2 - Moxa
Contents
1. c Disk Management b MOXA Embedded Drivers p Bs Services and Applications a iu Network adapters 2 menl Lu Qualcomm Atheros AR9580 Wireless Network Adapter E Realtek PCIe GBE Family Controller 2 Realtek PCIe OBE Family Controller 2 p Ports COM amp LPT n Processors b EP Ramdisk gt x Sound video and game controllers b Storage controllers b gill System devices E r Universal Serial Bus controllers V2201 Series Windows Software Module Card I nstalling the Cellular Module Dial Utility 1 Run driver x64 7 Modules MC 9090 Build4260 Skylight64 Generic msi to begin installation and then click Next Welcome to the InstallShield Wizard for Sierra Wireless Skylight Build 4260 The InstallShield R Wizard will install Sierra Wireless Skylight on your computer To continue dick Next WARNING This program is protected by copyright law and international treaties 2 Check I accept the terms in the license agreement and then click Next 5 te Sierra Wireless Skylight License Agreement Wa SIERRA Mazs Please read the following license agreement carefully bn WIRELESS End User License Agreement ATTENTION Please carefully read this Agreement By selecting Agree or accept the terms in the license agreement and or installing activating and or using this Software YOU indicate that YOU have read understood and accepted the provisions of this Agreement and tha2. 1 gt Display DIN 2 gt Display DOUT 3 gt Set DOUT value t4 Display both DIH and DOUT H 1 1 1 Dout Douti Dout Dout Mode Test Program CH Exit Program 1 gt Display DIH 2 Display DOUT 3 gt Set DOUT value 4 gt Display both DIH and DOUT 5 4 V2201 Series Windows Software Examples Watchdog l Copy the following files from the software CD DVD to a folder on the V2201 e mxdwg dll examples V2201 W7E example 3 lib mxdwg x64 e mxGenerall o dll examples V2201 W7E example 3 lib MxGenerall o x64 e Watchdog exe examples V2201 W 7E example Release x64 2 To prevent the system from rebooting press Enter at least once every 10 seconds otherwise the system will reboot automatically DAProject w2201example 6 Watchdog WatchdogExample exe ENTER Seconds to exit ENTER Seconds to exit ENTER i Seconds to exit EHTER i Seconds to exit EHTER i Seconds to exit ENTER i Seconds to exit ENTER i Seconds to exit EHTER i Seconds to exit EHTER i Seconds to exit 0 m LI Ln m 0 0 D Pr Pr Pr Pr Pre Pr Pr Pr Pr HSM eU m SM m EH ewe ewes eee 0 3 To stop the watchdog press q to exit the program LED In this section we illustrate how to use the test utility to display and set LED values l Copy the following files from the product software DVD e mxgpio dll examples V2201 W7E exam
3. Choose a user name for your account Your computer s name is managed by your organization s system administrator Type a user name for example John Copyright 2010 Microsoft Corporation All rights reserved Net 2 2 V2201 Series Windows Software System Initialization 2 Type a password and retype the password to confirm You may also type a password hint that you can refer to if you forget your password If you do not want to set a password leave all three fields blank Click Next to continue x Set Up Windows Set a password for your account Creating a password is a smart security precaution that helps protect your user account from unwanted users Be sure to remember your password or keep it in a safe place Type a password recommended Retype your password Type a password hint Choose a word or phrase that helps you remember your password If you forget your password Windows will show you your hint 3 Select a Windows update option o Set Up Windows Help protect your computer and improve Windows automatically Use recommended settings Install important and recommended updates help make Internet browsing safer check online for solutions to problems and help Microsoft improve Windows Install important updates only Only install security updates and other important updates for Windows x Ask me later Until you decide your computer might be vulnerable to security
4. File Based Write Filter Configuration Exclusion List Cache Content Volume name Ce WZ2406WES7 FBWFManagementTool Oper aaa MM a UD VU E GT ee oo W2406WES _FBWFManagementTool_Oper WZ406WES57 FBWFManagementTool Oper MW 2406WES7 FBWFManagementTool Oper WZ406WES7 FBWFManagementTool Oper 4 W2406WES _FBWFManagementTool_Oper 4W2406WES57 FBWFManagementTool Oper M 2406WES57 FBWFManagementTool Oper 4 n Add to exclusion list For more details about FBWF configuration and usage refer to the Microsoft help file that came with your computer or go to the following websites Microsoft s FBWF Installation and Configuration help pages Microsoft s FBWF overview on the official Microsoft FBWF help pages Microsoft s detailed description of FBWF features on the FBWF help pages Microsoft s detailed description of the FBWF API 4 11 2 Examples This chapter provides examples to illustrate how to use the V2201 computer for a variety of applications The following topics are covered in this chapter Serial I nterface Digital I nput Output Watchdog LED Power Control OQd0Q0Q06aeju Uu Power Reset V2201 Series Windows Software Examples Serial Interface l Copy the following files from the software CD DVD to a folder on the V2201 mxsp dll examples V2201 W7E example 3 lib mxsp x64 sysinfo dll examples V2201 W7E example 3 lib mxsp x64 sysinfo sys
5. By selecting Agree or accept the terms in the license agreement and or installing activating and or using this Software YOU indicate that YOU have read understood and accepted the provisions of this Agreement and that YOU have the authority to enter into this Agreement on your own behalf or on behalf of the entity that you represent Ift YOU do not accept or agree to these provisions or do not have the If you accept the terms of the agreement click I Agree to continue You must accept the agreement to install Mobile Broadband Driver Package V2201 Series Windows Software Module Card 3 Click Finish to complete installation Pa Mobile Broadband Driver Package V6 4 4208 0003 Completing the Mobile Broadband Driver Package Setup Mobile Broadband Driver Package has been installed on your computer Click Finish to dose Setup BS SIERRA WIRELESS 4 The system should locate the new hardware and install the driver automatically Check Windows Device Manager to verify i Oar C a Lomput Mai lagi ent Ele Action View Help EN Computer Management Local a il System Tools d E MOXA GIGPSLFSEQ b jf Computer D Task Scheduler D mg Disk drives b BH Event Viewer b A Display adapters gt Ga Shared Folders b 3 Human Interface Devices b amp Local Users and Groups gt ES Keyboards b amp i Performance p f Mice and other pointing devices a Device Manager fis Storage
6. Atheros R LZ Ethernet Driver version 2 2 3 6924301 Copyright c 2007 Atheros Corporation 7767701 Broadcom NetXtreme II 5771x 10Gigabit Ethernet Driver bnx2x 1 62 00 6 2011 01 30 39140141 BGtrfs loaded 955475 deuice mapper ueuent version 1 0 3 96140 device mapper ioctl 4 19 1 1octl 2011 01 07 initialised dm devel redhat com cry cn un gg Salida on eo Running scripts init premount done Mounting root file system I 6 1789461 Uniform Multi Platform E IDE driver 6 186189 ide generic please use probe mask 0x3f module parameter for probing all legacy ISA IDE ports 6 913744 FAT utf8 is not a recommended IO charset for FAT filesystems filesystem will be cas e sensitive 047997 aufs module is from the staging directory the quality is unknown you haue been war ied 7 072516 aufs 2 1 standalone tree 36 rcN 20110228 Jegin Running scripts live premount done 2 13433 loop module loaded 7 909770 squashfs version 4 0 2009 01 31 Phillip Lougher egin Running scripts live realpremount done Begin Mounting live image live filesystem squashfs on filesystem squashfs via deu loopO0 done one Jegin Running scripts live botton Begin Configuring fstab done egin Preconfiguring networking done egin Loading preseed file done egin Running scripts init bottom done INIT version 2 88 booting Ising makefile style c
7. Ls Computer az Local Disk C e NEW VOLUME E th Network T 4 T E os image Date modified 6 15 2014 5 58 PM File folder Step 2 Set the BI OS to Boot via USB This step shows you how to reset the BIOS so the system can boot directly from the USB port You must perform this action before you can continue to configure the system recovery environment 1 Reboot the system and during the POST process press F2 until you hear a long beep Click SCU to enter the BIOS setup menu Boot From File 2 Usethe left and right arrow keys to navigate to the Boot menu 7 4 V2201 Series Windows Software System Recovery 3 Use the up and down arrow keys to navigate to the Legacy link then press Enter Hain Advanced Security Power gt Legacy F5 F6 Enter 4 Normal Boot Menu Boot Type Order iFHard Disk Dr IKUSEB F5 F6 Enter 7 5 V2201 Series Windows Software System Recovery 5 Usethe up and down arrow keys to navigate to the USB link then use the plus or minus key to move USB to the top of boot priority list F5 F6 Enter 6 Press F10 and Enter to save and exit the BIOS configuration interface This sets the system to reboot from the hard drive Step 3 Performing a System Recovery This step describes how to perform a system recovery We include this as step 3 of the installation so administrators can first perform a test run before deploying the system to the field To begi
8. Skip running partclon ntfsfixboot Mose es xo eoe poe x oe exo poe ose eoe poe EREEREER oe xo eee oe ose ee nd of restoreparts job for image os image nd of restoredisk job for image os image O N n o J J ta rm rn EE T t MORE E SKK E Halim if les have to be restored his program is not started by Clonezilla server so skip notifying it the job is done inished Yow syncing flush filesystem buffers nding usr sbin ocs sr at 2015 11 01 10 52 17 UTC Check var log clonezilla log for more details ound ocs_postrun parameter in boot parameters he order to run acs pastruni spese ee eee ee ke ee ee ou run oacs postruni sudo lib live mount medium live restore_postrun sh y n ARGET_DEVICE dev sda device _count 1 io you want to resize filesystem y n V2201 Series Windows Software System Recovery 4 Choose one of the following options and press Enter to continue reboot reboot the system access the console terminal restart the entire procedure Choose mode Now you can choose to poweroff Powerott Reboot Enter command line reruni Start aver image repository home partimag if mounted will be umounted rerun Start_over_ keep_image_repository_ home part imag_mounted lt Ok gt Step 4 Resetting the BIOS Reset the boot priority to the factory default settings to allow the system to boot from the main system storage drive This is done for two reason
9. examples V2201 W7E example 3 lib mxsp x64 sysinfoX64 sys examples V2201 W7E example 3 lib mxsp x64 mxGenerall o dll examples V2201 W7E example 3 lib MxGenerall oVx64 UartMode exe examples V2201 W7E example Release x64 2 Execute UartMode exe DProjpect w2201 example 1 uart UartMode exe Serial Interface Test Program CH Exit Program 1 gt Display Serial Interface 2 gt Set Serial Interface 3 Type 2 to set the serial interface and then follow the on screen instructions DAP ropect w2201 example l uart UartMode exe Serial Interface Test Program CH Exit Program 1 gt Display Serial Interface 2 Set Serial Interface 2 Input the Port Humber 451 25 i Input the value CH RS485 2W 1 H5422 2 H8232 Set serial interface success Serial Interface Test Program CH Exit Program 1 gt Display Serial Interface 2 Set Serial Interface 5 2 V2201 Series Windows Software Examples 4 Type 1 to display the current serial interface settings DXProjectiv2201 example uartartMode exe Serial Interface Test Program CH Exit Program 1 gt Display Serial Interface C2 Set Serial Interface R 465 2 RS 232 Interface Test Program CH Exit Program 1 gt Display Serial Interface c2 gt Set Serial Interface Digital I nput Output l Copy the following files from the software CD DVD to a folder on the V2201 e mxdgio dll examples V2201 W7E example 3 lib mx
10. n link O n link O n link O n link O n link O n link O n link O n link O n link O n link O n link O n link O n link O n link O n link O n link n link 127 8 8 1 127 8 8 1 127 8 8 1 192 163 8 6 192 1638 8 6 192 168 11 127 192 168 11 127 192 166 111 127 127 8 8 1 192 166 180 127 192 168 11 127 192 163 8 6 1HH 73 239 1 79 127 8 8 1 192 168 180 127 1 2 168 1i 1i27 192 163 8 6 1HH 73 239 1 79 V2201 Series Windows Software Module Card 5 f you want to change to using cellular as the connection interface just reduce the Metric value of the cellular interface so that the value is less than the WiFi s Metric value Administrator C Wi de vs IG Xlsers moxa route change 0 0 0 0 mask 0 0 0 0 1660 73 239 177 metric 2H OK CoNUsers moxa gt _ 6 13 7 System Recovery This chapter describes the system recovery process that you can perform if the system is not functioning properly The following topics are covered in this chapter O Overview O Setting Up the Recovery Environment O Setting Up a Factory Default Recovery I mage gt Step 1 Prepare the USB drive Step 2 Setting the BIOS to Boot via USB Step 3 How to Perform a System Recovery Step 4 Reset the BIOS to its Original State O Creating a Custom System I mage V2201 Series Windows Software System Recovery Overview This section describes how to prepare your computer f
11. Networks Sincere S lene oS th o 2 4 3 Configuring the Serial I nterface This chapter describes how to configure the serial interface on the V2201 embedded computer The following topics are covered in this chapter O Overview O Configuring the Serial Interface Mode V2201 Series Windows Software Overview The V2201 supports the following serial modes RS 232 RS 485 2 wire and RS 422 485 4 wire These modes can be configured on COM1 and COM2 Configuring the Serial I nterface Configuring the Serial Interface Mode Complete the following steps to configure the serial interface mode L P Default Programs ak Desktop Gadget Gallery E Internet Explorer 64 bit E Internet Explorer e Windows Update XPS Viewer di Accessories di Games di Maintenance di Moxa E mxSetSeriallnterface di Startup di Subsystem for UNIX based Applications bk cnc Documents Pictures Music Games Computer Control Panel Devices and Printers Default Programs Help and Support 3 2 From the Start menu Click All Programs gt Moxa gt mxSetSeriall nterface V2201 Series Windows Software Configuring the Serial I nterface 3 Select the serial interface mode for the port from the Mode drop down box R5485 2 wires R5422 R5485 4 wires O R5232 4 Click OK Mode 3 3 4 Enabling Embedded Filters In this chapter we describe how to enable the V2201 s
12. State Hedia disconnected Connection specific DHS Suffix ThermaLah Tunnel adapter isatap iC7Hf 44CE 5A4BBH ADF5 h2H9 1504FP5EC92CBD Media State Media disconnected Connect ion specif ic DNS Suffix n Tunnel adapter 6TO4 Adapter Connection specific DHS Suffix IPu6 Address 2 2682 76449 ef bd 76449 ef ho Default Gateway a n C Users moxa gt 6 11 V2201 Series Windows Software Module Card 4 Windows 7 will choose the lowest Metric value for the connection interface if there are several routes with the same network destination and netmask In this case the WiFi interface is the connection interface Ee Administrator CAWindowsVsystems2 vem oc es qos Packets Sent 4 Received A Lost 4 ci z loss CoNUsers moxa route print Sierra Wireless Mobile Broadband Metwork Adapter Qualcomm Atheros AR586 Wireless Network Adapter Realtek PCIe GBE Family Controller 2 Realtek PCIe GBE Family Controller Software Loopback Interface 1 Microsoft ISATAP Adapter Microsoft ISATAP Adapter 2 Teredo Tunneling Pseudo Interface Microsoft ISATAP Adapter 3 Microsoft ISATAP Adapter 4 Microsoft 6to4 Adapter Active Routes Network Destination 4 4 0 8 4 4 0 8 108 73 239 176 168 73 239 179 168 73 239 183 Interface Metric 166 73 239 179 192 168 0 6 100 773 239 179 166 73 239 179 1HH 73 239 1 79 Hetmazsk 4 6 6 8 4 8 0 8 255 2
13. a drive volume from the drop down list Enabling Embedded Filters Add path click the ellipsis button to select a directory or file you want to exclude from FBWF protection then click the button The system displays the selected directory or file in the Path table File Based Write Filte PS Exclusion List Cache Content Program Files CMAK cmak exe Exduded after reboot Add path Program Files CMAK mak exe m 4 9 V2201 Series Windows Software Enabling Embedded Filters 4 Click the Cache Content tab and click Apply and OK Configuration Excusion ist Cache Content Volume name Path Cache size netpub temp appPools APC2F 78 tmp 72 0 KB lIProgramData Micro SystemIndex 1 Crwl 4 00 KB ProgramData Micro SystemIndex 1 gthr 4 00 KB ProgramData Microsoft Search MSS chk 8 00 KB ProgramData Microsoft Search M55 log 8 00 KB ProgramData Microsoft Se Windows edb 512 KB ProgramData Microsoft Search tmp edb 8 06 MB Windows bootstat dat 4 00 KB Windows inf setupapi dev log 56 0 KB Windowstprefetch AgGlFaultHistor y db 4 00 KB Add to exdusion list Restore 5 Reboot the system to make the changes take effect Managing Temporary Files Cached in the Overlay 1 On the Cached Content tab you will see all the files currently cached in the RAM overlay Three commands are available e Commit Save a file from the cache to permanent storage delete the
14. cece ener mmm mme hme sers 6 4 Cellular Module Conhiquratiofwwiw s 6 6 Installing the WiFi Module Driver for the WPEA 252NI ccccccccee cece eee ee eee eee hme nnns 6 7 VIE MOdUIe CONfiOURAUONi uu xaqse acelin aioe saan eee c n dant cao enden dua dgnadd MM ISIN D EE cdd IG P re dH Sa TR RA 6 9 Choosing the Gateway when WiFi and Cellular are Connected at the Same TIME cccceeeeeeee sees eeeeeees 6 11 Z System RECOVERY ssusssssssEaseE EE MERERI EE RI RUE BIER UR EUR ERE EE RE ERE RENE EMEN REFER ERE ERE EE SERRE NR 7 1 OVEIVICW a dE ARR RERO INA IURE IM Mx M MM MM MM LM Mx 7 2 Setting Jp the Recovery EnVironMent nieuwe Coen er Gee rep Co oe en Sr be epe ve pepe e pep C OR eR SE OE e EAE EU A EbO AE Ma 7 2 Setting Up a Factory Default Recovery Image isssssssssssseesseee nee nemen EE Eee DEES harenas 7 2 Step Preparing the sb seoresorihatobe ehe she Ye us valve be va vals vee Valen voles ava bales atate atat esa Noa Eo a N R 7 2 Step 23 Seb The BIOS to BOOK vid USB cro eo Roa a Bu RR E Rat atat x me aa m REN eU 7 4 Step 3 Performing a System Recovery cccccc cece eee eee eee ene EEE een EEE EE EES DEE a aaa arn aan aan nnn 7 6 Step 4 Resetting The BIOS 4 oor eerie Que CEU ee A S QR EE GE DEAE EE a AE EE UU OU CEUC oon es 7 12 Creating a Custom System HD aO B ea S ORE RD ON UD UD JE IS AED D DUE RED Eee eae eee exe eee 7 14 8 Proactive MONITORING iisccecesevesVsUEESRRRUMEEERRFIFEKEEERSKPVIREERREFFEDEEREKUKKKE
15. embedded filters The following topics are covered in this chapter O Enhanced Write Filter gt Overview gt Enabling Enhanced Write Filter gt Committing Data and or Disabling EWF O File Based Write Filter gt Configuring File Based Write Filter gt Excluding Files from FBWF Protection gt Managing Temporary Files Cached in the Overlay V2201 Series Windows Software Enabling Embedded Filters Enhanced Write Filter Overview Enhanced Write Filter EWF enables you to protect a volume from unauthorized writes by making the main operating system OS drive a write protected volume effectively making the system a read only system for most users This provides much stronger protection against malicious computer attacks such as trojans worms and viruses Enhanced Write Filter EWF allows Windows 7 users to protect data on their storage drive from permanent changes of any sort at the lowest level of hardware protection available the bit level EWF allows the OS to boot from the hard disk but protects the system by creating a virtual file system called an overlay All writes to an EWF protected volume the hard disk in the following figure are only recorded on this virtual overlay the EWF Volume in the following figure which is stored independently in random access memory RAM Because EWF does not write data directly to the hard disk but instead only records system writes to this virtual RAM overlay any data that is written
16. file system dev srO has been opened read nly Disk dev sda 20 GiB 21474836480 bytes 41943040 sectors nits sectors of 1 x 512 512 bytes sector size logical phusical 512 bytes Z0 size minimum optimal 512 bytes isklabel type dos Disk identifier Ox8660fa1i0 512 bytes 51 2 butes Boot Start End Sectors Size Id Type fdev sdai x 2048 206847 204800 100M HPFS NTFS exFAT fdev sda2 206848 15214591 15007744 7 260 HPFS NTFS exFAT Do you want to expand filesustem u n u ARGET_DEVICE_PARTITION_ARRAY 2 ARGET_DEVICE_PARTITION_ARRAY 1 1 ARGET_DEVICE_LAST_PARTITION dev sda2 ess any key to continune Check the system recovery partition details displayed in the console and type y at the command prompt to confirm the details Press Enter to continue fusr share drbl sbin ocs functions line warning setlocale LC ALL cannot change locale fusr share drbl sbin ocs functions line 10739 warning setlocale LC ALL cannot change locale fusr share drbl sbin ocs functions line 39 warning setlocale LC ALL cannot change locale usr share drbl sbin ocs functions line 10739 warning setlocale LC_ALL cannot change locale warning Setting locale failed warning Please check that uour locale settings LANGUAGE unset LEALL en LANG en US UTF 8 are supported and installed on your system jerl warning Falling back to a fallback locale en US UTF 8 Activating the partition info in proc d
17. html live manual en html customizing locale and language Dcs live keumap NONE batch mode or not yes no if no will run interactively Dcs live batch ues ocs lang is the language used in Clonezilla live Available value en US UTF 8 zh TH UTF 8 e DRBL SCRIPT PATH lang bash Dcs lang z cs live run ttu is the ttu for the ocs live run Default it will be dev ttu1 ive run ttu z ecruptfs cipher z aes _ecryptfs_key_bytes 16 any key to restore MBR y n Specify if the restore utility should expand the file system during the recovery process Type y at the command prompt to decompress the file system during the recovery process ocs_live_keymap usr sha are keymaps 1386 azerty tr latin9 kmap gz French keyboard NOTE ocs_live_keymap is deprecated It s better to use the parameters live conf ig keyboard la AITE or keyboard layouts for live config to E the keyboard layout Ref http live debian n et manual html live manual en html customizing locale and language ocs_live_keymap NONE batch mode or not yes no if no will run interactively Ocs live batch z ues ocs lang is the language used in Clonezilla live Available value en US UTF 8 zh TH UTF 8 E Hunen SCRIPT_PATH lang bash cs_lang ocs_live_run_tty is the tty for the ocs live run Default it will be dev ttu1 Ocs live run ttu z ecryuptfs_cipher aes s ecruptfs key bytes 16 Press any key to
18. threats earn more about each option When you use recommended settings or install updates only some information is sent to Microsoft The information is not used to identify you or contact you To turn off these settings later search for Turn off recommended setting in Help and Support Read the privacy statement 2 3 V2201 Series Windows Software System Initialization 4 Select the computer s current location Windows automatically applies the appropriate network settings based on the type of network you select e ol Set Up Windows This computer is connected to a network Windows will automatically apply the correct network settings based on the network s location ae Em Work network E t If all the computers on this network are at your workplace and you recognize them this is a trusted work network Don t choose this for public places such as coffee shops or airports Sis Public network If you don t recognize all the computers on the network for example you re in a coffee shop or airport or you have mobile broadband this is a public network and is not trusted If you aren t sure select Public network 5 When the Windows desktop screen appears you can start using your V2201 embedded computer 5 Recycle Bin gt dn N D a lt pate we ss 7 X at ON N 1 oxa Your Trusted Partner in Industrial Computing Solutions N sc EN Reliable
19. 55 255 248 255 255 255 255 255 255 255 255 Gateway 18H 73 239 17 7 192 168 8 1 On link On link On link 127 0 6 0 127 0 8 1 127 255 255 255 192 163 6 8 192 168 8 6 192 168 8 255 192 168 140 8 192 168 168 127 192 168 168 255 192 168 11 8 192 168 11 127 192 168 111 255 224 H H H 224 0 6 6 224 0 6 6 224 H H H 224 0 6 6 255 255 255 255 2505 255 255 255 2505 2505 2500 205 205 2505 25050 255 255 255 255 255 Persistent Routes Hone IPv6 Route Table Active Routes If Metric HMetuork 1 366 1 128 31 1858 31 366 266 266 251 266 2882 Fed 209 0 6 0 205 29050 25050 205 255 255 255 255 255 255 255 H 205 29050 200 2050 255 255 255 255 255 200 2090 Jub dhh 2hb ke 255 255 255 255 255 200 2090 H 25050 200 000 2005 255 255 255 255 24H H H H 24H H H H 24H H H H 240 0 6 6 255 255 255 45h 2505 255 255 255 J505 2455 255 45h5 2505 2505 255 255 255 255 255 255 Destination 2BB2 16 6449 ef bd 76449 ef b3 7128 fe 764 fe 764 fet 764 te5ae 2129622091 ch2a 128 Gateway On lLink On link On link On link O n link On link O n link FeO f 5f6 badd ebeV 75d4 128 fe8H fd63 FFARR 8 ff ff ff Persistent Routes Hone HT EE T FERSIET RS UTR 6 UR Rr TER ig Windows IP Configuration O n link 856b 128 On link On link On link On link On link 6 12 O n link O n link O n link O
20. 8 129 2297 18 71 with 32 bytes of data Reply from 998 129 229 187 bytes 32 time 235ms TIL 47 Reply from 978 129 229 187 hytez 32 time 226ms TTL 4 7 Reply from 98 129 229 187 bytes 32 time 1105ms TTL 47 Reply from 98 129 229 187 bytes 32 time 241ims TTIL 47 Ping statistics for 988 129 229 187 Packets Sent 4 Received 4 Lost A z loss gt Approximate round trip times in milli seconds Hinimum 226ms Maximum 1ilHb5ms Average 45ims C Users oxa gt 3 If you want to interrupt the cellular connection click Disconnect Skylight H 2 67KB 1 08 Kbps JT 2 SIERRA WIRELESS V2201 Series Windows Software Module Card I nstalling the WiFi Module Driver for the WPEA 252NI 1 Run driver x64 7 Modules WPEA 252NI Install CD setup exe to begin the installation 2 Select which language you would like to use and then click Next Qualcomm Atheros Client Installation Program InstallShield Wizard Choose Setup Language Select the language for the installation from the choices below Chinese Simplified Chinese Traditional Chinese Traditional Hong Kong 5 A R English United States French Standard German Greek Hungarian Italian Japanese E nre zarni InstallShield 3 Click Next Qualcomm Atheros Client Installation Program This program installs the driver and client utilities For your Qualcomm Atheros Wireless LAN Client Adapter dax ie V2201 Serie
21. C Windows system32 cmd exe o xj Ci NUsers moxa gt ipconf ig A Windows IP Configuration ohbile Broadband adapter Mobile Broadband Connection Connection specific DHS Suffix IPu4 Address gt 108 793 239 179 100 773 239 177 Default Gateway i tireless LAM adapter Wireless Metwork Connection ThermaLah fet f 5f6 badd ebe 7504215 192 168 0 6 192 168 0 1 Connection specific DHS Link local IPv6 Address IPu4 Address Default Gateway i i Ethernet adapter Local Area Connection 2 Connection specific DHS Suffix Link local IPv6 Address IPu4 faddress nono a 1 ww we ee Subnet Mask z o wow ww a u Default Gateway a a Fe eSae 21296 22091 ch2axis 192 168 11 127 255 255 255 H Ethernet adapter Local Area Connection Connection specific DHS Suffix Link local IPv6 Address IPu4 Address Subnet Mask Default Gateway Tunnel adapter isatap iDAH 7E2F68 5BAE 49C1 81FD Rh962CFBDH 74C Z1 ESI DRITTE DIU P 856b411 192 168 168 127 255 255 255 H n Media State Media disconnected Connect ion specif ic DNS Suffix Tunnel adapter isatap lt 5D66CA37 47HH 4304 BA21 H51E187B61AA gt Media State Media disconnected Connect ion specif ic DNS Suffix Tunnel adapter Teredo Tunneling Pseudo Interface Media State Hedia disconnected Connect ion specif ic DNS Suffix TE Tunnel adapter isatap ThermaLab Media
22. EEFEVENKREWRRKFEREEERENCKKEERIEKKKERENSNPKKEEEENEFUMUE US 8 1 1 Introduction Thank you for purchasing a Moxa V2201 panel computer running the Windows 7 Embedded operating system The Windows 7 Embedded OS provides a simple and familiar development environment for a variety of industrial applications Software Components The following software components of the Windows Embedded Standard 7 OS come pre installed on the V2201 computer Windows Embedded Standard 7 Core OS 64 bit supported Remote Client Remote Procedure Call Applications and Services Development Remote Desktop Protocol 7 1 e COM OLE Application Support e COM Application Support e MSMQ Internet Services Internet Explorer 8 e IIS 7 0 File Systems and Data Storage e Windows Data Access Components e Windows Backup and Restore Diagnostics Common Diagnostic Tools Problem Reports and Solutions Fonts Western Middle Eastern South East Asian and South Asian Fonts Graphics and Multimedia MPEG Layer 3 Audio Codecs MP3 e MPEG4 Decoders DirectX and Windows Device Experience Management e Group Policy Management e Windows Management Instrument WMI e Windows Update V2201 Series Windows Software Introduction Networking e Extensible Authentication Protocol EAP e Internet Authentication Service Telnet Server Bluetooth Domain Services Network Access Protection Network and Sharing Center Quality of S
23. EWF l Double click the padlock icon in the system tray You may need to show hidden icons in the system tray NOTE When disabled the EWF and FBWEF icons in the system tray look the same To verify that you have opened the correct writer filter program check the screen title Protected 2 In the File Based Writer Filter Overview screen click Configure File Based Write Filter Overview Current After restart State Disabled Disabled Cache compression Disabled Disabled Cache pre allocation Disabled Disabled Cache threshold 128 ME 128 MB Protected volumes Configure Runtime information RAM used for directory structure RAM used for file data 4 7 V2201 Series Windows Software Enabling Embedded Filters 3 To enable FBWF protection on a storage drive perform the following actions a Select Filter state enabled and Cache pre allocation enabled b In the Volume Configuration area select the storage drive you want to protect and click Protect c Click Apply or OK Write Filter eee ation Exclusion List Cache Content s Currently Disabled V Cache pre allocation enabled Currently Disabled Cache threshold MB Volume configuration Volumes State After reboot bbf71292 a Unprotected Unprotected L TILA ES ite Le LP Unprotected Unprotected NOTE To minimize memory usage on the overlay cache select Cache compression enable
24. Generallo dll examples V2201 W7E example 3 lib MxGenerall o x64 e RstExample exe examples V2201 W7E example Release x64 2 Execute RstExample exe DA Project w2201 example 5 RS TXRstExample exe Mini PCIE Power Contol Test Program A gt Exit Program 1 gt Display Power reset condition t2 Set Power 5 8 V2201 Series Windows Software 3 Type 1 to display the current power reset status DfilekProjectvv2201exampleyx64P owerResetkEstExample exe Mini PCIE Power Contol Test Program CH Exit Program 1 gt Display Power reset condition VP Set Power i Socketl is waiting for reset Socket is waiting for reset Minit PCIE Power Gontol Test Program CH Exit Program 1 gt Display Power condition t2 Set Power on off 4 Type 2 and follow the on screen instructions to set the reset pin Di file Project w2201 exarnple x64 P owerResetkEstExample exe Mini PCIE Power Contol Test Program CH Exit Program 1 gt Display Power reset condition VP Set Power 1 Socketl is waiting for reset Socket is waiting for reset Minit PCIE Power Gontol Test Program CH Exit Program 1 gt Display Power condition 2 Set Power on off 2 Input the Socket Number 41 25 1 Input H or 1 H Mini PCIE Power Contol Test Program CH Exit Program i Display Power condition P Set Power on off Examples 6 Module Card In this chapter we discuss installation and usage of the software utility
25. I 5 690577 fitheros R LZ Ethernet Driver version 2 2 3 1 692430 Copyright c 200 Atheros Corporation 5 776770 Broadcom NetXtreme II 5771x 10Gigabit Ethernet Driver bnx2x 1 62 00 6 2011 01 30 914014 Btrfs loaded 5 955475 device mapper uevent version 1 0 3 961407 device mapper ioctl 4 19 1 ioctl 2011 01 07 initialised dm devel redhat com Running scripts init premount done Mounting root file system I 6 176946 Uniform Multi Platform E IDE driver 6 186189 ide generic please use probe mask 0x3f module parameter for probing all legacy ISA IDE ports 6 913744 FAT utf8 is not a recommended IO charset for FAT filesystems filesystem will be cas gt sensitive 7 047997 aufs module is from the staging directory the quality is unknown you have been war ied 072516 aufs Z 1 standalone tree 38 rcN 20110228 Running scripts live premount done 2134331 loop module loaded 5097701 squashfs version 4 0 2009 01 31 Phillip Lougher Running scripts live realpremount done Mounting live image live filesystem squashfs on filesystem squashfs via dev loop0 done one egin Running scripts live bottonm Begin Configuring fstab done Jegin Preconfiguring networking done jegin Loading preseed file done jegin Running scripts init bottom done INIT version 2 88 booting Ising makefile style concurrent boot in runlevel 5 liue config hostname user setup sudo locales
26. SLF5EQ ii System Tools gt JE Computer gt Task Scheduler gt q Disk drives gt Bs Event Viewer ME Display adapters gt Ge Shared Folders gt fs Human Interface Devices de Local Users and Groups gt 4m Keyboards gt Ri Performance gt Mice and other pointing devices aay Device Manager gt iE Modems 4 3 Storage gt MOXA Embedded Drivers wey Disk Management ae Network adapters S Services and Applications E Qualcomm Atheros AR9580 Wireless Network Adapter Eam TEE 2 ve amp Realtek PCIe GBE Family Controller 2 Ee EF Sierra Wireless Mobile Broadband Network Adapter gt Portable Devices gt Ports COM amp LPT gt E Processors gt AP Ramdisk gt amp Sound video and game controllers gt gt Storage controllers JM System devices 7 Universal Serial Bus controllers WiFi Module Configuration 1 After installing the WiFi module driver select wireless network connection from the taskbar Mot connected Qi Connections are available Wireless Metwork Connection HTC Portable Hotspot 6F78 MHQ Mobile MHQ NB ZyXEL vmtest Other Network Open Network and Sharing Center 56 24PM 2 5 2015 V2201 Series Windows Software Module Card 2 Enter the password to connect to the network x Connect to a Network Type the network security key Security key Hide characters Cancel 3 You may verify
27. Support Contact I nformation Moxa Americas Toll free 1 888 669 2872 Tel 1 714 528 6777 Fax 1 714 528 6778 Moxa Europe Tel 49 89 3 70 03 99 0 Fax 49 89 3 70 03 99 99 Moxa India Tel 91 80 4172 9088 Fax 91 80 4132 1045 WWW moxa com su ort Moxa China Shanghai office Toll free 800 820 5036 Tel 86 21 5258 9955 Fax 86 21 5258 5505 Moxa Asia Pacific Tel 886 2 8919 1230 Fax 886 2 8919 1231 Table of Contents l Antrod ctlonossunssssveusucus rrr errr rr errr rrr rer rrr rrr rrr rrr rrr rrr rer rr ttre rrr r re rrr rer reer rrr rrr errr rr errr er rrr errr errr rrr 1 1 Sof Ware COImDONBNOlEbS eee ee ee ee ere er er ee ee eee 1 1 2 Systeni InitialiZalloli uccosessasezesuzaxexesu2u0scesagupLPRP E EDRDRPEPCEEELDRDEPEPERPRFEPCERFEREEFAKEERFEFEULKEEEFRCEPEKRFEKLPUEESRDLDIrE DES 2 1 eau MS 2 2 initializing User Settingsu iusiucie in iR REPE E REPE ied RR EE ee RE ERE ee IUE 2 2 3 Configuring the Serial TPE ER AC Coo aie aioe aes ciclo mu uum UE saUoN EE saEEN Ns ERES NE EEHONM NINE EIN NNEEUA MUS d NEUE 3 1 aca M a dmaaae 3 2 Configuring the Serial Interface Mode sssssssssssssssssee ene nnne hse aa aan aaa anna aan nnn 3 2 4 Enabling Enibedded Filters 5 rss xas spa eR UE ERE a a VEREENREFVRRVERNEVEEERVI NEU VERENNNUVRR VERI VV NE EEVNEVUNME 4 1 Eee Vibe tlt ele EE E A d esed bau bens esee solea bes
28. The following topics are covered in this chapter Overview I nstalling the Cellular Module Driver for the MC 9090 MC 7304 and MC 7354 I nstalling the Cellular Module Dial Utility Cellular Module Configuration I nstalling the WiFi Module Driver for the WPEA 252NI WiFi Module Configuration aougouuaug uo u Choosing the Gateway when WiFi and Cellular are Connected at the Same Time V2201 Series Windows Software Module Card Overview Moxa provides drivers and utilities for the MC 9090 MC 7304 and MC 7354 cellular modules and WPEA 252NI Wi Fi modules I nstalling the Cellular Module Driver for the MC 9090 MC 7304 and MC 7354 1 Run Build4208 exe to begin installation and then click Next Fa Mobile Broadband Driver Package V6 4 4208 0003 Welcome to the Mobile Broadband Driver Package Setup Setup will quide you through the installation of Mobile Broadband Driver Package It is recommended that you close all other applications before starting Setup This will make it possible to update relevant system files without having to reboot your computer Click Next to continue SIERRA WIRELESS 2 Click I Agree to accept the license Fa Mobile Broadband Driver Package V6 4 4208 0003 Q e Please review ipai license terms before installing Mobile s Broadband Driver Package Press Page Down to see the rest of the agreement End User License Agreement ATTENTION Please carefully read this Agreement
29. V2201 Series Windows Software User s Manual Edition 1 0 November 2015 WWW moxa com pr t MOXA 2015 Moxa Inc All rights reserved V2201 Series Windows Software User s Manual The software described in this manual is furnished under a license agreement and may be used only in accordance with the terms of that agreement Copyright Notice Trademarks O 2015 Moxa Inc All rights reserved The MOXA logo is a registered trademark of Moxa Inc All other trademarks or registered marks in this manual belong to their respective manufacturers Disclaimer Information in this document is subject to change without notice and does not represent a commitment on the part of Moxa Moxa provides this document as is without warranty of any kind either expressed or implied including but not limited to its particular purpose Moxa reserves the right to make improvements and or changes to this manual or to the products and or the programs described in this manual at any time Information provided in this manual is intended to be accurate and reliable However Moxa assumes no responsibility for its use or for any infringements on the rights of third parties that may result from its use This product might include unintentional technical or typographical errors Changes are periodically made to the information herein to correct such errors and these changes are incorporated into new editions of the publication Technical
30. ame Date modified Type BE Desktop osimage 6 15 2014 5 58PM File folder Downloads E Recent Places Libraries E Documents a Music E Pictures Videos jE Computer amp Local Disk C es NEW VOLUME E tig Network os image Date modified 6 15 2014 5 58 PM File folder 7 18 8 Proactive Monitoring The V2201 series supports the Moxa Proactive Monitoring utility See the Moxa Proactive Monitoring Windows Software User s Manual for details The manual can be found on the product CD DVD or downloaded from Moxa s website Note that the V2201 does not support hardware relay
31. d However cache compression decreases performance when accessing protected volumes Select Cache pre allocation enable to set the memory space available for the overlay cache when the system starts up instead of adjusting it as needed You cannot enable cache pre allocation and cache compression at the same time The cache threshold field sets the amount of memory that can be used by the write filter for the overlay cache The default value and size limits for the overlay cache vary depending on the operating system 4 Reboot the system 5 Log into the system and verify that the padlock icon in the system tray displays a number and indicates that FBWF is enabled on a drive The following figure shows an example Protected C P 4 8 V2201 Series Windows Software Excluding Files from FBWF Protection 1 Double click the FBWF icon in the system tray You may need to show hidden icons in the system tray 2 In the File Based Write Filter Overview window click Configure File Based Write Filter Overview Current State Enabled Cache compression Disabled Cache pre allocation Enabled Cache threshold 128 MB Protected volumes C Show exclusion list Show cache content Runtime information After restart Enabled Disabled Enabled 128 MB C RAM used for directory structure RAM used for file data 3 Click the Exclusion List tab and configure the following fields Volume name Select
32. dgio x64 e mxGenerall o dll examples V2201 W7E example 3 lib MxGenerall o x64 e DiO exe examples V2201 W7E example Release x64 2 Execute DI O exe DXProjectiv2201exampleX2 DIOXDIO exe UART Mode Test Program CH Exit Program 1 gt Display DIN Display DOUT Set DOUT value Display both DIM and DOUT 5 3 V2201 Series Windows Software Examples 3 Type 4 to display the current DI and DO values DXProjectvv2201XexampleX2 DIOXDIO exe UART Mode Test Program CH Exit Program 1 gt Display DIH 2 Display DOUT 3 gt Set DOUT value 4 gt Display both DIH and DOUT 1 1 1 1 Dout gt Doutl Dout Dout3 Mode Test Program CH Exit Program 1 gt Display DIH 2 Display DOUT 3 gt Set DOUT value 4 gt Display both DIH and DOUT 4 Type 3 to set the DOUT port number and then follow the on screen instructions D AProjectiv2201XexampleX2 DIO DIO exe UART Mode Test Program A Exit Program 1 gt Display DIH 2 Display DOUT 3 gt Set DOUT value 4 gt Display both DIH and DOUT 3 Input the Port Humber 4H 35 iH Input the value A or 1 H Set digital output successt UART Mode Test Program CH Exit Program 1 gt Display DIN 2 gt Display DOUT 3 Set DOUT value 4 gt Display both DIH and DOUT 5 Type 4 to check if the port value was set correctly DXProjectiv2201exampleX2 DIOXDIO exe UART Mode Test Program gt Exit Program
33. during system operation will disappear upon the next re boot This approach allows the system to operate as if it is writeable when in reality all OS and user space file systems are stored in a permanent read only state If required data written to the overlay can be committed to the protected volume but this requires additional setup and permissions that can only be granted by the administrator The following figure shows an overview of the EWF structure File read wite File reagivite File readtarte Commi CD Rom dass driver n dass diver Disk da ciii driver PUR EtTarito Hard disk CD ROM For more detailed information about EWF configuration and usage refer to the following resources e Visit Microsoft s EWF Volume Configuration help pages See Microsoft s EWF overview on the official Microsoft EWF help pages See Microsoft s detailed description of EWF modes on the EWF help pages See Microsoft s detailed description of the EWF API e For EWF commands refer to the MSDN web site http msdn microsoft com en us library ms940853 28v winembedded 5 29 aspx 4 2 V2201 Series Windows Software Enabling Embedded Filters Enabling Enhanced Write Filter Follow these steps to enable Enhanced Write Filter 1 To open EWF double click the padlock icon in the system tray You may need to show hidden icons in the system tray Molumel Disabled C Disabled Sincere 5 2 Inthe Volume Informati
34. e File Based Writer Filter FBWF Note that when Enhanced Writer Filter is enabled the File Based Writer Filter function will not work According to Microsoft File Based Write Filter FBWF allows the Windows Embedded platform to maintain the appearance of read and write access on write sensitive or read only storage FBWF makes read and write access transparent to applications Writing to storage media may be undesirable or impossible in embedded devices FBWF redirects all writes targeted for protected volumes to a RAM cache called an overlay Used in this context an overlay is similar to a transparency overlay on an overhead projector Any change made to the overlay affects the picture as seen in the aggregate but if the overlay is removed the underlying picture remains unchanged FBWF supports an advanced ESF feature which allows users to specify which directory to write data to The default directory is c temp The advanced feature allows you can read write data to disk without committing an action 4 6 V2201 Series Windows Software Enabling Embedded Filters Configuring File Based Write Filter Complete the following steps to enable the File Based Write Filter FBWF feature Although you can enable FBWF and EWF on the same computer FBWF does not protect a volume that is already protected by EWF Similarly EWF does not protect a volume that is already protected by FBWF NOTE Before using FBWF make sure that you disable
35. e you want to configure and click Configure Enhanced Write Filter Overvie Volume information Overlay Type State Pending Command E RAM Reg Enabled No command HORM information Overlay information HORM state Disabled Overlay size Space available Configure Show overlay details 4 5 V2201 Series Windows Software Enabling Embedded Filters NOTE 3 Inthe Enhanced Write Filter Configuration screen select a drive volume then select an option from the Pending Command drop down list e No Command e Disable Disables EWF on the selected drive The system automatically reboots if you select this option e Commit Writes all current system changes to the hard drive e Commit and Disable Live Writes all current data and changes to the system and also turns off EWF on the selected drive so that all future data and system changes will also be committed to the drive The system does not automatically reboot if you select this option Enhanced Write Filter Name Overlay Type State Pending Command Volume 1 Reg Disabled No command RAM Reg Enabled Mo command Pending command Moco Disable Commit Commit and disable live HORM support For detailed information go to the Microsoft website at http msdn microsoft com en us library ff794092 v winembedded 60 aspx File Based Write Filter This section describes how to use th
36. ert mode Memtest amp FreeDOS gt 7 16 V2201 Series Windows Software System Recovery 2 Wait until the boot process is complete NOTE You can press any key or use CTRL C to cancel the backup process and exit Clonezilla 153522 sd 0 0 0 sda Attached SCSI disk 1637261 sd 0 0 1 sdb Attached SCSI disk 2879411 sd 0 0 0 0 Attached scsi generic sg type 0 310750 sd 0 0 1 Attached scsi generic sgl type 9 334915 sr 1 0 0 0 Attached scsi generic sgZ type 5 Loading essential drivers I 5 690577 Atheros R L2 Ethernet Driver version 2 2 3 6924301 Copyright c 200 Atheros Corporation 776770 Broadcom NetXtreme II 5771x 10Gigabit Ethernet Driver bnxZx 1 62 00 6 2011 01 30 3914014 Btrfs loaded 5 955475 device mapper uevent version 1 0 3 3961407 device mapper ioctl 4 19 1 ioctl 2011 01 07 initialised dm devel redhat com d mao uo un Running scripts init premount done jegin Mounting root file system I 6 178946 Uniform Multi Platform E IDE driver 6 186189 ide generic please use probe mask 0x3f module parameter for probing all legacy ISA IDE ports 6 913744 FAT utf8 is not a recommended IO charset for FAT filesystems filesystem will be cas sensitive 2 047997 aufs module is from the staging directory the quality is unknown you have been uar ied 072516 aufs 2 1 standalone tree 36 rcN 20110228 jegin Running scripts live premount done 2134331 loop modu
37. ervice Remote Access Service RAS Telephony API Client e Windows Firewall Wireless Networking Security Credential Roaming Service Credentials and Certificate Management e Windows Authorization Manager AZMAN e Windows Security Center Active Directory Rights Management Security Base Encrypted File System EFS Embedded Features e Enhanced Write Filter EWF File Based Write Filter FBWF Registry Filter WSDAPI for NET Embedded Self Health Diagnostic Software Moxa Proactive Monitoring amp Moxa SmartRecovery 1 2 2 System Initialization In this chapter we describe how to initialize the system settings on the V2201 embedded computer when booting up for the first time The following topics are covered in this chapter O Overview 0 Initializing User Settings V2201 Series Windows Software System Initialization Overview Similar to using a laptop computer for the first time you need to specify a user name and create a user account to start using the V2201 embedded computer Follow the procedure described in the next section NOTE If you perform a system recovery on the V2201 embedded computer the system automatically resets to the factory defaults You must initialize the user settings again nitializing User Settings 1 When you turn on the embedded computer for the first time enter a user name for the computer ed Set Up Windows Windows Embedded Standard 7
38. file from the overlay and overwrite the original file e Restore Return the file to its original state remove the file from the overlay cache and discard the changes that added the file to the cache e Add to exclusion list Adds the file to the exclusion list after the next restart This will delete the file from the cached overlay and replace the current file in permanent storage with the modified cache file File Based Write Filter Exclusion List Cache Content Volume name Cache size inetoub temp appPools APC2F 78 tmp 72 0 KB ProgramData S lProgramData Micro SystemIndex 1 gthr ProgramData Microsoft Search MSS chk ProgramData Microsoft Search M55 log ProgramData MicrosoftiSe Windows edb ProgramData Microsoft Search tmp edb 8 06 MB Windows bootstat dat 4 00 KB Windows nf setupapi dev log 56 0 KB Windows prefetch AgGlFaultHistory db 4 00 KB 4 10 V2201 Series Windows Software Enabling Embedded Filters 2 The most common usage of the Cache Content filter will likely be to permanently write content to the hard drive To do this select the file you wish to write to permanent memory and click on the commit button This will delete the file from the cached overlay and replace the current file in permanent storage with the modified cache file Keep in mind that committing a configuration or application file will permanently alter the setup and or performance of the application or system
39. hapter Creating a Custom System I mage In this section we describe the procedure to create a custom backup image for your system We recommend that you create and store backup images of your system on a regular basis so that you can restore your system to the last know good state when your system crashes The procedure described here will help you save a copy of your entire system along with the current configuration settings to a USB drive The backup files are stored under the y home partimag folder in the USB drive and are overwritten each time you create a backup for your system Prerequisites Before you proceed with the custom backup ensure that you have completed the following steps described in the Setting Up a Factory Default Recovery Image section Step 1 Preparing the USB drive Step 2 Set the BIOS to Boot via USB Auto mode l Select the clonezilla live save disk option in the boot loader window to boot the system in auto mode for system backup 7 14 V2201 Series Windows Software System Recovery 2 Wait until the boot process is complete NOTE You can press any key or use CTRL C to cancel the backup process and exit Clonezilla 5 153522 sd 0 0 0 sda Attached SCSI disk 1637261 sd 0 0 1 sdb Attached SCSI disk 5 287941 sd 0 0 0 60 Attached si generic sgO type 0 310750 sd 0 0 1 Attached scsi generic sg1 type O 334915 sr 1 0 0 0 Attached scsi generic sgZ type 5 Loading essential drivers
40. le loaded 7 509770 squashfs version 4 0 2009 01 31 Phillip Lougher jegin Running scripts live realpremount done Begin Mounting live image live filesystem squashfs on filesystem squashfs via dev loop0 done one egin Running scripts live bottonm Begin Configuring fstab done Jegin Preconfiguring networking done jegin Loading preseed file done jegin Running scripts init bottom done INIT version 2 88 booting ising makefile style concurrent boot in runlevel 5 liue config hostname user setup sudo locales tzdata keyboard configuration sysvinit susu rc initram s tools util linux login openssh seruer Specify if the file system should be resized after the backup process is complete Type y at the command prompt to resize the file system and press Enter to continue ni mount o remount nru lib live mount medium Jotololoto ne mount bind lib live mount medium home partimag home partimag Jolotolor n3 sudo lib live mount medium live save_prerun sh 9cs live run is the main program to run in Clonezilla live to save or restore or other command vailable program ocs live general ocs live restore or any command you write Use the Absolute pati in Clonezilla liv Prun z ocs live restore neri of _extra_param will be used only when ocs_live_run ocs live restore not for ocs live ge ther s sr Therefo
41. lity should restore the MBR from an image or not Type y at the console prompt to restore from an image and press Enter to continue OOOO OKA KK KK Now run ocs_prerun2 sudo lib live mount medium live restore prerun sh y n count 1 Dcs live extra param g auto e1 auto e2 c icds j2 k p true restoredisk os image sda auto e1 auto e2 c icds j2 k p true restoredisk os image sda ocs live run is the main program to run in Clonezilla live to save or restore or other command A vailable program ocs live general ocs live restore or any command you write Use the Absolute path in Clonezilla live Dcs live run ocs live restore NM Oocs live extra param will be used only when ocs live run zocs live restore not for ocs live genera i or n any other then it will be passed to ocs sr Therefor re prin parameters actually those of Ex ocs_liv e_extra param b c restoredisk sarge rS hda _live_extra_param g auto e1 auto e2 c icds j2 k p true restoredisk os image sda ocs_live_keymap is for keymap used in Clonezilla live Man install keymap for more details ocs_live_keymap NONE won t change the default layout ocs live keumap usr shere keumapsy 386 acertu tr latin9 kmap gz French keyboard M NOTE ocs live keumap is deprecated It s better to use the parameters live config keyboard lay puts or keyboard layouts for live config to configure the keyboard layout Ref http live debian n et manual
42. n the system recovery process configure the BIOS settings as described in the previous section Step 2 Set the BI OS to Boot via USB Then connect the USB recovery drive to any USB port on the V2201 and reboot the computer If you have successfully prepared the USB and BIOS the computer will boot into the Clonezilla boot loader from the USB port There are 2 kinds of recovery process in Clonezilla auto mode and expert mode Select auto mode to complete the recovery task if you want Clonezilla to help you recover the MBR and expand the image automatically Select expert mode to see a list of selectable options for completing the recovery task 7 6 V2201 Series Windows Software System Recovery Auto mode l Select the clonezilla live restore disk auto Mode option in the boot loader window to boot the system in auto mode for system recovery clonezilla live restore disk auto mode Automatic boot in 1 second 2 Wait until the boot process is complete NOTE You can press any key or use CTRL C to cancel the recovery process and exit Clonezilla 153522 s 0 0 0 sda Attached SCSI disk 163726 sd 0 0 1 0 sdb Attached SCSI disk 287941 sd 0 0 0 0 Attached scsi generic sg tupe 0 310750 sd 0 0 1 0 Attached scsi generic sgi type 0 3349151 sr 1 0 0 0 Attached scsi generic sgZ type 5 Loading essential drivers I 5 690577
43. o eden bens deas bebes tema te catetate neta ambe neta andlnanantane 4 2 OVORVIQW sS rct he eh aA a Eun Ld enata nue a atate ua etat daa e afa aut 4 2 Enabling Enhanced Write BIIEGE dei pedido eden dnd uiu dance ax dmt dad lat a ea a landed lad ade audet atat addat 4 3 Committing Data and or Disabling EW Fivcs0 ss0smeewesse we etc ecce xc eee ton nae tent vocet to trate dede 4 5 File BasequWrite Filer c E EDEN 4 6 Configuring File Based Write Filter c cece cece cece eee e nee nene heh DEE E EE ES SDE EEE ESS anna nnn nnn 4 7 Excluding Files trom FBWE PFOESCEIDDE I seciceracstevcatuet T E bvs ial pel b a bes pua Lent ee iets 4 9 Managing Temporary Files Cached in the Overlay cccccccccee cesses eee esse eee enne e ehem h nnn nns 4 10 5 Examples uini EIN NELEIS S NEC MN EE UE EEE MEE STI NENNEN EE NEM NIST MENU REN MUERE NM SINCE 5 1 Seldall WCC aCe NT TEE TD Dm 5 2 Digital np OUTPUT ouo non AAEE EE EEEE UMMDO MIDI EEUU MEDI EE DUI E 5 3 NAL GING OG 2 aot RUN NRI ATO C T UTE 5 5 DED EET EM 5 5 POWOI 4 2 161 s ttf oft f M M MM Mu Ef E 5 7 Power NA eT 5 8 Gx Module Card cusssceviususesE VES CER SNVVIEUOVREFUVOEMENUVEEDOURNUMUEEEUNEUVKEENUNUVERKERNEVUVUNRUNNUFVEUEENEMUVEUEUMVVUVENENENUMU UEM aaae 6 1 Qva i c eere NR c cM PCR T DE RN TN DN T D CE 6 2 Installing the Cellular Module Driver for the MC 9090 MC 7304 and MC 7354 sssesssssen nmn 6 2 Installing the Cellular Module Dial Utility c cece
44. on area select the partition you want to enable write protection on and click Configure Enhanced Write Filter en Volume information Overlay Type State Pending Command E RAM Reg Disabled No command Show volume details HORM information Overlay information HORM state Disabled Overlay size Space available Configure Show overlay details Close 4 3 V2201 Series Windows Software Enabling Embedded Filters 3 The Configuration dialog box appears Select Enable from the Pending command drop down list and click OK Enhanced Write Filter Configuration Name Overlay Type State Pending Command Volume 1 RAM Reg Disabled No command ES RAM Reg Disabled Enable al HORM support c D _ 4 Reboot the system Log into the system and verify that the padlock icon in the system tray indicates that the drive volume is locked with EWF Molumel Disabled 1 C Enabled 4 4 V2201 Series Windows Software Enabling Embedded Filters Committing Data and or Disabling EWF Perform the following steps to write or commit data to an EWF enabled drive NOTE You must have administrator privileges to commit data to the drive l Double click the padlocked drive in the system tray You may need to show hidden icons in the system tray 3 Volumel Disabled 3 C Enabled Sincere Customize 2 In the Enhanced Write Filter Overview dialog box select the driv
45. oncurrent boot in runlevel 5 live config hostname user setup sudo locales tzdata keyboard configuration suysuinit sysu rc initram s tools util linux login openssh server_ 7 7 V2201 Series Windows Software System Recovery 3 Choose one of the following options and press Enter to continue poweroff power off the system cmd access the console terminal restart the entire procedure Choose mode Now you can choose to powerott Poweraff reboot Reboot reruni Start over image repository home partimag if mounted will be umounted rerun Start_over_ keep_image_repository_ home part imag mounted DK Expert mode l Select the clonezilla live restore disk expert Mode option in the boot loader window to start the system in expert mode for system recovery clonezilla live restore disk expert mode 2 Press Enter to continue with the system recovery process The jobs in etc ocs ocs live d are finished Start ocs live restore now Found ocs_prerunx parameter in boot parameters The order to run ocs_preruni ocs_prerun2 DIKSKKOK KOK KOK KOK KOK KOK KKK OK KOK OK OK KOK KOK Now run ocs preruni mount bind lib live mount medium home partimag home partimag DIKDKIKK KKK KOK KKK KK OK KKK OK OK OK OK OK OK OK OK Nou run ocs_prerun2 sudo lib live mount medium live restore_prerun sh y n count 1_ V2201 Series Windows Software System Recovery Specify if the restore uti
46. one Betting dev sdai info fusr share drbl sbin ocs functions line 3632 warning setlocale ALL cannot change locale fusr share drbl sbin ocs functions line 3645 warning setlocale LC cannot change locale Betting dev sda2 info fusr share drbl sbin ocs funct ions line 3632 warning setlocale LC_ALL cannot change locale fusr share drbl sbin ocs functions line 3645 warning setlocale LC_ALL cannot change locale DKK KKK KKK KKK OK KK KKK KOK OK OK OKO OOK OOK OOK HOOK OHIO IOI IOIOK he aarp step is to restore an image to the hard disk partition s on this machine home part imag os_image gt sda sdai sda2 he image was sf a at 2015 1020 1521 us re you sure you want to continue y n V2201 Series Windows Software System Recovery Reconfirm the system recovery partition details by typing y at the command prompt and press Enter to continue Getting dev sdal into fusr share drbl sbin ocs functions line 3632 warning setlocale LEALL cannot change locale fusr share drbl sbin ocs functions line 3645 warning setlocale LEALL cannot change locale Getting dev sdag2 into fusr share drbl sbin ocs functions line 3632 warning setlocale LC BALL cannot change locale fusr share drbl sbin ocs ftunctions line 3645 warning setlocale LEALL cannot change locale SOR ose eoe eoe oe oe oe oe OS XOSKE SE SEE SEO REOR OC EOS HOC EORR REOSCHEOSCHIOE The following step is to restore an image to the hard disk parti
47. or recovery in the event the system becomes unstable You can perform a system recovery using one of the following system images A clean factory default image A user generated image created from a fully configured fully set up system Before you perform a system recovery set up the system environment Setting Up the Recovery Environment To set up the recovery environment on a V2201 computer prepare a USB drive that has at least 4 GB of memory and a copy of the recovery suite The following lists the major steps in the recovery procedure L Copy the recovery programs and system image file on to the USB drive Set up the drive as a live drive system with an ISO image of the boot environment Reboot the system and configure the BIOS to boot the recovery system from the USB port An image of the current software system will be created on the USB drive The recovery environment will use this image when restoring the system Reboot the system again and the BIOS is returned to its original state Setting Up a Factory Default Recovery I mage Step 1 Preparing the USB drive L Load the software DVD that came with your V2201 computer and execute tuxboot windows 23 exe in the recovery folder Select Pre Downloaded and click the ellipsis button to browse the file system and locate the boot environment s ISO image E Tuxboot On Line Distribution clonezilla_live stable I current Clonezilla Homepage h
48. ple 3 lib mxgpio x64 e mxGenerallo dll examples V2201 W7E example 3 lib MxGenerall o x64 e LED exe examples V2201 W7E example Release x64 2 Execute LED exe DAProjpect w2201 example M LED LEDexample exe LED Test Program CH Exit Program 1 gt Display LED 2 gt Set LED value 5 5 V2201 Series Windows Software 3 Type 1 to display the current LED value D Prajectvv2201 example M LEDLEDexample exe Program CH Exit Program 1 gt Display LED 2 gt Set LED value Program CH Exit Program 1 gt Display LED c2 gt Set LED value 4 Type 2 and follow the on screen instruction to set the LED value When you set the LED value to 0 the LEDs turn off When you set the LED value to 1 the LEDs turn on DProjectvv2201 example M LEDLEDexample exe Program CH Exit Program 1 gt Display LED 2 gt Set LED value 2 Input the Port Number 4H 25 H Input the value tA or 1 1 Set LED successt LED Test Program CH Exit Program 1 gt Display LED 2 gt Set LED value 5 6 Examples V2201 Series Windows Software Power Control Examples In this section we illustrate how to use the test utility to control power through the mini PCIE interface l Copy the following files from the product software DVD e mxgpio dll examples V2201 W7E example 3 lib mxgpio x64 e mxGenerallo dll examples V2201 W7E example 3 lib MxGenerall o x64 e PwrExample exe exam
49. ples V2201 W7E example Release x64 2 Execute PwrExample exe DAProject w2201 example 3 PWRCT RL PwrExample exe Mini PCIE Power Contol Test Program CH Exit Program 1 gt Display Power condition CP Set Power on off 3 Type 1 to display the current power status DXProjectvv2201XexampleX3 PWRCTRLXPwrExample exe Mini PCIE Power Contol Test Program CH Exit Program 1 gt Display Power condition CP Set Power on off i Socketl is on Socket iz on Mini PCIE Power Contol Test Program CH Exit Program 1 gt Display Power condition t2 Set Power on off 5 7 V2201 Series Windows Software 4 Type 2 and follow the on screen instructions to set the power value When you set the power value to 0 the power turns off When you set the power value to 1 the power turns on DAProject w2201 example 3 PWRCT RL PwrExample exe Mini PCIE Power Contol Test Program CH Exit Program 1 gt Display Power condition 22 gt Set Power on off 2 Input the Socket Number 4 amp 1 25 i Input 8 or 1 WA OFF 1 On gt Set Power successt Mini PCIE Power Contol Test Program CH Exit Program 1 gt Display Power condition CP Set Power on off Power Reset Examples In this section we illustrate how to use the test utility to reset the power through the mini PCIE interface 1 Copy the following files from the product software DVD e mxgpio dll examples V2201 W7E example 3 lib mxgpio x64 e mx
50. re these parameters are actually those _extra_param b c restoredisk s 5 hda c ntfs ok z1 p true q2 fsck src part y savedisk os image sda keumap is fan Jmap used in Clonezilla live Man install keumap for more details Ex ocs live keumap NON uon t change the default layout 4 ocs live keumap us re keymaps 19 kmap gz Fre 4 NOTE ocs_live_keymap is deprecated It s better to use the pe ters outs or key l lauouts for liv E ut Re et manual html live manual en html amp customizing locale and language s live keumap NONE OCcs liv D D np batch mode or not yes no if no will run interactively ocs live batch z ues ocs lang is the language used in Clonezilla live Available value en US UTF 8 zh TH UTF 8 e DRBL SCRIPT PATH lang bash ocs_lang ocs_live_run_tty is the tty for the ocs_live_run Default it will be dev ttu1 ve nun ttu z V2201 Series Windows Software System Recovery 4 Choose one of the following options and press Enter to continue reboot reboot the system access the console terminal restart the entire procedure 5 Power down the system and remove the USB drive The system backup process is now complete The backup image file is located in the home partimag os image folder of the USB drive Label the USB drive and store it in a safe place Organize E Share with New folder i ud 9 Eoo N
51. restore MBR y n y 1 0 records in 1 0 records out 512 bytes 512 B copied 0 00557 s 91 9 kB s Warning Unable to open dev snrO read write Read only file Stem dev srO has been opened read only Warning Unable to open dev snrO read write Read only file system dev srO has been opened read only Disk dev sda 20 GiB 21474836480 bytes 41943040 sectors Units sectors of 1 x 512 512 bytes Sector size logical physical 512 bytes 512 bytes I 0 size minimum optimal 512 bytes 512 bytes Disklabel type dos Disk identifier 0x8660fai10 Device Boot Start End Sectors Size Id Type f dev sdail x 2048 20684 204800 100M HPFS NTFS exXFAT dev sda 206848 15214591 15007744 7 2G HPFS NTFS exFAT Do you want to expand filesystem y n _ V2201 Series Windows Software System Recovery 5 Press Enter to continue with the system recovery process Ocs lang is the language use DRBL SCRIPT PATH lang bash d in Clonezilla live Available value en US UTF 8 zh TH UTF 8 cs lang OCS live run ttu is the tty for the ocs live run Default it will be dev ttu1 cs live run ttu z ics_ecryptfs_cipher aes cs_ecryptfs_key_bytes 16 ress any key to restore MBR u n u 1 0 records in 0 records out 112 bytes 512 B copied 0 00557 s 91 9 kB s larning Unable to open dev srO read write Read only file system dev snrO has been opened read nly Narning Unable to open dev srO read write Read only
52. s e The first reason is for security since the computer will not be able to be rebooted from unauthorized USB drives The second reason is because the computer is able to boot up from a non bootable USB drive Currently if the V2201 is set to boot from a USB drive the V2201 s boot process stops anytime you insert a non bootable USB data drive into the machine The V2201 cannot detect USB data drives and boot capable OS drives Complete the following steps to reset the boot priority setting 1 Reboot the system and during the POST process press F2 until you hear a long beep Click SCU to enter the BIOS setup menu 2 Use the left and right arrow keys to navigate to the Boot menu then press Enter 7 12 V2201 Series Windows Software System Recovery 3 Use the up and down arrows to navigate to the Legacy link then press Enter Nain Advanced Security Power i gt Legacy Normal Boot Menu gt Boot Type Order Hard Dis Dr ye L SE F5 F6 Enter 7 13 V2201 Series Windows Software System Recovery 5 Use the up and down arrows to highlight Hard Disk Drive and use the plus or minus key to move Hard Disk Drive to the top of the boot priority list 6 Press F10 and Enter to save and exit the BI OS configuration interface This sets the system to reboot and the system should now boot from the hard drive For more information about initializing user settings refer to the System Initialization c
53. s Windows Software Module Card 4 Check I accept the terms of the license agreement and click Next Qualcomm Atheros Client Installation Prog um m License Agreement Please read the following license agreement carefully a ualcamm Atheros Communications Inc Software License Agreement PLEASE READ THIS SOFTWARE LICENSE AGREEMENT LICENSE CAREFULLY E BEFORE USING THE Qualcomm Atheros SOFTWARE BY USING THE Qualcomm Atheros SOFTWARE YOU SRE AGREEING TO BE BOUND BY THE TERMS OF THIS LICENSE IF OU DO NOT AGREE TO THE TERMS OF THIS LICENSE DO NOT USE THE SOFTWARE IF YOU DO NOT AGREE TO THE TERMS OF THE LICENSE YOU M Y RETURN THE Qualcomm Atheros SOFTWARE TO THE PLACE WHERE OU OBTAINED IT FOR A REFUND IF THE Qualcomm Atheros SOFTWARE WAS ACCESSED ELECTRONICALLY CLICK DISAGREE DECLINE FOR Qualcomm 2 da nat accept the terms of the license agreement InstallShield iii m Qualcomm Atheros Client Installation Program InstallShield Wizard Complete The installation program has successtully perfarmed the selected operations Click Finish to exit the Wizard Back Cancel V2201 Series Windows Software Module Card 6 The system should locate the new hardware and install the driver automatically Check Windows Device Manager to verify En Computer Management Ele Action View Help A omputer Management Lorca at mg IOXA GIGPSLFSEQ Comp Manag Local aay MOXA GIGP
54. t YOU have the authority to enter into this Agreement on your own behalf or on behalf of the entity that you represent Install Sierra Wireless Skylight to Cx C Program Files Sierra Wireless Inc Skylight InstallShield V2201 Series Windows Software Module Card 3 Click Finish to Pope the installation InstallShield Wizard Completed SIERRA WIRELESS The InstallShield Wizard has successfully installed Sierra Wireless Skylight Click Finish to exit the wizard Cancel 4 The system should locate the new hardware and install the driver automatically Check Skylight under Sierra Wireless to double check gk Desktop Gad iget Gallery Internet Explorer 64 bit E Internet Explorer e Windows ri tron di Sierra Wireless Fa Mobile Broadband Update Subsystem for UNIX based Applications Search programs an 6 5 V2201 Series Windows Software Module Card Cellular Module Configuration l After installing the cellular module driver and utility if you want to establish a cellular connection start Skylight and click Connect Skylight EB Administrator C Windows system32 CMD exe Microsoft Windows Version 6 1 7681 1 Copyright tc 2610 Microsoft Corporation All rights reserved C2 Users oxa gt PIND WUW MOXA COM PIND is not recognized as an internal or external command operable program or batch file CiSUsersroxa PING WUU MOXA COM Pinging WWW MNOXA COM 9
55. the cellular connection by pinging the interface once the connection is established Microsoft Windows Version 6 1 7601 Copyright tc 26160 Microsoft Corporation All rights reserved C2 Users oxa gt PIND WW MOKA COM PIND is not recognized as an internal or external command joperable program or batch file BC Users oxa gt PING WWW MOKA COM Pinging WWW MOXA COM 978 129 229 187 with 32 bytes of data Reply from 998 129 229 187 bytes 32 time 235ms TTL 47 Reply from 988 129 229 187 bhytes 32 time 226ms TTL 47 SReply from 978 129 229 187 bytes 32 time 1165ms TTL 47 Reply from 998 129 229 187 bytes 32 time 24ims TTL 47 Ping statistics for 998 129 229 187 Packets Sent 4 Received 4 Lost B Hz loss gt Approximate round trip times in milli seconds Hinimum 226ms Maximum 1iB5ms Average 451ms C Users oxa gt 6 10 V2201 Series Windows Software Module Card Choosing the Gateway when WiFi and Cellular are Connected at the Same Time l Open the Start Menu and type cmd in the Start Menu search box 2 Click cmd from the search results which should appear directly under Programs 3 When the Command Prompt window opens type ipconfig in the command prompt window to display the IP addresses of the WiFi connection and cellular connection In the example shown below the IP address of the WiFi connection is 192 168 0 6 and the IP address of the cellular connection is 100 73 239 179 BB Administrator
56. tion s on this machine zt imag os image gt sda sdai sda2 ted at 2015 1020 152 ine uou sure uou want to continue ysn Y Ok lets do it DEREK EEE EEE EEE EE HEE EE EEE EEE EEE EEE EEE Let me ask uou again The following step is to restore an image to the hard disk partition s on this machine Zt _image gt sda sdai sdaz ted at 2015 1020 152 Specify if the file system should be resized after the recovery process is complete Type y at the command prompt to resize the file system and press Enter to continue LG ALL lt en LANG en US lTF 8 are supported and installed on your system jerl warning Falling back to a fallback locale en US UTF 8 fusr share drbl sbin ocs functions line warning setlocale LC ALL cannot change locale fusr share drbl sbin ocs ftunctions line warning setlocale LC_ALL cannot change locale fusr share drbl sbin ocs functions line warning setlocale LC_ALL cannot change locale he grub directory is NOT found Maybe it does not exist so other boot manager exists or the file in the kernel Skip running grub install HOCH unning run ntfsreloc part p sdai sda2 auto bin bash warning setlocale en bin bash warning setlocale LC BLL cannot change locale en bin bash warning setlocale LC BLL cannot change locale en bin bash warning setlocale LC_ALL cannot change locale en he NTFS boot partition was not found or not among the restored partition s
57. ttp JIclonezilla arg Description Clonezilla live is a distribution used Far disk backup and imaging The stable branch of Clonezilla live are based an Debian Install Notes Clonezilla live is booted and run in live made no installation is required to use it Download Path Clonezilla Live Stable at SourceForge Pre Downloaded ISO we Show All Drives Use with Care Save I50 file MOS Check Type USB Drive Drive Fii hal OK cancel 7 2 V2201 Series Windows Software System Recovery 3 Navigate to the V recovery folder on the software DVD and select the boot environment s ISO image Organize v Share with New folder Name Date modified Type X Favorites RE Desktop i q 12 24 2014 12 03 File folder Jp Downloads clonezilla live 2 0 1 15 1686 pae moxa 2 0 6 7 18 2014 9 43 AM Disc Image File 107 072 KB Recent Places tuxboot windows 23 5 26 2011 8 33 PM Application 5 729 KB 153 Libraries Documents a Music Pictures Emi Videos 4 Select USB Drive from the Type drop down list and select the drive letter that corresponds to the USB drive from the Drive drop down list Click OK to copy the boot environment and bootloader to your USB drive MS Tuxboot On Line Distribution clonezilla_live stable m current Poa ba Clonezilla Homepage btto fclanezilla org Description Clonezilla live is a distribution used For disk backup and imaging The stable branch of Clone
58. tzdata keyboard configuration sysvinit susu rc initram s tools util linux login openssh seruer 3 Choose one of the following options and press Enter to continue emd access the console terminal restart the entire procedure Choose mode Now you can choose to poweroff Poweroff Reboot Enter command line promot reruni Start over image repository home partimag if mounted will be umounted rerun Start_over_ keep_image_repository_ home part imag_mounted lt Ok gt 7 15 V2201 Series Windows Software System Recovery 4 Power down the system and remove the USB drive The system backup process is now complete The backup image file is located in the home partimag os image folder of the USB drive Label the USB drive and store it in a safe place KLUB NEWVOLUME D home partimag Organize Jj Open Share with New folder WW Favorites NE Desktop d os image Ji Downloads Recent Places 3 Libraries Documents a Music ks Pictures pg Videos JE Computer Zz Local Disk C es NEW VOLUME E tha Network j n os image Date modified 6 15 2014 5 58 PM File folde l Expert mode 1 Select the clonezilla live save disk expert Mode option in the boot loader window to boot the system in expert mode for system backup clonezilla live restore disk auto mode clonezilla live restore disk expert mode clonezilla live save disk clonezilla live save disk exp
59. zilla live are based on Debian Install Notes Clonevilla live is booted and run in live made no installation is required to use it Download Path Clonezilla Live Stable at SourceForge S Pre Downloaded lso v Ds 42011 06 15 13 clonezilla live 1 2 6 46 688 iso Show All Drives Use with Care Save I50 file MOS Check 5 Click Exit Tuxboot 1 Downloading Files Done 2 Extracting and Copying Files Done 3 Installing Bootloader Done 4 Installation Complete Reboot Current After rebooting select the USB boot option in the BIOS boot menu Reboot now aos on 7 3 V2201 Series Windows Software System Recovery 6 From the desktop copy the directory containing the base OS from the software DVD on to the USB drive That is copy lt SoftwareDVD gt recovery os image to the partition image directory F home partimag on the USB drive However if you want to recover from your own system image back up a system image first For more information refer to the Creating a Custom System I mage section After Step 1 procedure is complete proceed to the next section Step 2 Set the BI OS to Boot via USB es fr lt lt NEW VOLUME D home partimag Organize Open Share with New folder Fil e sk T Mame Date modified Type Siz BE Desktop di os image 5 15 2014 5 58 PM File folder m Downloads Recent Places Libraries a Documents a Music E E Pictures B Videos
Download Pdf Manuals
Related Search