set system configuration options Jumpers with more than one pin are numbered When setting the jumpers ensure that the jumper caps are placed on the correct pins The illustrations show a 2 pin jumper When the jumper cap is placed on both pins the jumper is SHORT If you remove the jumper cap or place the jumper cap on just one pin the jumper is OPEN SHORT OPEN This illustration shows a 3 pin jumper Pins 1 and 2 are SHORT Checking Jumper Settings The following illustration shows the location of the motherboard jumpers Pin 1 is labeled oole T USBPWRR E J w d am ai mi Fai ip er at Histo AM24 TT E he P Phenom CPU ee ed Free Boost PCE Genz USBPWR_F 1 2 NORMAL CLR_CMOS 2 3 CLEAR CLR_CMOS 3 pin CLEAR CMOS Before clearing the CMOS make sure to turn the system off Rear USB PS2 1 2 VCC5 2 3 USBPWR_R USBPWR_R 3 pin Power Select VCC5 DUAL Jumper _ lim 1 USBPWR_F Front Panel USB 1 2 VCCS5 2 3 USBPWR_F 3 pin Power Select VCC5 DUAL Jumper 1 To avoid the system instability after clearing CMOS we recommend users to enter the main BIOS setting page to Load Optimized Defaults and then Save amp Exit Setup 2 Make sure the power supply provides enough VCC5_DUAL voltage before selecting the VCC5_DUAL function J It is required that users place the USBPWR_F amp USBPWR_R cap onto
5. which may be damaged if the cooling fan is carelessly installed Avoid using cooling fans with sharp edges on the fan casing and the clips Also install the cooling fan in a well lit work area so that you can clearly see the motherboard and processor socket Before installing the Processor This motherboard automatically determines the CPU clock frequency and system bus frequency for the processor You may be able to change these settings by making changes to jumpers on the motherboard or changing the settings in the system Setup Utility We strongly recommend that you do not over clock processors or other components to run faster than their rated speed 2 Warning Over clocking components can adversely affect the reliability of the system and introduce errors into your system Over clocking can permanently damage the motherboard by generating excess heat in components that are run beyond the rated limits This motherboard has a socket AM2 AM2 processor socket When choosing a processor consider the performance requirements of the system Performance is based on the processor design the clock speed and system bus frequency of the processor and the quantity of Internal cache memory and external cache memory CPU Installation Procedure The following illustration shows CPU installation components 1 Unhook the locking lever of the CPU socket Pull the locking lever away from the socket and raising it to the upright position 2 Match
6. 32BIt Data Transfer oeect ine type Auto ofdevice connected Auto to ihe sySemi AiO AUW ALDO Enabled Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings Type Auto Use this item to configure the type of the IDE device that you specify If the feature is enabled it will enhance hard disk performance by reading or writing more data during each transfer LBA Large Mode Auto Use this item to set the LAB Large mode to enhance hard disk performance by optimizing the area the hard disk is visited each time Block Mode Auto If the feature is enabled it will enhance hard disk performance by reading or writing more data during each transfer PIO Mode Auto Use this item to set the PIO mode to enhance hard disk performance by optimizing the hard disk timing DMA Mode Auto DMA capability allows user to improve the transfer speed and data integrity for compatible IDE devices S M A R T Auto The S M A R T Self Monitoring Analysis and Reporting Technology system is a diagnostics technology that monitors and predicts device performance S M A R T software resides on both the disk drive and the host computer 32Bit Data Transfer Enabled Use this item to set the onboard SATA IDE channel to be disabled IDE or RAID Press lt Esc gt to return to the Standard CMOS Setup page IDE BusMaster Enabled This item enables or disables the DMA under DOS mode We recommend you
7. 660UD00 25DB98X AU 51082 800P505 HYS64T64000HU 25F B 512 MB 04751208CZ5U2D KHX6400D2ULK2 1G s MT8HT F6464AY WEDA N anya NT512T64U88BOB Y 25C PSC AL6E8E63H 8E1 AET 60UD00 25DC08X AET860UD00 25DC08X 78 01GA0 9K5 AU1G082 800P000 HYS64T128020HU 25F B 04701G16CZ5U2G gii KHX6400D2ULK2 2G teen MT amp H TF12864A Y 80EE 1 U2S12D30TP 8E NT 1GT amp 4U8HBOBY 25C ELE NCPTZAUDR 25MAB AL7E8E63H 8E1 m AL7EBF 73C 8E1 53016042 7100B 0 78 A1GA0 9K4 D x Micron MT16HTF25664AY 800E1 Pse AL8EBF73C 8E1 Qimonda HYS84T256020EU 25F C2 512 MB eee Installing a Hard Disk Drive CD ROM SATA Hard Drive This section describes how to install IDE devices such as a hard disk drive and a CDROM drive About IDE Devices Your motherboard has one IDE interface An IDE ribbon cable supporting two IDE devices is bundled with the motherboard fe must orient the cable connector so that the pinl color edge of the cable corresponds to the pin I of the I O port connector IDE IDE Connector This motherboard supports five high data transfer SATA ports with each runs up to 3 0 Gb s To get better system performance we recommend users connect the CDROM to the IDE channel and set up the hard drives on the SATA ports IDE devices enclose jumpers or switches used to set the IDE device as MASTER or SLAVE Refer to the IDE device user s manual Installing two IDE devices on one cable ensure that one dev
8. BIOS CMOS Setup Utility window appears Phoenix Award BIOS CMOS Setup Utility Standard CMOS Features Load Fail Safe Defaults 3 OAC r Advanced RINS Features Advanced BIOS Features aad Pitino Thatta im 7 P L k Load Optimized Defaults nget Features Set Supervisor Password Set User Password F10 Save amp Exit Setup 4 V gt lt Select Item 110 IRQ DM riyry3rri li IMA Unboard K IRU Din Figure 2 1 BIOS CMOS Setup Utility Main Window 2 Use the arrow keys to select Integrated Peripherals see Figure 2 1 then press Enter The Integrated Peripherals window appears Phoenix Award BIOS CMOS Setup Utility integrated Peripherals RAID Config Press Enter OnChip IDE Channel Primary Master PIO Primary Slave PIO Primary Master UDMA Primary Slave UDMA OnChip IDE Channeli Secondary Master PIO Secondary Slave PIO Secondary Master UDMA Secondary Slave UDMA IDE Prefetch Mode Init Display First OnChip USB USB Keyboard Support USB Mouse Support Serial ATA SATA Spread Spectrum ACS Audio Enabled Auto Auto Auto Auto Enabled Auto Auto Auto Auto Enabled PCI Slot v1 1 v2 0 Disabled Disabled Enabled Disabled Auto Menu Level AY Move Enter Salect PU PD Value F40 Save ESC Exit F1 General Help F5 Previous Values F6 Fail Safe Defaults Fi Optimized Defaults Figure 2 2 Integrated Peripherals Window 3 Use t
9. Check to see if one came with your system If not you can create one by downloading the appropriate driver package and following the steps in this section 1 Create an F6 install floppy by using the x option then copy all files in IDE WinXP sataraid to a floppy disk For Windows 2000 substitute Win2K in the path 2 After you complete the RAID BIOS setup boot from the Windows CD The Windows Setup program starts 3 Press F6 and wait a few moments for the Windows Setup screen to appear Windows Setup Setup could not determine the type of one or more mass storage devices installed in your system or you have chosen to manually specify an adapter Currently Setup will load support for the following mass storage device s lt none To specify additional SCS adapters CD ROM drives or special disk controllers for use with Windows including those for which you have a device support disk from a mass storage device manufacturer press 3 lf you do not have any device support disks from a mass storage device manufacturer or do not want to specify additional mass storage devices for use with Windows press ENTER Specify Additional Devices ENTER Continue F3 Exit Figure 2 13 Windows Setup Specify Devices 4 Specify the NVIDIA drivers a Insert the floppy that has the RAID driver press S then press Enter The following Windows Setup screen appears Windows Setup a bso
10. Windows rForce Drivers Version 6 31 Release Date 2004 11 03 Space Required on C 101143 K Space Available on C 18753568 K InstallShield Next gt Cancel 3 Check the box next to the items you want to install The default options are recom mended 4 Click Next run the Installation Wizard An item installation screen appears 5 Follow the instructions on the screen to install the items 1 Drivers and software are automatically installed in sequence Followthe onscreen instructions confirm commands and allow the computer to restart a few times to complete the installation 2 During the Windows Vista Driver Auto Setup Procedure users should use one of the following two methods to install the driver after the system restart Method 1 Run Reboot Setup Windows Vista will block startup programs by default when installing drivers after the system restart You must select taskbar icon Run Blocked Program and run Reboot Setup to install the next driver until you finish all drivers installation alntenance A Windows has blocked some startup programs gt Windows blocks programs that require permission to run when Windows starts Click to view blocked programs s LU 7 28 PM nel System and Maintenance Show or remove blocked startup programs Run blocked program View help Exit Method 2 Disable UAC User Account Control For administrator account only Standard user account can only us
11. and a 3 5 inch drive with various capacities The floppy diskette drive cable has one type of connector for a 5 25 inch drive and another type of connector for a 3 5 inch drive Q Dyou must orient the cable connector so that the pin I color edge of the cable corresponds to the pin 1 of the I O port connector FDD Floppy Disk Connector This connector supports the provided floppy drive ribbon cable After connecting the single end to the onboard floppy connector connect the remaining plugs on the other end to the floppy drives correspondingly Installing Add on Cards The slots on this motherboard are designed to hold expansion cards and connect them to the system bus Expansion slots are a means of adding or enhancing the motherboard s features and capabilities With these efficient facilities you can increase the motherboard s capabilities by adding hardware that performs tasks that are not part of the basic system ma ma p mi mh pi a TT jajaka Naja ke B RB E H T3 0 AM24 P Pa P Phenom CPU x nll x p 2s 5 Hoe a Pi TP GeForce Boost PCIEX16 Slot is PCIE1 2 Slots PCl1 3 Slots PCIEX16 Slot The PCI Express x16 slot is used to install an external PCI Express graphics card that is fully compliant to the PCI Express Base Specification revision 2 0 PCIE1 2 Slots The PCI Express x1 slots are fully compliant to the PCI Express Base Specification revision 1 1 as well PCl1 3 Slots This moth
12. rs lt 3iu xrt r You have chosen to configure a SCSI Adapter for use with Windows using a device support disk provided by an adapter manufacturer Select the SCSI Adapter you want from the following list or press ESC to resutrn to the previous screen WA NVIDIA RAID CLASS DRIVER required NVIDIA NForce Storage Controller required Enter Select F3 Exit Figure 2 14 Windows Setup Selected SCSI Adapter b Select NVIDIA RAID CLASS DRIVER required and then press Enter c Press S again at the Specify Devices screen then press Enter d Select NVIDIA NForce Storage Controller required and then press Enter The following Windows Setup screen appears listing both drivers Windows Setup Setup will load support for the following mass storage device NVIDIA RAID CLASS DRIVER NVIDIA NForce Storage Controller To specify additional SCS adapters CD ROM drives or special disk controllers for use with Windows including those for which you have a device support disk from a mass storage device manufacturer press S If you do not have any device support disks from a mass storage device manufacturer or do not want to specify additional mass storage devices for use with Windows press ENTER S Specify Additional Devices ENTER Continue F3 Exit Figure 2 15 Windows Setup NVIDIA drives listed 5 Press Enter to continue with Windows XP Installation Be sure to leave the floppy disk inserted in the floppy dr
13. the 24 pin power cable can be connected to the ATX POWER connector With ATX v2 x power supply users please note that when installing 24 pin power cable the latches of power cable and the ATX_POWER match perfectly 24 pin power cable CPU_FAN CPU cooling FAN Power Connector Pin Signal Name Function 1 exp System Ground zam n Power 12V KEN EH 4 CPU FAN control Se Users please note that the fan connector supports the CPU cooling fan of 1 1A 2 2A 26 4W max at 12V SYS FAN PWR_FAN NB_FAN FAN Power Connectors ATX_POWER ATX 24 pin Power Connector Pin Signal Name Pin Signal Name llu ule afew au o 3 Gmm 5 cea o aje los 6 8 Grout 7 Ground Grom 8 rwrep a o o ss Jafe ajay Te Suan fas ge ae a e ATX12V ATX 12V Power Connector SPK Internal speaker header Pin Signal Name Front Panel Header The front panel header F_PANEL provides a standard set of switch and LED headers commonly found on ATX or Micro ATX cases Refer to the table below for information F_PANEL Pin Signal Function Pin Signal Function spew MoO mawa EDO _ Reset Power RST_SW_N switch O PWR SW P Switch Reset Power RST_SW_P switch KA PWR_SW_N switch O MSG LED dual color or single color Hard Drive Activity LED Connecting pins 1 and 3 to a front panel mounted LED provides visual indication that data is being read
14. the pin1 corner marked as the beveled edge on the CPU with the pin1 corner on the socket Insert the CPU into the socket Do not use force 3 Push the locking lever down and hook it under the latch on the edge of socket 4 Apply thermal grease to the top of the CPU Install the cooling fan heatsink unit onto the CPU and secure them all onto the socket 6 Plug the CPU fan power cable into the CPU fan connector CPU_FAN on the motherboard O1 gt achieve better airflow rates and heat dissipation we suggest that you use a high quality fan with 4500 rpm at least CPU fan and heatsink installation procedures may vary with the type of CPU fan heatsink supplied The form and size of fan heatsink may also vary Installing Memory Modules This motherboard accommodates four memory modules It can support four 240 pin DDR2 1066 AM2 800 667 533 400 The total memory capacity is 32 GB DDR2 SDRAM memory module table Memory module Memory Bus DDR2 400 200 MHz DDR2 533 266 MHz DDR2 667 333 MHz DDR2 800 400 MHz DDR2 1066 533 MHz You must install at least one module in any of the four slots Each module can be installed with 8 GB of memory total memory capacity is 32 GB 6 not remove any memory module from its antistatic packaging until you are ready to install it on the motherboard Handle the modules only by their edges Do not touch the components or metal parts Always wear a grounding strap when you handle the modules
15. to leave this item at the default value Drive A 1 44 MB 3 This item defines the characteristics of any diskette drive attached to the system You can connect one or two diskette drives Press lt Esc gt to return to the main menu setting page Advanced Setup This page sets up more advanced information about your system Handle this page with caution Any changes can affect the operation of your computer CMOS Setup Utility Copyright C 1985 2007 American Megatrends Inc Advanced Setup HT Frequency Auto ALRO AMD C amp O Enahied Quick Power on Seif Test Enabled HT frequency selection Boot Up Numipcs Status OH by CPU capability and APIC Mode Enabled southBrdge to SPU 1st Bom Dewees Hard Cu Trequency Gek ON 2nd Boot Device CO DVO ard Boot Device TE FLOPPY DRIVE te Removable Drives Press Enter Boot Other Device YES NO lt gt Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings HT Frequency Auto Anto This item enables users to manually set up the HyperTransport frequency ranging from Auto 1x to 5x AMD C amp Q Enaled This item helps the system to lower the frequency when CPU idles When the frequency decreases the temperature will drop automatically as well Quick Power on Self Test Enabled Enable this item to shorten the power on testing POST and have your system start up faster You might like to enable this item after you are confident that your syste
16. to the DRAM maximum size 2 GB per dimm at present thememory maximum size we have tested is 8 GB Feature Processor This motherboard uses a socket AM2 AM2 that carries the following features Accommodates AMD Phenom processor socket AM2 AMD Athlon 64 X2 Dual Core Athlon 64 Sempron processors Supports HyperTransport HT 3 0 interface speeds HyperTransport Technology is a point to point link between two devices it enables integrated circuits to exchange information at much higher speeds than currently available interconnect technologies Chipset The NVIDIA GeForce8200 is a single chip with proven reliability and performance HyperTransport 3 0 x16 up and down links to the AMD socket AM2 AM2 CPU PCI Express 16 lane link interface for external graphics processors PCI Express Generation 2 0 compatible Integrated NVIDIAGeForce Series DirectX 10 Vertex Shader 4 0 graphics processor Compliant with PCI v2 3 interface at 33 MHz Integrated SATA 3 0 Gb s Host Controller Twelve USB 2 0 ports supported Fast ATA 133 IDE controller NVIDIA MediaShield RAID with support for RAID 0 RAID 1 RAID 0 1 RAID 5 and JBOD Integrated Hybird SLI technology NVIDIA UltraShadow technology full NVIDIA nView multi display technology capability Memory Supports DDR2 1066 AM2 800 667 533 400 DDR2 SDRAM with Dual channel architecture Accommodates four unbuffered DIMMs Up
17. A hard disk with external power Connect an RJ 45 jack to the LAN port to connect your computer to the network Use the audio jacks to connect audio devices The D port is for stereo line in signal while the F port is for microphone in signal This motherboard supports 8 channel audio devices that correspond to the A B C and E port respectively In addition all of the 3 ports B C and E provide users with both right amp left channels individually Users please refer to the following note for specific port function definition A L B Back Surround C Side Surround The above port definition can be changed to audio input or audio output by changing the driver utility setting e Microphone This motherboard may adopt 6 channel audio ports Use the three audio ports to connect audio devices The first jack is for stereo line in signal The second jack is for stereo line out signal The third jack is for microphone This concludes Chapter 2 The next chapter covers the BIOS Chapter 3 Using BIOS About the Setup Utility The computer uses the latest American Megatrends Inc BIOS with support for Windows Plug and Play The CMOS chip on the motherboard contains the ROM setup instructions for configuring the motherboard BIOS The BIOS Basic Input and Output System Setup Utility displays the system s configuration status and provides you with options to set system parameters The parameters are stored in b
18. Disabled Syslem Suspend Resume By PS2 KS 53 Disabled Resume By PS2 S 33 Disabled Resume by USS 53 Disabled Resume on RTC Alami Disabled a Mre 3 Enler Sefect 4 Value Fif Save ESC Exit 1 General Help ra Load Defaut settings ACPI Suspend Type S3 Use this item to define how your system suspends In the default S3 the suspend mode is a suspend to RAM 1 e the system shuts down with the exception of a refresh current to the system memory Soft off by PWR BTTN Instant off Under ACPI Advanced Configuration and Power management Interface you can create a software power down In a software power down the system can be resumed by Wake Up Alarms This item lets you install a software power down that is controlled by the power button on your system If the item is set to Instant Off then the power button causes a software power down If the item is set to Delay 4 Sec then you have to hold the power button down for four seconds to cause a software power down PWRON After PWR Fail Power Off This item enables your computer to power off automatically restart or return to its previous status after abnormal power lost Resume By RING Disabled The system can be turned off with a software command If you enable this item the system can automatically resume if there is an incoming call on the Modem You must use an ATX power supply in order to use this feature Resume By PCI PCI E Lan PME Disabled The system can be turned
19. HDMI audio support Hybrid SLI support Disabled This item allows users to enable or disable the NVIDIA Hybrid SLI technology Press lt Esc gt to return to the main menu setting page Integrated Peripherals This page sets up some parameters for peripheral devices connected to the system CMOS Setup Ultllly Copyright C 1985 2007 American Megairends Inc Integrated Peripherals Onboard IGE Coninailer Enabied Onchip S ATA Conroler Enabled SATA Mode peleri AHCI Hode ARO Configuration Prass Enter Onboard AUDIO Functon Enabled Onboard LAN Funcion Enabled Onboard LAN Boot ROM Disabled senal Parti Address IFAR OnBoard IR Disabled USB Controller Enabled Legacy USS Support Enabled H me Enere Ch Vale Fin massa ESC Ext a F1 General Help F3 Load Default settings OnBoard IDE Controller Enabled Use this item to enable or disable the onboard IDE interface Onboard S ATA Controller Enabled This item allows you to enable or disable the onboard SATA controller SATA Mode select AHCI Mode Use this item to select the mode of the Serial ATA lt AHCI Configuration Press Enter Scroll to this item and press lt Enter gt to view the following screen CMOS Setup UMR Copyight CG 1995 2007 Amercan Megarends Ing AHCI Configuration AHCI Stings AHCI COVOVD Boot Time out Ji E AHCI Pond E AHCI Pont F AHCI Pat e AHCI Porm be AHCI Pon amp AHCI Ports a5 Hot Detected Not Detected Not De
20. Handle this page with caution Any changes can affect the operation of your computer CMOS Setup Utility Copyright C 1985 2007 American Megatrends Inc Advanced Chipset Setup share Memory Auto Detection ARO DRAM Frequency Auto z DRAM Timing Mode Auto IGPU Frame Buller Size DOT Unganged Mace Ato Auto Detect Memory Hole Remapping Enatled HOM AUDIC Enabled Hybrid SLI support Disabled Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings Share Memory Auto Detection Auto Disable this item to set the Share Memory Size And if the item is set to Auto Share Memory Size can be controlled according to the dram size When the dram size is less than 512 MB Share Memory Size should be set to 64 MB While between 512 MB and 1 GB it should be set to 128 MB When more than 1 GB it should be set to 256 MB DRAM Frequency Auto This item enables users to adjust the DRAM frequency The default setting is auto and we recommend users leave the setting unchanged Modify it at will may cause the system to be unstable DRAM Timing Mode Auto This item enables you to specify the DRAM timing mode to be configured automatically or manually DCT Unganged Mode Auto This item is used to select the DCT mode DRAM Controller mode Memory Hole Remapping Enabled This item allows users to enable or disable memory hole remapping HDMI AUDIO Enabled This item is used to enable or disable the NB
21. Help F9 Load Default seng Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings iGPU and Ext VGA Selection Single Use this item to select internal VGA or external VGA card to display Init Display First PCl Use this item to select which graphics controller to use as the primary boot devices Press lt Esc gt to return to the main menu setting page PC Health Status On motherboards support hardware monitoring this item lets you monitor the parameters for critical voltages temperatures and fan speeds CMOS Setup Utility Copyright C 1985 2007 American Megatrends Inc PC Health Status Hardware Heal Event Mantioning t Smat Fan Function ShuiGown Temperaire ii a Voor WERI WHE CPU FAN Spesad oS FAN Speed CPU Temperature jaka Temparah Te Iz Ir ii of L is i T oi hi Dn 2 al i 1m oe criti i fe Fier at J d of me cn a Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings Smart Fan Function Scroll to this item and press lt Enter gt to view the following screen CMOS Setup Utility Copyright C 1985 2007 American Megatrends Inc Smart Fan Function CPU SMART FAN Contral Enabled TargeiTemp Value BEO Tolerance Value 03 startup Value 150 Sing Value 100 StopTime Value BEO Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default setti
22. Preface Copyright This publication including all photographs illustrations and software is protected under international copyright laws with all rights reserved Neither this manual nor any of the material contained herein may be reproduced without written consent of the author Version 1 0 Disclaimer The information in this document is subject to change without notice The manufacturer makes no representations or warranties with respect to the contents hereof and specifically disclaim any implied warranties of merchantability or fitness for any particular purpose The manufacturer reserves the right to revise this publication and to make changes from time to time in the content hereof without obligation of the manufacturer to notify any person of such revision or changes Trademark Recognition Microsoft MS DOS and Windows are registered trademarks of Microsoft Corp NVIDIA is a registered trademark of NVIDIA Corporation Other product names used in this manual are the properties of their respective owners and are acknowledged Federal Communications Commission FCC This equipment has been tested and found to comply with the limits for a Class B digital device pursuant to Part 15 of the FCC Rules These limits are designed to provide reasonable protection against harmful interference in a residential installation This equipment generates uses and can radiate radio frequency energy and if not installed and used in accordance wi
23. at the NVIDIA IDE Driver is selected You must install the NVIDIA IDE driver in order to enable NVIDIA RAID If you do not install the NVIDIA IDE driver NVIDIA RAID will not be enabled Click Next and then follow the instructions After the installation is completed be sure to reboot the PC After the reboot initialize the newly created array Setting Up a Bootable RAIDArray This section explains how to configure a bootable NVIDIA RAID array Setting Up the BIOS 1 Start your computer and then press Delete to enter the BIOS setup Phoenix Award BIOS CMOS Setup Utility Ese Quit F10 Save amp Exit Setup Load Fail Safe Defaults Exit Without Saving V gt Select item 2 Usethe arrow keys to select Integrated Peripherals see Figure 2 5 then press Enter The Integrated Peripherals screen or a screen similar to it appears Phoenix Award BIOS CMOS Setup Utility RAID Config OnChip IDE Channel Primary Master PIO Primary Slave PIO Primary Master UDMA Primary Slave UDMA OnChip IDE Channel Secondary Master PIO Secondary Slave PIO secondary Master UDMA Secondary Slave UDMA IDE Prefetch Mode Init Display First OnChip USB USB Keyboard Support USE Mouse Support Serial ATA SATA Spread Spectrum ACS Audio Integrated Peripherals Press Enter Item Help Enabled Zes Menu Loval Auto Auto Enabled Auto Auto Auto Auto Enabled PCI Sot V1 4 V2 0 Di
24. attery backed up CMOS RAM that saves this information when the power is turned off When the system is turned back on the system is configured with the values you stored in CMOS The BIOS Setup Utility enables you to configure Hard drives diskette drives and peripherals Video display type and display options Password protection from unauthorized use Power Management features The settings made in the Setup Utility affect how the computer performs Before using the Setup Utility ensure that you understand the Setup Utility options This chapter provides explanations for Setup Utility options The Standard Configuration A standard configuration has already been set in the Setup Utility However we recommend that you read this chapter in case you need to make any changes in the future This Setup Utility should be used when changing the system configuration when a configuration error is detected and you are prompted to make changes to the Setup Utility when trying to resolve IRQ conflicts when making changes to the Power Management configuration when changing the password or making other changes to the Security Setup Entering the Setup Utility When you power on the system BIOS enters the Power On Self Test POST routines POST is a series of built in diagnostics performed by the BIOS After the POST routines are completed the following message appears Press DEL to enter SETUP Press the delete
25. auxiliary front oriented microphone and line out ports for easier access Pin Signal Name Pin Signal Name PORT a ronm NONA KN PORT 7h JENIE SEND lt PORT 2L Ea a 3EM3E2 RETURN SPDIFO SPDIF out header This is an optional header that provides an S PDIF Sony Philips Digital Interface output to digital multimedia device through optical fiber or coaxial connector Pin Signal Name Function x 1 3DF 3PDIF digital output KAE ds SV analog Power IR Infrared header The motherboard supports an Infrared IR data port Infrared ports allow the wireless exchange of information between your computer and similarly equipped devices such as printers laptops Personal Digital Assistants PDAs and other computers Pin Signal Name Function Not Assigned Not assigned IR Power IrDA serial ouiput EDA serial inpur F USB1 3 Front Panel USB headers The motherboard has six USB ports installed on the rear edge I O port array Additionally some computer cases have USB ports at the front of the case If you have this kind of case use auxiliary USB connector to connect the front mounted ports to the motherboard Pin Signal Name Function Gp Grong OOo O Gp Gua oOo m ea Lg make sure that the USB cable has the same pin assignment as indicated above A different pin assignment may cause damage or system hang up SATA1 5 Serial ATA connectors These connectors are used to support the new Seria
26. d NG Md st A x an akal uzg 1 104 NVT esto AJ ATANG INA NI ALAA JALAN LELIA IILI ll NYA siS S na i so1pn V 4 OF AS qs a aaa t Ga uuey PE 3 wits ernie 19 E ier we LAN d Table of Motherboard Components LABEL CO MPO NENTS Socket for AMD Phenom processor socket AM2 AMD 1 CPU Socket Athlontm 64 X2 Dual Core Athlont 64 Sempront processors 2 CPU_FAN CPU cooling fan connector 3 DDR2_1 4 240 pin DDR2 SDRAM slots 5 5 IDE 6 SPK This concludes Chapter 1 The next chapter explains how to install the motherboard 4 AT X POWER Standard 24 Pin ATX Power connector Chapter 2 Installing the Motherboard Safety Precautions Follow these safety precautions when installing the motherboard Wear a grounding strap attached to a grounded device to avoid damage from static electricity Discharge static electricity by touching the metal case of a safely grounded object before working on the motherboard Leave components in the static proof bags they came in Hold all circuit boards by the edges Do not bend circuit boards Choosing a Computer Case There are many types of computer cases on the market The motherboard complies with the specifications for the ATX system case Firstly some features on the motherboard are implemented by cabling connectors on the motherboard to indicators and switches on the system case Ma
27. e Array List screen appears where you can review the RAID arrays that you have set up MediaShield Utility Array List Boot ld Status Vendor Array Model Name Healthy NVIDIA MIRROR 74 53G Ctri X Exit Aa Select B Set Boot N New Array ENTER Detail 3 Use the arrow keys to select the array that you want to set up then press B to specify the array as bootable 4 Press Enter to view and verify details The Array Detail screen appears Array 2 NVIDIA MIRROR 74 566 Array Detail RAID Mode Mirroring Striping Width 1 Striping Block 32K Adapt Channel M S Index Disk Model Name Capacity 74 56GB 74 56GB R Rebuild D Delete C Clear Disk Enter Return Figure 2 12 Array Detail Screen The Array Detail screen shows various information about the array that you selected such as Striping Block used RAID Mode Striping Width Disk Model Name and disk capacity 5 If you want to mark this disk as empty and wipe out all its contents press C 6 At the prompt press Y to wipe out all the data otherwise press N 7 Press Enter again to go back to the previous screen and then press F10 to exit the RAID setup Installing the RAID Drivers Your system may come with a Windows install CD that already includes NVIDIA RAID drivers If so then this section is not relevant If that is not the case or you are trying to install a new version of Windows then you will need an NVIDIA RAID driver F6 install floppy
28. e Method 1 Disable Vista UAC function before installing drivers then use CD driver to install drivers it will continue to install drivers after system restart without running blocked programs Follow these instructions to Disable Vista UAC function 1 Go to Control Panel Internet Oy Internet Exptores E mail QS65T M ELJ Windows Mail nents dl Welcome Center e Windows Media Center w Windows Ultimate Extras gt Windows Media Player lal Windows Photo Gallery 20 Windows Live Messenger Download Windows DVD Maker 4 Windows Meeting Space C EIES AM 2 Select Classic View a Mm 3 Set User Account WI Control Panel gt Control Panel Home Recent Task System and Maintenance Get started with Windows Back up your computer Security Check for updates Check this computer s security status Kd Allow a progtam through Windows Firewall Network and Internet Connect to the Internet View network status end tasks Set up file sharing Hardware and Sound Play CDs or other media automatically Printer Mouse Programs Uninstall a program Change startup programs Problem Programs Regionaland Scanners and Reports a and Features Language Cemer amp Tablet PC as Taskbar and Settings Start Menu User Accounts and Family Safety r Setup parental controls for any user W Adi or remove user accounts Appearance and Personalization Change desktop background Custo
29. erboard is equipped with three standard PCI slots PCI stands for Peripheral Component Interconnect and is a bus standard for expansion cards which for the most part is a supplement of the older ISA bus standard The PCI slots on this board are PCI v2 3 compliant ib Q Before installing an add on card check the documentation for the card carefully If the card is not Plug and Play you may have to manually configure the card before installation Follow these instructions to install an add on card 1 Remove a blanking plate from the system case corresponding to the slot you are going to use 2 Install the edge connector of the add on card into the expansion slot Ensure that the edge connector is correctly seated in the slot 3 Secure the metal bracket of the card to the system case with a screw be For some add on cards for example graphics adapters and network adapters you have to install drivers and software before you can begin using the add on card Connecting Optional Devices Refer to the following for information on connecting the motherboard s optional devices 3 0 AM2 F gt Phenom CPU Giga LAN _ PCI E Gen 2 i AHCI RAID Only yee Lk 1 AST HOTS TAL SI MASSA Aa S PDIFO 1 Gek L I PWA Hor E i S KENA 3 q a ojojo 3 b a POP z A AAS z CD_IN com F USB3 F USB2 F_USB1 1 7 9 F_AUDIO F_AUDIO Front Panel Audio header optional This header allows the user to install
30. et of I O ports and connectors e Two PS 2 ports for mouse and keyboard One VGA port e One HDMI port e One eSATA port e Six USB ports e One LAN port e Audio jacks for microphone line in and 6 8 ch optional line out BIOS Firmware The motherboard uses AMI BIOS that enables users to configure many system features including the following e Power management e Wake up alarms e CPU parameters CPU and memory timing The firmware can also be used to set parameters for different processor clock speeds Lo I Some hardware specifications and software items are subject to change without prior notice 2 Due to chipset limitation we recommend that motherboard be operated at ambiance temperature between 0 and 50 C Motherboard Components ANAKAN ANANA NANA ANNA RL KANAAN NANA NA NANA NANA NAN ANANA NA ANA NANA NANA NANA NAN JIIIIDTILITIILIIIIIITITPIILILIITITITTITTTTITTITITITTITITTTTITII ANAA ANNA NAN AAN NANA NAN NANA NANA NA NASA NANA TAA ANANA INA TANG RATAN AAN NANTANG KAN TA AN KABANARAN NAN NGA ANA NINI el PRTAPLCEPSUAL RATATAT AREAS ED HAT AR RISE NAN Ga E ini g mg te MITTIN NANA NANA NA ANAN ANANA NANA NA ANANA NANA ERE REET EEE MANAN NAH DRBRIBLSeere erewesrrresese TANANAN ANA NA ANANA NANA NANA ELDER ANTA NANA NANI MAN BUNGA NABA NANA NAGA NANA NAN RARA AAN ANAN ANANA RANU PECLAETLRAT OE LORE RSET PATE ERE REVE RT AEA EREDAR TERETE NAN ALIAN NGANAN anana NANA NANANG Nana aan NYS Bi
31. from or written to the hard drive For the LED to function properly an IDE drive should be connected to the onboard IDE interface The LED will also show activity for devices connected to the SCSI hard drive activity LED connector Power Sleep Message waiting LED Connecting pins 2 and 4 to a single or dual color front panel mounted LED provides power on off sleep and message waiting indication Reset Switch Supporting the reset function requires connecting pin 5 and 7 to a momentary contact switch that is normally open When the switch is closed the board resets and runs POST Power Switch Supporting the power on off function requires connecting pins 6 and 8 to a momen tary contact switch that is normally open The switch should maintain contact for at least 50 ms to signal the power supply to switch on or off The time requirement is due to internal de bounce circuitry After receiving a power on off signal at least two seconds elapses before the power supply recognizes another on off signal Installing Hardware Installing the Processor 2 Caution When installing a CPU heatsink and cooling fan make sure that you DO NOT scratch the motherboard or any of the surface mount resistors with the clip of the cooling fan If the clip of the cooling fan scrapes across the motherboard you may cause serious damage to the motherboard or its components On most motherboards there are small surface mount resistors near the processor socket
32. he NVIDIA RAID BIOS set up lets you choose the RAID type and which hard drives you want to make part of the array Entering the RAID BIOS Setup 1 Wait until you see the RAID software prompting you to press F10 The RAID prompt appears as part of the system POST and boot process prior to loading of the OS You have a few seconds to press F10 before the screen disappears 2 Press F10 The NVIDIA RAID Utility Define a New Array screen appears Figure 2 8 NVIDIA RAID Utility Define a New Array RAID Mode q Striping Block Optimal Free Disks Array Disks Disk Model Name Loc Disk Model Name F6 Back FT Finish TAB Navigate Wu Select ENTER Popup Figure 2 8 NVIDIA RAID Utility By default RAID Mode is set to Mirroring and Striping Block is set to Optimal Using the Define a New Array Screen If necessary press the tab key to move from field to field until the appropriate field is highlighted Selecting the RAID Mode By default this is set to Mirroring To change to a different RAID mode press the down arrow key until the mode that you want appears in the RAID Mode box either Mirroring Striping Spanning Stripe Mirroring or RAID 5 Note Not all RAID levels are supported on all platforms Selecting the Strping Block Size Striping block size is given in kilobytes and affects how data is arranged on the disk It is recommended to leave this value at the default Optimal which is 64KB but the values ca
33. he arrow keys to select the RAID Config see Figure 2 2 then press Enter The RAID Config window appears Phoenix Award BIOS CMOS Setup Utility RAID Config RAID Enable Enable RAID Enabled SATA 1 Primary SATA 1 Secondary RAID Enabled Menu Level SATA 2 Primary RAID Enabled SATA 2 Secondary RAID Disabled YS lt Move Enler Select PU PD Value F10 Save ESC Exit F1 General Help F5 Previous Values 6 Fail Safe Defaults FT Optimized Defaults Figure 2 3 RAID Config Window From the RAID Config window globally enable RAID then enable the SATA ports with disks that you want to use for RAID If RAID is enabled globally but not enabled on the individual SATA port disks on that port can only be used for non RAID applications In the example in Figure 2 3 three SATA ports are enabled so the non bootable RAID array can include up to 3 SATA disks If there is a disk Connected to SATA 2 Secondary it can not be used for RAID 5 Press F10 to save the configuration and exit The PC reboots Installing the NVIDIA RAID Software under Windows This section describes how to run the setup application and install the RAID software 1 Start the nForce Setup program to open the NVIDIA Windows nForce Drivers page PAM BA Wire norco Driverg Gelmo Festu mi mp ruis AADA GAAT Dire AVDA SHB ai Diras Figure 2 4 nForce Driver Installation Window Select the modules that you want to install Make sure th
34. he software f Windows Explorer look for a file named README TXT INSTALL TXT or something s lar This file may contain important information to help you mstall the software correctly Some software 15 installed im separate folders for operat mg systems such as Windows XP Vista Always go to the correct folder for the kind of OS vou are using In install the software execute a file named SETUP EXE or instructions on the screen Application Tab Lists the software utilities that are available on the CD Read Me Tab Displays the path for all software and drivers available on the CD Running Setup Follow these instructions to install device drivers and software for the motherboard 1 Click Setup The installation program begins a Bim ki ani ee A Pele Tay nin Progr iran Laka lean Pa j P Tha following screens are examples only The screens and driver lsi oe will be different according to the motherboard you are installing The following screens are examples only The screens and driver lists will be different according to the motherboard you are installing The motherboard identification is located in the upper left hand corner 2 Click Next The following screen appears Auto Setup Package software Version 2 00 0018 Select Features Choose the features Setup will install Select the features you want to install clear the features you do not want to install 51892 K Description NVIDIA
35. ice is set to MASTER and the other device is set to SLAVE The documentation of your IDE device explains how to do this About SATA Connectors Your motherboard features five SATA connectors supporting a total of five drives SATA refers to Serial ATA Advanced Technology Attachment is the standard interface for the IDE hard drives which are currently used in most PCs These connectors are well designed and will only fit in one orientation Locate the SATA connectors on the motherboard and follow the illustration below to install the SATA hard drives Installing Serial ATA Hard Drives To install the Serial ATA SATA hard drives use the SATA cable that supports the Serial ATA protocol This SATA cable comes with an SATA power cable You can connect either end of the SATA cable to the SATA hard drive or the connector on the motherboard f SATA cable optiona SATA power cable optional Refer to the illustration below for proper installation 1 Attach either cable end to the connector on the motherboard 2 Attach the other cable end to the SATA hard drive 3 Attach the SATA power cable to the SATA hard drive and connect the other end to the power supply n Bni motherboard supports the Hot Plug function Installing a Floppy Diskette Drive The motherboard has a floppy diskette drive FDD interface and ships with a diskette drive ribbon cable that supports one or two floppy diskette drives You can install a 5 25 inch drive
36. ive until the blue screen portion of Windows XP installation is completed then take out the floppy 6 Follow the instructions on how to install Windows XP After Windows XP is completely installed it is recommended that you install the ForceWare software in order to access the MediaShield RAID Management tool Each time you add a new hard drive to a RAID array the RAID driver will have to be installed under Windows once for Note that hard drive After that the driver will not have to be installed
37. ke sure that your case supports all the features required Secondly this motherboard supports one or two floppy diskette drives and two enhanced IDE drives Make sure that your case has sufficient power and space for all drives that you intend to install Most cases have a choice of I O templates in the rear panel Make sure that the I O template in the case matches the I O ports installed on the rear edge of the motherboard This motherboard carries an ATX form factor of 305 x 220 mm Choose a case that accommodates this form factor Installing the Motherboard in a Case Refer to the following illustration and instructions for installing the motherboard in a case Most system cases have mounting brackets installed in the case which correspond the holes in the motherboard Place the motherboard over the mounting brackets and secure the motherboard onto the mounting brackets with screws Ensure that your case has an I O template that supports the I O ports and expansion slots on your motherboard ys T Hi Bt amp E or a fut Bt B TE m d TA z HT3 0 AM2 i as 5 Es Ps Phenom CPU zy 1 lih ae TPS ee 1 BE W Pr ee Bea F H i o n or Bie S a a lt A oS Be 7 ee me y z W y Y Do not over tighten the screws as this can stress the motherboard Checking Jumper Settings This section explains how to set jumpers for correct configuration of the motherboard
38. key to access the BIOS Setup Utility CMOS Setup Utility Copyright C 1985 2007 American Megatrends Inc P Standard CMOS Setup Frequency Voltage Contral gt Advanced Setup Load Defaut Settings p Advanced Chipset Setup Superdsor Password gt integrated Peripuerais User Password Power Management Setup oave amp Eat Setup b POP Setup Ex Without Saving p PC Heath Saits flee Moe Enfer Seeet Har Value ESC Exit Fi ereral Helo v02 61 C Copyright 1985 2007 American Mega trends lnc BIOS Navigation Keys The BIOS navigation keys are listed below KEY FUNCTION Scrolls through the items on a menu PU PD Modifies the selected field s values Load a default optimized setting Saves the current configuration and exits setup Displays a screen that describes all key functions Updating the BIOS You can download and install updated BIOS for this motherboard from the manufacturer s Web site New BIOS provides support for new peripherals improvements in performance or fixes for known bugs Install new BIOS as follows If your motherboard has a BIOS protection jumper change the setting to allow BIOS flashing 2 If your motherboard has an item called Firmware Write Protect in Advanced BIOS features disable it Firmware Write Protect prevents BIOS from being overwritten J Create a bootable system disk Refer to Windows online help for information on creating a bootable system disk 4 Download the F
39. l ATA devices for the highest date transfer rates 3 0 Gb s simpler disk drive cabling and easier PC assembly It eliminates limitations of the current Parallel ATA interface But maintains register compatibility and software compatibility with Parallel ATA Pin Signal Name b Due to the limitation of NVIDIA chipset SATA 4 5 support AHCI RAID Mode only CD_IN Analog Audio Input connector Function CD In nght channel COM Onboard serial port header Connect a serial port extension bracket to this header to add a second serial port to your system Pin Signal Name Function 1 pepe Data Camer Detect UART B Serial Ona UART B Data Terminal Ready Cs ep jG Data Bet Ready 7 Emma RART E Request to Jend s S CTB Chansa S 9 s Fiar Connecting I O Devices The backplane of the motherboard has the following I O ports PS2 Mouse PS2 Keyboard VGA Port HDMI Port USB Ports eSATA Port A 2 LAN Port Audio Ports LAN port AB Ie o MG a F _ PS2 VGA port HDMI l keyboard USB eSATA USB ports port ports Use the upper PS 2 port to connect a PS 2 pointing device Use the lower PS 2 port to connect a PS 2 keyboard Connect your monitor to the VGA port Connect the HDMI port to the HDMI devices Use the USB ports to connect USB devices Use this port to connect to an external SATA box or a Serial ATA port multiplier It is suggested that users use the eSAT
40. lash Utility and new BIOS file from the manufacturer s Web site Copy these files to the system diskette you created in Step 3 5 Turn off your computer and insert the system diskette in your computer s diskette drive You might need to run the Setup Utility and change the boot priority items on the Advanced BIOS Features Setup page to force your computer to boot from the floppy diskette drive first 6 At the A prompt type the Flash Utility program name and the file name of the new bios and then press lt Enter gt Example AMINF340 EXE 040706 ROM 7 When the installation is complete remove the floppy diskette from the diskette drive and restart your computer If your motherboard has a Flash BIOS jumper reset the jumper to protect the newly installed BIOS from being overwritten The computer will restart automatically Using BIOS When you start the Setup Utility the main menu appears The main menu of the Setup Utility displays a list of the options that are available A highlight indicates which option is currently selected Use the cursor arrow keys to move the highlight to other options When an option is highlighted execute the option by pressing lt Enter gt Some options lead to pop up dialog boxes that prompt you to verify that you wish to execute that option Other options lead to dialog boxes that prompt you for information Some options marked with a triangle b lead to submenus that enable you to change the values for the o
41. m hardware is operating smoothly Boot Up Numlock Status ON This item defines if the keyboard Num Lock key is active when your system is started APIC Mode Enabled This item allows you to enable or disable the APCI Advanced Programmable Interrupt Controller mode APIC provides symmetric multi processing SMP for systems allowing support for up to 60 processors 1st 2nd 3rd Boot Device Hard Drive CD DVD 1st FLOPPY DRIVE Use this item to determine the device order the computer used to look for an operating system to load at start up time The devices showed here will be different depending on the exact devices installed on your motherboard Removable Drives Press Enter Scroll to this item and press lt Enter gt to view the following screen CMOS Setup Utility Copyright C 1985 2007 American Megatrends Inc Removable Drives Removable Ores 1m Drive Tet FLOPPY DRIVE species the Boot sequence fram the avalat cevces Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings Press lt Esc gt to return to the Advanced Setup page Boot Other Device Yes When enabled the system searches all other possible locations for an operating system if it fails to find one in the devices specified under the First Second and Third boot devices Press lt Esc gt to return to the main menu setting page Advanced Chipset Setup This page sets up more advanced information about your system
42. main menu Exit Without Saving Highlight this item and press lt Enter gt to discard any changes that you have made in the Setup Utility and exit the Setup Utility When the Exit Without Saving dialog box appears select OK to discard changes and exit or select Cancel to return to the main menu be you have made settings that you do not want to save use the Exit Without Saving item and select OK to discard any changes you have made This concludes Chapter 3 Refer to the next chapter for information on the software supplied with the motherboard Chapter 4 Using the Motherboard Software About the Software CD ROM The support software CD ROM that is included in the motherboard package contains all the drivers and utility programs needed to properly run the bundled products Below you can find a brief description of each software program and the location for your motherboard version More information on some programs is available in a README file located in the same directory as the software Before installing any software always inspect the folder for files named README TXT INSTALL TXT or something similar These files may contain important information that is not included in this manual 1 Never try to install all software from folder that is not specified for use with your motherboard 2 The notice of Intel HD audio installation optional The Intel High Definition audio functionality unexpectedly quits working in Window
43. n be between 4 KB and 128 KB 4 8 16 32 64 and 128 KB Assigning the Disks The disks that you enabled from the RAID Config BIOS setup page appear in the Free Disks block These are the drives that are available for use as RAID array disks To designate a free disk to be used as a RAID array disk 1 Tab to the Free Disks section The first disk in the list is selected 2 Move it from the Free Disks block to the Array Disks block by pressing the right arrow key gt The first disk in the list is moved and the next disk in the list is selected and ready to be moved 3 Continue pressing the right arrow key gt until all the disks that you want to use as RAID array disks appear in the Array Disks block Figure 2 9 illustrates the Define a New Array screen after two disks have been assigned as RAID1 array disks MediaShield Utility Define aNew Array Sn bold Mirroring si lapi us Optim Free Disks Array Disks Loc Disk Model Name Loc Disk Model Name F6 Back F7 Finish TAB Navigate Ha Select ENTER Popup Completing the RAID BIOS Setup 1 After assigning your RAID array disks press F7 The Clear disk array prompt appears MediaShield Utility Define a New Array Striping Block RAID Mode Mirroring Free Disks Array Disks Loc Disk Model Name zk Model Name Clear disk data Y YES N NO F6 Back FT Finish TAB Navigate pj Select ENTER Popup 2 Press Y to clear the disk data Th
44. ng the Motherboard Introduction Thank you for choosing the GF8200A motherboard This motherboard is a high performance enhanced function motherboard that supports socket for AMD Phenom processor socket AM2 AMD Athlon 64 X2 Dual Core Athlon 64 Sempron processors for high end business or personal desktop markets This motherboard is based on NVIDIA GeForce8200 MCP78S Premium media and communications processor MCP for best desktop platform solution GeForce8200 is a single chip highly integrated high performance HyperTransport peripheral controller unmatched by any other single chip device controller The memory controller supports DDR2 memory DIMM frequencies of 10661 AM2 800 667 533 400 It supports four DDR2 sockets with maximum memory size of 32 GB 2 High resolution graphics via one PCI Express x16 slot two PCI Express x1 slots 12 USB 2 0 ports 6 USB ports and 3 USB 2 0 headers support additional 6 USB ports and SATA support with RAID function There is an advanced full set of I O ports in the rear panel including PS 2 mouse and keyboard connectors one VGA port one HDMI port one eSATA port six USB ports one LAN port and audio jacks for microphone line in and 6 8 ch optional line out This motherboard is designed in an ATX form factor using a four layer printed circuit board and measures 305 mm x 220 mm b 1 Due to the limitation of AMD CPU spec please refer to Memory QVL for more information 2 Due
45. ngs CPU SMART FAN Control Enabled This item allows you to enable or disable the control of the CPU fan speed by changing the CPU temperature Press lt Esc gt to return to the PC Health Status page ShutDown Temperature Disabled Enable you to set the maximum temperature the system can reach before powering down System Component Characteristics These items display the monitoring of the overall inboard hardware health events such as System amp CPU temperature CPU amp DIMM voltage CPU amp system fan speed etc Vcore e VDIMM e VNB e VHT e CPU FAN Speed e SYS FAN Speed e CPU Temperature e SYS Temperature Press lt Esc gt to return to the main menu setting page Frequency Voltage Control This page enables you to set the clock speed and system bus for your system The clock speed and system bus are determined by the kind of processor you have installed in your system CMOS Setup Utility Copyright C 1985 2007 American Megatrends Inc Frequency Voltage Control Auto Detect DIMMIPCI CIK CPLVLOT Spread Spectrum PC Spread Spectum Options Memory vollage NB Voltage HT Voltage CPU Voltage Danie Enabled CPU Frequency MHz Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings Auto Detect DIMM PCI Clk Enabled When this item is enabled BIOS will disable the clock signal of free DIMM PCI slots CPU LDT Spread Spectrum Enabled If you enable spread
46. nize colors Adjust screen resolution Clock Language and Region Change keyboards or other input methods Chanoe display language Ease of Access Let Windows suggest settings Optirrize visual display Additional Options Text to Speech g Windows Windows Sidebar Make changes to your user account Create a password for your account Change your picture Change your account name Change your account type P Manage another account Turn User Account Control on ot oft SideShow Update 5 Disable User Account Control UAC to help protect your computer item and press OK then press Restart Now Then you can restart your computer and continue to install drivers without running blocked programs fe NG lt User Accounts v Tum User Account Control On oe Off Turn on User Account Control UAC to make your computer more secure User Account Control UAC can help prevent unauthorized changes to your computer We recommend that you leave UAC tumed on to help protect your computer Use User Account Control UAC to help protect your computer Manual Installation Insert the CD in the CD ROM drive and locate the PATH DOC file in the root directory This file contains the information needed to locate the drivers for your motherboard Look for the chipset and motherboard model then browse to the directory and path to begin installing the drivers Most drivers have a setup program SETUP EXE that au
47. off with a software command If you enable this item the system can automatically resume if there is an incoming call on the PCI Modem or PCI LAN card You must use an ATX power supply in order to use this feature Use this item to do wake up action if inserting the PCI card Resume By PS2 KB S3 Disabled This item enables or disables you to allow keyboard activity to awaken the system from S3 mode Resume By PS2 MS S3 Disabled This item enables or disables you to allow mouse activity to awaken the system from S3 mode Resume By USB S3 Disabled This item allows you to enable disable the USB device wakeup function from S3 mode Resume on RTC Alarm Disabled The system can be turned off with a software command If you enable this item the system can automatically resume at a fixed time based on the system s RTC realtime clock Use the items below this one to set the date and time of the wake up alarm You must use an ATX power supply in order to use this feature Press lt Esc gt to return to the main menu setting page PCI PnP Setup This page sets up some parameters for devices installed on the PCI bus and those utilizing the system plug and play capability CMOS Setup Utility Copyright C 1985 2007 American Megatrends inc PCI PnP Setup IGPU and Ext VGA Selection Single e init Display First Pcl Select Inemal VGA or External VSA CARD to display H Mee Enier Salect ralue Fiksa ESC Ext Fi General
48. ption Use the cursor arrow keys to scroll through the items in the submenu In this manual default values are enclosed in parenthesis Submenu items are denoted by a triangle b Standard CMOS Setup This option displays basic information about your system CMOS Setup Utility Copyright C 1985 2007 American Megatrends Inc Standard CMOS Setup Date Time t Primary IDE Master t Primary IDE Slave IDE BusMaster Drive A Tue 0210008 Melo Itam 00 06 54 User Enter TAE or SHIFT TAB to sajeg 3 Nek Not Detected Not Detected Enabled 1 44 MB 314 configure system Dale Lise orj to Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings Date amp Time The Date and Time items show the current date and time on the computer If you are running a Windows OS these items are automatically updated whenever you make changes to the Windows Date and Time Properties utility Primary IDE Master Slave Your computer has one IDE channel which can be installed with one or two devices Master and Slave In addition this motherboard supports five SATA channels and each channel allows one SATA device to be installed Use these items to configure each device on the IDE channel CMOS SETUP UTILITY Copyright C 1985 2007 American Megatrends Inc Primary IDE Master Primary IDE Master Device Not Detected Type LEA Large Mode Block Mode PIO Mode DMA Mode s MALE T
49. qa 9 Connecting Case Componenhis u aa aaa ng aaa Naah akan aaa wa gk 10 WOM Vanel ICAO CF ua au AN A a na SA A usus 12 TVG Hi TAU ANG a gara aaa naa a a E GAE a BE DAK DE BAE KENE Ba 13 Insialhing the PT OCESS OF As uqa as ag a aa a a A ANAA GA aa ag a ab ab gan a 13 TASI NG Memory Module kaga na aaa ga a Aa aa ag a KAE Ba E A Ra gi Da BA Aa aaa a ga pah 14 Installing a Hard Disk Drive CD ROM SATA Hard Drive 18 Installing a Floppy Diskette Drive 19 pisq raq b COIS u aa aa aa a AGA AAN BG A EN PK AN BE KA BA A a aa a WAN 20 Conniecnns Optional Daya u unas in aia ka aaa aken walaa nd aaa aa aa aa ad aa a 22 Connectne VO DEVICES jina sane yaa usa ans NGNE engi KANA qsayhianakasqshaqshapabakawsuspa tence 2 Chapter 3 Using BIUS About the Setup Uliliy u uu raga ya dapak yaan daana rebin 27 The Standard Configuration 2 Entering the Setup Unity usecase cane aga ieee a at aka a a aa aaa ada O TC TI OD AEA EEE a KEN NAN a NE an E A ab E pasa 29 WISAN BIO aes aa aaa an aaa a aaa naa aa a ng aka ap Na a a aaa a a a a aaa a 29 DIGANTOS SOUD aaa a Bah aa AN Sa A AB a A a BA BA NE AA NA A a WA a AA a a AE Na a ga Ah 30 pana a SEND MA sce NE EP NENG E rE BG EE E PEPEN GE Cp SCID aa anga nman E E ABA ag a AB ga KA NAK TE A PA Aa 33 Tilia PEKING KOS sk an aa a KN Ka KAKE a JA BEA a JA NA 35
50. s Server 2003 Service Pack I or Windows XP Professional x64 Edition Users need to download and install the update packages from the Microsoft Download Center before installing HD audio driver bundled in the Driver CD Please log on to http support microsoft com default aspx scid kb en us 901 105 appliesto for more information Auto installing under Windows XP Vista The Auto install CD ROM makes it easy for you to install the drivers and software for your motherboard o If the Auto install CD ROM does not work on your system you can still install drivers through the file manager for your OS for example Windows Explorer Refer to the Utility Folder Installation Notes later in this chapter The support software CD ROM disc loads automatically under Windows XP Vista When you insert the CD ROM disc in the CD ROM drive the autorun feature will automatically bring up the install screen The screen has three buttons on it Setup Browse CD and Exit PNY Software Installation CU EE Install Chipset Drivers Install LAN Drivers Install RAID Drivers Install Sound Drivers View User Guides Contact PNY Exit CO Setup Tab Setup Click the Setup button to run the software installation program Select from the menu which software you want to mstall Browse CD The Browse CD button is the standard Windows command that allows you to open Windows Explorer and show the contents of the suppert CD Before installing t
51. sabled Disabled Enabled Disabled Auto Aya lt lt Move Enter Select PU PD Value Fi0 Save ESC Exit F1 General Help F5 Previous Values 6 Fall Sale Defaults FT Optimized Defaults Figure 2 6 Integrated Peripherals Screen 3 Use the arrow keys to select the RAID Config see Figure 2 6 4 Press Enter The RAID Config window appears Phoenix Award BIOS CMOS Setup Utility RAID Config RAID Enable Enable Item Help SATA 1 Primary RAID Enabled SATA 1 Secondary RAID Enabled Menu Level SATA 2 Primary RAID Enabled SATA 2 Secondary RAID Disabled A gt Move Enter Select PU PD Value F10 Save ESC Exit Fi General Help F5 Previous Values FB Fail Safe Defaults FT Optimized Defaults Figure 2 7 RAID Config Screen 5 From the RAID Config window globally enable RAID then enable the SATA ports with disks that you want to use for RAID If RAID is enabled globally but not enabled on the individual SATA port disks on that port can only be used for non RAID applications In the example in Figure 2 7 three SATA ports are enabled so the non bootable RAID array can include up to 3 SATA disks If there is a disk Connected to SATA 2 Secondary it can not be used for RAID 6 Press F10 to save the configuration and exit The PC reboots 7 Enter the RAID BIOS Setup by pressing F10 when prompted and proceed to set up the NVIDIA RAID BIOS as described in the next section Configuring the NVIDIA RAID BIOS T
52. spectrum it can significantly reduce the EMI Electro Magnetic Interference generated by CPU LDT PCI Spread Spectrum Enabled If you enable spread spectrum it can significantly reduce the EMI Electro Magnetic Interference generated by PCI Memory Voltage 1 90V This item allows users to adjust the DDR memory voltage NB Voltage 1 13V This item allows users to adjust the Northbridge voltage HT Voltage 1 20V This item allows users to adjust the HyperTransport voltage CPU Voltage Disabled This item allows users to adjust the CPU voltage CPU Frequency MHz 200 This item indicates the current CPU frequency Users can not make any change to this item Please noted that the frequency will be varied with different CPU Press lt Esc gt to return to the main menu setting page Load Default Settings This option opens a dialog box to ask if you are sure to install optimized defaults or not You select OK and then lt Enter gt the Setup Utility loads all default values or select Cancel and then lt Enter gt the Setup Utility does not load default values Supervisor Password This page helps you install or change a password CMOS Setup Utility Copyright C 1985 2007 American Megatrends Inc Supervisor Password supervisor Password ot Inetalec Change Superibor Password Prass Emer netall o Change ihe Das WON Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default se
53. tected Not Oetected Not Detected Not Detected Some SATA COMODO In ARC mode need to walt ready longer H Move Enter Select 4 Valle FD Sawe Bc Ext Fi General Help Press lt Esc gt to return to the Integrated Peripherals page FS Load Default settings OnBoard AUDIO Function Enabled Use this item to enable or disable the onboard Audio function OnBoard LAN Function Enabled Use this item to enable or disable the onboard LAN function OnBoard LAN Boot ROM Disabled Use this item to enable or disable the booting from the onboard LAN or a network add in card with a remote boot ROM installed Serial Port1 Address 3F8 IRQ4 Use this item to enable or disable the onboard COM1 serial port and to assign a port address OnBoard IR Disabled Use this item to enable or disable the onboard infrared port and to assign a port address USB Controller Enabled Use this item to enable or disable the USB function Legacy USB Support Enabled Use this item to enable or disable support for legacy USB devices Press lt Esc gt to return to the main menu setting page Power Management Setup This page sets up some parameters for system power management operation CMOS Setup Utility Copyright C 1285 2007 American Megatrends Inc Power Ranagement Setup ACA Suspend Type a3 Sato by PWR STTN Instant Of PWRON After PYVR Fall Power Oe SHE Ne ACHI Resume by RING Disabled siale used Tor Resume By PCIPCHE Lan PME
54. th the instructions may cause harmful interference to radio communications However there is no guarantee that interference will not occur in a particular installation If this equipment does cause harmful interference to radio or television reception which can be determined by turning the equipment off and on the user is encouraged to try to correct the interference by one or more of the following measures Reorient or relocate the receiving antenna Increase the separation between the equipment and the receiver Connect the equipment onto an outlet on a circuit different from that to which the receiver is connected Consult the dealer or an experienced radio TV technician for help Shielded interconnect cables and a shielded AC power cable must be employed with this equipment to ensure compliance with the pertinent RF emission limits governing this device Changes or modifications not expressly approved by the system s manufacturer could void the user s authority to operate the equipment operation Declaration of Conformity This device complies with part 15 of the FCC rules Operation is subject to the following conditions This device may not cause harmtlul interference and This device must accept any interference received including interference that may cause undesired Canadian Department of Communications This class B digital apparatus meets all requirements of the Canadian Interference causing Equipment Ree
55. to 8 GB per DIMM with maximum memory size up to 32 GB Audio Optional The onboard Audio provides either of the following features 5 1 Channel High Definition Audio Codec DACs Support 96K 48K 44 1KHz DAC sample rate Power support Digital 3 3V Analog 5 0V WOW and True Surround from SRS Provides single ended CD input with DRM solutions and legacy OS issues 7 1 Channel High Definition Audio Codec SPDIF In Out supports 96K 48K 44 1KHz plus SPDIF OUT supports 88 2 KHz Power support Digital 3 3V Analog 5 0V MAxx Player from Waves Provides single ended CD input with DRM solutions and legacy OS issues Onboard LAN Optional The onboard LAN provides either of the following features Integrated Gigabit Ethernet Controller for PCI Express Applications Integrated 10 100 1000 transceiver VYake On LAN and remote wake up support Integrated Fast Ethernet Controller for PCI Express Applications Integrated 10 100 transceiver VYake On LAN and remote wake up support Expansion Options The motherboard comes with the following expansion options e One PCI Express x16 slot for Graphics Interface e Two PCI Express x1 slots Three 32 bit PCI v2 3 compliant slots e One IDE connector supporting up to two IDE devices e One floppy disk drive interface e Five 7 pin SATA connectors This motherboard supports Ultra DMA bus mastering with transfer rates of 133 100 66 33 Mb s Integrated I O The motherboard has a full s
56. tomatically detects your operating system before installation Other drivers have the setup program located in the operating system subfolder If the driver you want to install does not have a setup program browse to the operating system subfolder and locate the readme text file README TXT or README DOC for information on installing the driver or software for your operating system Utility Software Reference All the utility software available from this page is Windows compliant They are provided only for the convenience of the customer The following software is furnished under license and may only be used or copied in accordance with the terms of the license Ly 1 These software s are subject to change at anytime without prior notice Please refer to the support CD for available software 2 Please go to ECS website to download AMD Cool n Quiet technology Chapter 5 Setting Up NVIDIA RAID Configuration Setting Up a Non Bootable RAID Array RAID arrays can be created deleted using both MediaShield RAID BIOS and the MediaShield RAID Manager from Windows This section only covers basic BIOS setup required for non bootable array See the section Setting Up a Bootable RAID Array for instructions on configuring the RAID array in BIOS See sections on using the MediaShield RAID Manager for details on configuring non bootable RAID from Windows Setting Up the BIOS 1 Start your computer then press Delete to enter the BIOS setup The
57. ttings Supervisor Password Not Installed This item indicates whether a supervisor password has been set If the password has been installed Installed displays If not Not Installed displays Change Supervisor Password Press Enter You can select this option and press lt Enter gt to access the sub menu You can use the sub menu to change the supervisor password Press lt Esc gt to return to the main menu setting page User Password This page helps you install or change a password CMOS Setup Utility Copyright C 1985 2007 American Megatrends Inc User Password Jeer Passwort Mot inetal ea Help tem Change Hesr Password Press Ember Install or Change the password Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings User Password Not Installed This item indicates whether a user password has been set If the password has been installed nstalled displays If not Not Installed displays Change User Password Press Enter You can select this option and press lt Enter gt to access the sub menu You can use the sub menu to change the user password Press lt Esc gt to return to the main menu setting page Save amp Exit Setup Highlight this item and press lt Enter gt to save the changes that you have made in the Setup Utility and exit the Setup Utility When the Save and Exit dialog box appears select OK to save and exit or select Cancel to return to the
58. ulations Cet appareil num rique de la classe B respecte toutes les exigences du R glement sur le mat riel brouilieur du Canada About the Manual The manual consists of the following Chapter 1 Introducing the Motherboard Chapter lt Installing the Motherboard Chapter 3 Using BIOS Chapter 4 Using the Motherboard Software Chapter 5 Setting Up NVIDIA RAID Configuration Describes features of the motherboard Goto Pagel Describes installation of motherboard components Goto Page 7 Provides information on using the BIOS Setup Utility Goto Page 27 Describes the motherboard software Goto Page 45 Provides information about SATA RAID Setup Goto Page 51 TABLE OF CONTENTS Chapter 1 Introducing the Motherboard ili i ON e E m SSS S ak rate 1 li S aaa pa arose E E a GA EN Na GE E kaa a ang A a aa ai 2 Motherboard Components 4 Chapter 2 Installing the Motherboard CL PE Wm 2 a GEGE S E a gg a maana Aa A gaga ai 7 Choosing a Computer Case dsp aaa ag kaa ag gana pa aaa aa anawa 7 Installing the Motherboard in a Case 7 C hochino Jamper SCE s uuu u Ba E aa aqu E Dia aan ae Bag aane 8 T ST 5 aaa aaa Oe T ee ee eee ee a aan a aa ad aa CHECKING JUINDCT SCIINGS ic s sua siasa apenstuphukuqawkaqpanwpayiuaqaaikaqepakuyak 9 J ipa s i NIIE PE aa ag aana aaa an Bala a aaa a ayayasqa yu

PNY GeForce 8200 Motherboard User Guide

Contents

Download Pdf Manuals

Related Search

Related Contents