Home
H8/300 and 300L E6000 Emulator User`s Manual
Contents
1. MCU Group I O Address H8 3834 Group H8 3814Group Note FF4A to FFA7 O X The H8 3814 group does not have bits 0 to 4 FFAE to FFAF X X FFB2 O X The H8 3814 group does not have bits 0 to 2 and7 FFB3 O X FFB4 O X The H8 3814 group does not have bits 0 to 2 and 5 to 7 FFB5 O X FFB6 A A FFBC A A FFBF X X FFC2 FFC3 X X FFC7 X X FFC8 O X The H8 3814 group does not have bit 5 FFC9 O X The H8 3814 group does not have bits 2 and 5 FFCA O X The H8 3814 group does not have bits 3 to 7 FFCD FFCE xX X FFDO O X The H8 3814 group does not have bits 2 to 7 FFD1 O X The H8 3814 group does not have bits 6 and 7 FFD2 O X The H8 3814 group does not have bits 0 to 7 FFD3 X X FFD4 A A Note O indicates the same specifications as the actual MCU X indicates that a register that does not exist in the actual MCU can be accessed in the emulator A indicates that the initial value of the register differs between the actual MCU and the emulator 431 RENESAS Table 8 20 Differences in I O Registers cont MCU Group 1 0 Address H8 3834 Group H8 3814 Group Note FFD6 to FFDD A FFE4 to FFED a FFEE FFEF X X FFF4 O X The H8 3814 group does not have bits 0 1 and 5 FFF5 X X FFF7 O X The H8 3814 group does not have bits 0 1 and 5 FFF8 X X FFFA to FFFF X X Note O indicates the same specifications as the actual MCU X indicates
2. Phase X Input Files Phase X Output Files Figure 3 1 Build Process 39 RENESAS The High performance Embedded Workshop provides the ability to change this build process via its Build Phases dialog which can be accessed via the Options gt Build Phases figure 3 2 On the left hand side are the phases that are defined in the current project Figure 3 2 shows a standard set of build phases The remainder of this chapter details the various functions that the Build Phases dialog provides Build Phases MISH C C Library Generator MISH C C Compiler HEGYE Move Up Move Down Figure 3 2 Build Phases Dialog 40 RENESAS 3 2 Creating a Custom Build Phase If you want to execute another tool before during or after a standard build process then this can be achieved by creating your own i e custom build phase Select Options gt Build Phases to invoke the Build Phases dialog figure 3 2 and then click the Add button This will invoke the new build phase wizard dialog figure 3 3a The first step as shown in figure 3 3a asks whether you want to create an entirely new phase or whether you want to add a system phase A system phase is a ready made phase which is already defined within the toolchain you are using e g compiler assembler linker librarian etc or a utility phase e g file copy complexity analyzer etc The Add an exis
3. Figure 3 15 Add Dependent File Dialog gt To modify a dependent file 1 Select the dependent file that you would like to modify 2 Click Modify The Modify Dependent File dialog which is the same as figure 3 15 except the title will be invoked 3 Modify the fields as required and then click the OK button to add the modified entry back to the list gt To remove a dependent file 1 Select the dependent file that you would like to remove 2 Click the Remove button 54 RENESAS 3 5 File Mappings By default the files input to a phase are only taken from the project i e all project files of the type specified in the Select input file group drop down list on the New Build Phase dialog figure 3 3b If you would like a phase to take files output from a previous phase i e intermediate files then you must define this in the File Mappings tab of the Build Phases dialog figure 3 16 Build Phases Build Order Build File Order File Mappings Intermediate file mappings for build Source Destination _ SH Assembler OptLinker Object file SH C C Compiler SH Assembler Assembly source file Modify SH C C Compiler OptLinker Object file SH C C Library Generator OptLinker Library file Cancel Figure 3 16 Build Phases Dialog File Mappings Tab 55 RENESAS A file mapping states that you would like the HEW to pass output fi
4. 219 4 3 1 Creating a New File 4 3 2 Saving a File 73 4 3 3 Saving all Files 4 3 4 Opening a File 4 3 5 Closing Files 74 Editing a File we eee 75 Searching and Navigating through Files 76 4 5 1 Finding Text 76 4 5 2 Finding Text in Multiple Files 4 5 3 Replacing Text 78 4 5 4 Jumping to a Specified Line Bookmarks cece eee 80 Printing a File Configuring Text Layout 81 ABV PASS SCtUp ENE EE E 81 48 2 Changing Tabs icice scc etssdivesesecsstodecsivoucseosctecssanti cosnacceressensteessceonessvsestersoncaduroseney 83 48 3 Auto Indentation c2 ccscesrencscenpseoncersseotsassnessendoersseoesnessennbapnsenestonguavnesncustsqencaseenss 84 PLIGG Say Window ee ose crssyszecas arab I ETE TTE TEO 85 Coni SUTIN TEXiiyar ii irr AE E TES OTE sees ovasshhs cotsteynipveds engi eesayssecs 86 4 10 1 Changing the Editor Fontc 3 cj cisisscseacosessrscosescnscstessasesesstessscsspenssescbcovteekieisvactes 86 Syntax COMMING ieiesiesiesducsaldtedess eccesssuecivesetoneesely oveveardocsseadesesweensessweedzssvoesdassvenleceisoee 87 PE GMPV ALCS ss sicisnssciwssessssnserzsosnoarzsssvonrsussnovessovrouesea tobaestgueaaetesdsvsetaessvestenteoersoodesersensertecssans s 89 4 13 4 14 5 1 5 2 5 3 5 4 5 5 5 6 5 7 5 8 5 9 6 1 6 2 6 3 6 4 6 5 6 6 6 7 6 8 6 9 8 2 8 3 4 12 1 Defining a Template 4 12 2 Deleting a Template ji iicisscssnssezssicsseccossssessntcdeesssesieccese
5. Select Groups Assembly source file Binary file C header file C list file C source file C header file C list file CPU information file Expanded assembly source file Figure 3 3c Modify multiple input file groups Once this choice has been made the input file group selection is displayed as Multiple Groups This dialog allows the user to choose multiple input file groups for the custom phase being added to the project To select a file group check the box next to the file groups name One or more file groups can be selected in this dialog 42 RENESAS The third step figure 3 3d requests the fundamental information about the new build phase Enter the name of the phase into the Phase name field Enter the location of the program file into the Command field do not insert any command line options as these options are specified via the Options menu of the HEW menu bar Specify the default options for the phase i e what options you would like new files to take when added to the project into the Default options field If you have a preferred directory in which you would like this program to run from i e where you want the current working directory to be set to before the tool is executed then enter it into the Initial directory field New Build Phase Step 3 of 4 Figure 3 3d New Build Ph
6. c hew workspace project a configuration named debug has a configuration directory located at c new workspace project debug HEW EXE is installed in c hew a HRF file of a toolchain i e compiler assembler linker is located at c hew toolchain hitachi sh 5 11 This is referred to as TCINSTALL on the option setting dialogs of the Options menu and as TOOLDIR on the Tools Administration dialog the Windows operating system is installed in c Windows and the Windows system directory is c Windows System a version control executable path is v vc win32 ss exe a user name and its password to login the version control system are JHARK and 214436 respectively COMMENT is specified in a command line to the version control executable and c project is mapped to x vc project on the Projects tab of the Version Control Setup dialog which is invoked via Tools gt Version Control gt Configure an error of compiler or assembler occurred at line 12 446 RENESAS Note Not all of the placeholders are relevant in every field For example the LINE placeholder has no meaning when specifying a dependent files location USERNAME PASSWORD VCDIR and COMMENT placeholders are acceptable only in version control If you enter a placeholder into an edit field where it is not acceptable you might be informed C 4 Placehol
7. Debug Search Reset Templates Bookmarks Standard Version Control Map Difference Debug Run SKK Toolbar name Editor Figure 6 1 Customize Dialog Toolbars Tab gt To create a new toolbar 1 Select Tools gt Customize The dialog shown in figure 6 1 will be displayed 2 Click the New button The dialog shown in figure 6 2 will be displayed 3 Enter the name of the new toolbar into the Toolbar name field 4 Click OK to create the new toolbar New Toolbar Toolbar name M yToolbad Figure 6 2 New Toolbar Dialog 113 RENESAS When a new toolbar is created it will appear undocked i e floating and empty To add buttons to a toolbar 1 Select Tools gt Customize The dialog shown in figure 6 1 will be displayed Select the Commands tab see figure 6 3 2 Browse the available buttons by selecting the button categories from the Categories list Select a button from the Buttons area to display information on its operation 3 Click and drag a button from the dialog onto the toolbar Customize Figure 6 3 Customize Dialog Commands Tab 114 RENESAS To remove buttons from a toolbar 1 Select Tools gt Customize The dialog shown in figure 6 1 will be displayed Select the Commands tab see figure 6 3 2 Click and drag a button from the toolbar
8. s ssssssssssssesesessrererersrersrererersrerererernrsrenene 35 2 12 Removing a Project from a Workspace 2 13 Loading unloading a Project into from a Workspace s essssssssssssssssssrsrsrsrsrsrsrersrsessessee 36 2 14 Relative projects paths in the workspace esesssesssssesssersssssrsssrsrsrnrsrererererersrrsrenrenee 37 215 3 3 1 3 2 3 3 3 4 3 5 3 6 3 7 3 8 3 9 3 10 3 11 3 12 4 1 4 2 4 3 44 4 5 4 6 4 7 4 8 4 9 4 10 4 11 4 12 iv User foldets im the workspace ccsisciecicstsussccstsievidssessiatasetsvasevers acces TENE er ENCES 38 Advanced Build Features eeeeeeeeeeeseereerisrreririrrisriereerrresre 39 The Build Process Revisited css ccsesisiscsetcevessensoscsnines cossonceroscsnebeesssnsbaesssasnerdonectsaveenwees 39 Sled Whatisa Build sis cccstsscsseseeccsseseeisscnsentevsrssvactantersstoosesuvenssssateceehessenssnencecaveenulte 39 Creating a Custom Build Phase 0 ec cceceseseeeeseesesseseeesceeesesaeseeseseseeaeeessseesesaseeeaaae 41 Ordering Boild M oda E AA E A TE 45 Jal Build Phase Order anisa EE Te E E O E E ES 46 3 3 2 Build File Phase Order issccasvescccovsedsoassassssnsnessssccvacssneseresbacssrcediessossscosseesteonveatte 49 Setting Custom Build Phase Options 0 0 cece cece cece eeecseeeeeesseesaeeeesesaeeeeseeeeseeagee 50 SAD Opuons Tab OAE E 51 34 2 Output Files Tab c cc ssscsccersnesiceestoncsennassdeavsesnsseone
9. Indicates that a regular expression or subexpression is anchored at the beginning of the input string For example ab matches ab and abc but not cab Recall that is treated differently in bracket expressions 441 RENESAS Table B 1 Regular Expression Characters cont Character Meaning Indicates that a regular expression or subexpression is anchored at the end of the input string For example ab matches ab and cab but not abc Denotes alternation or the creation of a set of equally valid alternate expressions or subexpressions each of which can be matched For example ab cd matches ab or cd Matches any code unit except for those which indicate the logical end of a line 442 RENESAS Appendix C Placeholders This appendix describes how to use the placeholders a feature provided by several of the HEW components C 1 What is a Placeholder A placeholder is a special string inserted into text which is replaced at some subsequent time for the actual value For example one of the HEW placeholders is FULLFILE which represents a file with a full path Suppose that you have an editor in c myedit myeditor exe which can take the file to edit as a parameter When invoking the editor the following shortcut could be made e g c myedit myeditor exe c files file1 c if you wanted to open FILE1 C from the directory c files However what happens if you want the HEW to open any file through this editor T
10. i PHAR 0x0000202a t oxoo00202 a 3 s 3 oap 0x00002 106 atjegap t else break Eh ees Debug Rnd rien fj verson Corral FE ooN etna do Readvwte 6287 g mo NM Figure 1 2 HEW Main Window There are three main windows the workspace window the editor window and the output window The workspace window shows the projects and files which are currently in the workspace the editor window provides file viewing and editing facilities and the output window shows the results of a various processes e g build version control commands and so on 1 2 1 The Title Bar The title bar displays the name of current activate project and file It also contains the standard minimize maximize and close buttons Click the minimize button to minimize the HEW on the Windows task bar Click the maximize button to force HEW to fill the screen Click the close button to close the HEW this has the same effect as selecting File gt Exit or pressing ALT F4 1 2 2 The Menu Bar The menu bar contains eleven menus File Edit View Project Options Build Debug Memory Tools Window and Help All of the menu options are grouped logically under these headings For instance if you wanted to open a file then the file menu is where you will find the right menu option if you wanted to set up a tool then the tools menu is the correct selection The following sections will cover the functions of the various menu options
11. Figure 5 20 Format Dialog Box To display and edit memory in different widths use the Display Data As combo box For example choose the Byte option and the display will be updated to show the memory area as individual bytes 238 RENESAS The data can be converted into different formats as shown in the Value column The list of formats depends on the data selection To change the number of bytes displayed on one line use the Bytes Count For One Line drop down list For example choose the 8 Byte option and the display will be updated to show the 8 byte data on one line 5 5 3 Splitting Up the Window Display To vertically divide the Memory window display into two select Split from the popup menu and move the split up bar 5 5 4 Viewing a Different Memory Area To change the memory area displayed in the Memory window use the scroll bars To quickly look at a new address use the Format dialog box This can be opened by choosing Format from the popup menu Enter the new address value and click the OK button or press the Enter key The dialog box closes and the Memory window display is updated with the data at the new address When an overloaded function or a class name is entered the Select Function dialog box opens for you to select a function 5 5 5 Modifying the Memory Contents The memory contents can be modified via the Edit Memory dialog box Move the cursor on the memory unit according
12. Statist m Statistic Analysis Result Condition Amount PTR Figure 6 54 Statistic Dialog Box 375 RENESAS 4 Select R W in the Item combo box and enter WR in the Start edit box After that click the New button R W WR is now displayed in the Condition column of the Result list box r Statistic Analysis Default Range ltem RAV E Start wr Result End 2 aoa aw Result Condition Amont PTR Figure 6 55 Statistic Dialog Box New Condition 376 RENESAS 5 Then select Area from the Item combo box and enter RAM in the Start edit box After that click the Add button the new condition is now added to the R W WR display in the Condition column of the Result list box so that it now shows R W WR amp Area RAM This completes setting of the condition r Statistic Analysis Default Range ltem fArea 7 New Start RAM Result End E Beut Clear Result e R W WR amp Area RAM Figure 6 56 Statistic Dialog Box Condition Added 377 RENESAS 6 To start statistical analysis of the specified condition press the Result button The number of write operations that satisfy the condition and the PTR values will be displayed rm Statistic Analysis Default Range ltem Area bi Start RAM End Result RAW WR amp Ar
13. tr Figure 5 2 HRF File Location and Registration In order to use a component with HEW it must first be registered The Tools Administration dialog figure 5 1 shows all currently registered components To access it ensure no workspaces are open and then select Tools gt Administration If you attempt to access tools administration when there is a workspace open the tools administration dialog is opened but cannot be modified When HEW is installed by default any new tools are automatically registered HEW stores tool information in a tool database file By default this is created in the HEW application directory however if you are working in a network environment this directory may be set to another location It is possible to change the tool directory location gt To change the tools location 1 Select Tools gt Administration 2 Click the Modify button for the Current HEW tools database location field 3 Select the directory under which the new tool is located then click OK 4 This will switch the directory and change the tool location to the new directory It will be necessary to scan for any new tools that may be in this location this is achieved by using the scan disk or register tool functionality 96 RENESAS 5 3 Registering Components The HEW will automatically attempt to register any n
14. 1 Part of the reserved area specified in each MCU s memory map can be used as an external address area when the RAME bit of the SYSCR is cleared to 0 On Board or Emulator can be specified for this area with the Configuration settings 2 If the reserved area other than that described in item 1 above is used the operation in the actual MCU cannot be guaranteed e Use of Internal RAM Area as External Memory The internal RAM area cannot be used as an external address area even when the RAME bit of the SYSCR is cleared to 0 User Program Execution by the Go Reset Command When the user program is executed by the Go Reset command a reset signal is input for about 16 to 17 system clock 0 cycles to the evaluation chip from the emulator For the execution time measurement result the time for reset signal input is added 424 RENESAS 8 2 3 Notes on Use of the H8 350 Group Evaluation Chip Set HS3508EVI60H User Program Execution by the Go Reset Command When the user program is executed by the Go Reset command a reset signal is input for about 16 to 17 system clock cycles to the evaluation chip from the emulator For the execution time measurement result the time for reset signal input is added 8 2 4 Notes on Use of the H8 338 H8 329 Group Evaluation Chip Set HS3398EVI60H e T O Register Differences Between Actual MCU and Emulator In the E6000H emulator one evaluation chip emulates several types of MCU Therefore
15. 3 5 Online Help An online help explains the usage of each function or the command syntax that can be entered from the command line window Select Emulator Help from the Help menu to view the emulator help 198 RENESAS Section 4 Preparation before Use 4 1 Workspaces Projects and Files Just as a word processor allows you to create and modify documents HEW allows you to create and modify workspaces A workspace can be thought of as a container of projects and similarly a project can be thought of as a container of project files Thus each workspace contains one or more projects and each project contains one or more files Figure 4 1 illustrates this graphically PROJECT RKSPACE wo PROJECT Figure 4 1 Workspaces Projects and Files Workspaces allow you to group related projects together For example you may have an application that needs to be built for different processors or you may be developing an application and library at the same time Projects can also be linked hierarchically within a workspace which means that when one project is built all of its child projects are built first We need to add a project to a workspace and then add files to that project before we can actually do anything 199 RENESAS 4 2 Method for Activating HEW To activate the HEW follow the procedure listed below 1 Connect the emulator to the host computer 2 Connec
16. 5 15 6 Setting PC Breakpoints It is possible to display modify and add PC breakpoints on the Breakpoint sheet Program Enable PC H 0000105C Tutorial cpp 42 Program Enable PC H 000010CE Tutorial cpp 53 Program Enable PC H 00001772 Breakpoint Figure 5 58 Event Window Breakpoint Sheet 281 RENESAS Select Add or the PC breakpoint displayed in this window and then select Edit from the popup menu to display the Breakpoint Event Properties dialog box Breakpoint Event Properties General Type Address C DonitCare Address Range Address Lo DE H 00000000 Address Hi J Outside Range Data Compare Direction 4 F Compare Use Mask C Read Yalue Ho f write Bute C Word Either Figure 5 59 Breakpoint Event Properties Dialog Box Setting a PC Break In this dialog box select the address condition to set PC breakpoints Type Select the type of a breakpoint Note that the Breakpoint Event Properties dialog box is used for setting PC breakpoints and event points Selecting a particular type of breakpoint enables or disables other pages and parts of the dialog according to the options available to that type of breakpoint PC Break Only a single address with a program fetch can be selected Other options are invalid Event Set conditions in detail with other options on this page or on the Bus Area Signa
17. A typical project will contain dependencies between files for example one C file may include one or more header files In complex projects source files will include or depend upon others and this can quickly become difficult to manage However the HEW provides a dependency scanning mechanism whereby all files in a project are checked for dependencies Once complete the project window will display an up to date list with all the project file dependencies gt To update a project s dependencies Select Build gt Update All Dependencies or click the right mouse button on a project icon in the Projects tab of the Workspace window and select Update All Dependencies from the pop up menu Initially the dependencies for all files are contained within the Dependencies folder figure 2 21 i 2 8 Configuring the Workspace Window If you click the right mouse button anywhere inside the Projects tab of the Workspace window a pop up menu will be invoked Select the Configure View menu option to modify the way in which information is displayed The following four sections detail the effect of each option on the Configure View dialog 2 8 1 Show Dependencies under Each File If you select Show dependencies under each file the dependent files are shown under the including source file as a flat structure i e the files themselves become folders figure 2 21 ii If this option is not s
18. Build Editor Workspace Confirmation Network rm Errors and warnings I Stop build if the number of errors exceeds 0 V Stop build if the number of warnings exceeds 10 Show I Command line J Initial directory I Environment J Mark out of date files m Makefile build Command excluding parameters S HEWDIF hmake exe gt Browse I Use makefile build system Make file opt ions eee Makefile path WORKSPDIR make PROJECT NAME mak Browse Generate makefile before build commences Figure 3 18 Options Dialog Build Tab Select Tools gt Options to invoke the dialog If you want to stop the build when a certain number of errors are exceeded then set the Stop build if the no of errors exceed check box and then specify the error count limit in the edit field to the right If you want to stop the build when a certain number of warnings are exceeded then set the Stop build if the no of warnings exceed check box and then specify the warning count limit in the edit field to the right Note Irrespective of what these controls are set to the build will always halt if a fatal error is encountered In addition to specifying error and warning count limits the Build tab also allows you to request that the command line environment and initial directory of each execution should be displayed
19. Cancel all configurations in the currently active project all configurations in all loaded projects in the current workspace Makefile format HMake J Use static sub command files IV Scan dependencies whilst building make file Figure 3 23 Generate Makefile Dialog 63 RENESAS The HEW will create a subdirectory make within the current workspace directory and then generate the makefile into it It is named after the selection with a mak extension for example the current project and configuration e g project_debug mak The executable HMAKE EXE located in the HEW installation directory is provided for you to execute the makefiles generated by the HEW It is not intended to execute makefiles which have been user modified For further details on HMAKE refer to Appendix F HMAKE User Guide gt To execute a makefile 1 Open a command window and change to the make directory where the makefile was generated 2 Execute HMAKE Its command line is HMAKE EXE lt makefile gt Note The degree portability of a generated makefile is entirely dependent upon how portable the project itself is For example any compiler options which include full paths to an output directory or include file directory will mean that when given to another user with a different installation the build will probably fail In general use placeholders wherever possible using a full specific path should be avoide
20. E main Cancel Figure 5 10 Set Address Dialog Box Enter the address in the Address edit box and either click on the OK button or press the Enter key A label name can also be specified as the address The Disassembly window will be updated to show the code at the new address When an overloaded function or a class name is entered the Select Function dialog box opens for you to select a function For details refer to section 5 13 3 Supporting Duplicate Labels 5 2 6 Viewing the Current Program Counter Address Wherever you can enter an address or value into the HEW you can also enter an expression If you enter a register name prefixed by the hash character the contents of that register will be used as the value in the expression Therefore if you open the Set Address dialog box and enter the expression pc the Source or Disassembly window will display the current PC address It also allows the offset of the current PC to be displayed by entering an expression with the PC register plus an offset e g PC 0x100 230 RENESAS 5 3 Debugging with the Command Line Interface Use the Command Line window to enter text based commands instead of window menus and commands 5 3 1 Opening the Command Line Window Choose View gt Command Line or click the Command Line toolbar button to open the Command Line window Command Line no batch File no log File Figure 5 11 Command Line Window
21. H8S 2655 Series I O Register Definitions File Modules BaseAddress 0 Module Module1 Power_Down_Mode_Registers definition Module2 DMA_Channel_Common Module3 DMA_Channel_0 Comment Module42 Bus_Controller Module43 System_Control Module44 Interrupt_Controller DMA_Channel_Common DMAWER Oxffff00 B A DMATCR Oxffff01 B A DMACROA Oxffff02 B A DMACROB Oxffff03 B A DMACR1A Oxffff04 B A DMACR1B 0xffff05 B A DMABCRH Oxffff06 B A DMABCRL 0Xffff07 B A Register definition DMA_Channel_0 MAROAH OxfffeeO W A MAROAL Oxfffee2 W A IOAROA Oxfffee4 W A ETCROA Oxfffee6 W A MAROBH Oxfffee8 W A MAROBL Oxfffeea W A IOAROB Oxfffeec W A ETCROB Oxfffeee W A Address Size Absolute address flag Register name 450 RENESAS D 2 File format Bit Field Supported Each module name must be defined in the Modules definition section and the numbering of each module must be sequential Each module corresponds to a register definition section and within the section each entry defines an I O register The user must define File Version 2 at the start of the section It means that this I O register file is described with the version that supports the bit field The BaseAddress definition is for devices where the location of I O registers moves in the address space depending on the CPU mode In this case the BaseAddress value is the base address of the I O registers in one specific mode and the addresses
22. IRQ7 to IRQ0 Select IRQ input conditions not available when Don t care has been checked Don t care Detects no selected IRQ input condition High The status of the IRQ input is high Low The status of the IRQ input is low 322 RENESAS 9 Timestamp page Specify the time stamp value for bus cycles The specification is not available when a time stamp is acquired Trace Filter x General Aima Data RAW Timestamp Setting Point Range Cancel Apply Figure 5 93 Trace Filter Dialog Box Timestamp Page Don t care Detects no time stamp value when this box is checked Setting Detects the specified time stamp value Point Specifies a single time stamp not available when Don t care has been checked Range Specifies a time stamp range not available when Don t care has been checked From Enter a single time stamp value or the minimum value of the time stamp range The format is as follows hour h minute min second s millisecond ms microsecond us nanosecond ns Not available when Don t care has been checked To Enter the maximum value of the time stamp range The format is as follows hour h minute min second s millisecond ms microsecond us nanosecond ns Only available when Range has been selected Note Along with setting the time stamp range the minimum and maximum time stamp values can be set in the From and To op
23. Selecting Options gt Emulator gt Memory Resource or clicking the Emulator Memory Resource toolbar button opens the Memory Mapping dialog box Memory Mapping System Memory Resources Erm To Mapping Add SIMM Module Tears Carag IP cr glace 1MB SIMM fitted ser Guarde dodifu Ram Bases OOFFB000 OOFFEFBF On Chip Read write _Mosity _ D not used OOFFEFCO OOFFF7FF User Guarded 1 not used OOFFFS800 OOFFFFFF On Chip Read write Reset 2 not used 3 not used Close Target Device Configuration 00000000 OOO3FFFF Internal ROM OOFFBO00 OOFFEFBF Internal RAM DOFFF800 OOFFFF3F Internal 10 OOFFFF60 OOFFFFBF Internal 10 OOFFFFCO OOFFFFFF Internal RAM Figure 5 4 Memory Mapping Dialog Box This dialog box displays the current memory map The E6000 H8S or H8 300 series supports four blocks of user memory These can be 256 kbyte or 1 Mbyte each depending on the SIMM fitted Each block can be placed in the address space on a 256 kbyte or 1 Mbyte boundary The memory mapping has a granularity of H 40 D 64 byte Each 64 byte block can be set to the internal emulation or external memory and can be guarded access prohibited write protected or read write The H8 300 series E6000 generally incorporates an emulation memory In the memory map the memory can be set as an internal emulation or external guarded access prohibited write protected or read wri
24. The High performance Embedded Workshop also has the ability to define custom placeholders This means you can enter your own custom placeholder definition and decide upon its directory value Once defined this placeholder becomes available throughout the rest of the HEW system The placeholders can be defined on an application wide level so the placeholders are available to all workspaces and projects that use the HEW The other method of defining the placeholders is using the workspace wide custom placeholders this means the placeholders can only be used in the current workspace This list is only available when you have a workspace open Customize Toolbars Commands Menu Placeholders Debugger Log Help Application wide custom placeholders Placeholder Directory Add Mo dify a3 Remove Workspace wide custom placeholders Placeholder Directoy Add Modify Remove Figure 6 14 Customize Dialog Placeholder Tab 125 RENESAS gt To add a custom placeholder 1 Select Tools gt Customize The dialog shown in figure 6 1 will be displayed Select the Placeholders tab figure 6 14 2 Choose whether you need to use an Application wide custom placeholder or Workspace wide custom placeholder Click Add on the adjacent button to the list you require 3 The dialog add New Custom Placeholder dialog is displayed figure 6 15 4 In the fiel
25. 0x00002012 for i O i lt 10 i 0x0000201a j rand 0x00002022 if j lt Of ynnnnen A 4 ie of gt e demo c Version Control g Build desktop Read write 29 86 4 Figure 6 17 Desktop button In this example the selected desktop is number 1 This has been given the name Build by the user Its description is seen in the edit box to the right on the buttons Clicking a different desktop selects that button and changes the description control Once clicked HEW then loads the windows in the new configurations style Another method of changing the desktop configuration is as follows 1 Click the Window gt Virtual Desktop menu item Select is cascaded menu 2 Then select the desktop configuration you wish to view on this menu The selected item is ticked 3 Select the menu item and the setup is altered automatically Note If the configuration has never been used then HEW will copy the current window configuration to the new configuration You can then modify this setup When you save the session it will store the positions of your windows for each window configuration 128 RENESAS 7 Version Control The High performance Embedded Workshop provides facilities for connecting to a version control tool Some of the reasons why version control tools are used with a project are e To maintain the integrity of a project e To store each stage of a project e To enable different users to c
26. 9 2 4 Checking In a Writable Copy of a File into Version Control Visual SourceSafe protects your source files and ensures that only one user can have a writable copy of a controlled file at any one time The check out operation takes a writable copy of the file from Visual SourceSafe and places it on your local drive Once a file is checked out it is edited and then checked back in so that the edits can be made available to other users gt To check in edits made to a file or files in Visual SourceSafe 1 Select the file s upon which you would like to check back into Visual SourceSafe You may also select a file folder project folder a workspace folder or combination thereof 2 Click the Check In Files toolbar button 2 or select the Tools gt Version Control gt Check In menu option 9 2 5 Undoing a Check Out Operation Visual SourceSafe protects your source files and ensures that only one user can have a writable copy of a controlled file at any one time The check out operation takes a writable copy of the file from Visual SourceSafe and places it on your local drive Once a file is checked out it is edited and then checked back in so that the edits can be made available to other users However if the check out operation was carried out by mistake or perhaps is no longer required then the operation can be undone gt To undo a check out of a file or files from Visual SourceSafe 1 Select the file s upon which you would like to
27. A TiN Dort N or gt Figure 5 29 IO Window ka HHHH HAMMAM 5 6 2 Expanding the I O Register Display To display the names addresses and values of the I O registers click the mark at the left of the module name or select the module name by clicking on it or using the cursor keys and press the gt key The module display will expand to show the individual registers of that peripheral module and their names addresses and values Clicking the mark at the left of the expanded module name or pressing the lt key will close the I O register display For a display in the bit level click the mark at the left of the register name or select the register name by clicking on it or using the cursor keys and press the gt key The register display will expand to show the names of register bits and values Clicking the mark at the left of the expanded register name or pressing the lt key will close the register bits display 246 RENESAS 5 6 3 Manually loading an IO file To manually load an IO file right click on the IO window and select the Load IO file menu item on the IO window pop up A standard file browser is invoked Simply select the file you require to load and click OK The IO file will be loaded into the window 5 6 4 Modifying the I O Register Contents To edit the value in an I O register double click or press the Enter key on
28. ANIMAL C Classes C navigation category title Project name Class name amp CGreatWhite amp CGreatwhitef FeedTheShark CCrocodile myGoat amp FeedTheShark CFish myFishyFood FeedTheShark char pszO therT ype FeedTheShark CHorse myHorseyF FeedTheShark CPerson myPersonl FeedTheShark void GetClassName void sa m_nDangerous e m naws E m_nSea E m_strName Globals amp heap_area amp _siptr amp be bs amp brk amp INT Vectors ha a asl wf Project Templates Navigation Class Member functions Protected member variable Private member variable Global variables and functions folder Figure 13 4 C Navigation information The C navigation view uses a number of icons to describe the type of function or variable the icon belongs too These are listed in the table below 171 RENESAS Public member function Protected member function Public member variable Protected member variable Private member variable Figure 13 5 C Navigation Icons The navigation view allows you to move around your source code quickly and efficiently Double clicking on a navigation item by default jumps you to the associated navigation items definition Normally the definition is found in the source file and the declaration is found in the
29. Event Sequencing dialog box This dialog box allows the user to define which events are triggered by other events If this dialog box is accessed directly or indirectly from Trace Acquisition only those events assigned to the trace subsystem are displayed If accessed from the Eventpoint window only the breakpoint or timer events are shown Is Aimed By J No occurrence of Is Reset By The following events Cancel F 1 E W088 address P 2 E H 105C address count D 10 P 3 E H 10F6 address count D 2 I 4 E H 10FC address F undefined or unavailable F undefined or ur J undefined orur F undefined or ur Figure 5 65 Event Sequencing Dialog Box Event Selects an event point to be set Is Armed By Arms the selected event Is Reset By Resets the selected event No occurrence of Arms an event when the set of events being selected does not occur only available when Is Armed By has been selected The test of conditions on event points is started with the execution of the user program The conditions on event points have not been satisfied immediately after the execution of the user program is started Satisfaction of the condition on an event point allows a transition of the state to that where the condition is satisfied 289 RENESAS The state where the condition is satisfied is retained until the user program is stopped or the event point is reset When the condition on
30. 1 3 1 4 Emulator External Dimensions and Mass Section 2 Preparation before Use 2 1 Emulator Preparatton wissisiiesscxcssssscscsveisenconsanesccversincensabenccsetcasconeadandavaidaveesdaascsseuabacenseieeis 2 2 Installing Emulator s Software 2 3 Connecting to the User System 2 3 1 Example of Connecting the User System Interface Cable Head vi RENESAS tothe User Sy Stenis sss ceccicecsetelecciutenssdovbelescducutanguvesletdawoasenesseacsedisouesvowesaleodeosese 184 2 3 2 Plugging the User System Interface Cable Body into the Emulator 000000 185 2 3 3 Plugging the User System Interface Cable Body into the Cable Head 185 ZA POWT SUPPLY wise eas acess inane la aisha iomincuaienvaininaccomaaniats 186 2AT SAC AdaMeriasischvicsisscetsssdevateners ens tesierrs EAAS EESTIT EEES 186 Pr PAE o e N E E AE E ON E A TA 186 2 4 3 Power Supply Monitor Circuit cece cece cess cecescseceeeecsesesseseeesseeeseesaeees 186 2 3 Hardware Interface srinsicssvetatssivsastriwesslucslessescasssetecnsoecesousetslsb vent eav eve vosi Noas Enei KEE eres 186 2 5 1 Signal Protection on the emulator s ssssssssssssesessereresessressrsrsrnrerersrersrersrersrensn 186 2 5 2 User System Interface Circuits eee eeee cee ceeeecseeessesseesaeeeesetaeeeeseeaes 186 25 3 ClOCk Oscillator aaee 187 2 5 4 External Probe Trigger Output ccc cece ceeceecsceecaeeecseseeeesseeeeseseseeaeees 187 2 3 3 Voltage Follower Cu
31. 8 3 4 Specifying a User Name and Password ccece cece cess eeeeseeeeseceeeeeeeeeeeeaeee 146 S34 Controlling Brecution ce vcccicsscccekcevesssnessiscsucssuacsncssencseosdvassietsvacteeisveskessostehcosenevtesssucdee 148 8 4 1 Prompt before executing command eee eeee eee teeteeteteeeeeeeteeeeeaee 148 8 4 2 Runin DOS Window 8 4 3 Use forward slash as version contiol directory delimiter 148 8 5 Importing and exporting a Set up ssessssssssssssststsrststststseseseeseneserererereressenenenerereresenenes 149 9 Using Visual SourceSafe s jiiiainiiirininiaiiaiiiaa 151 9 1 Attaching Visual SourceSafe to a Workspace cece cseeeeeseseeetseeecsecseeeeeeeeeeaees 151 9 1 1 Selecting Visual SourceSafe ct cteetcssesseecssesesecessssesssssssensesesseoessseseenee 151 9 1 2 Adding files to Visual SourceSafe 00 eee eee eeee cece eseeeeeeeeeeesseeeeeesseeeeeeaes 152 9 2 Visual SourceSafe commands sienrsnerssissorsrossroreresivirsirssvesstodvtsib tosk tbtt tiredis daro rva renki 153 9 2 1 Removing a File from Version Control sssssssesssesssssssesssssssssrsrnrsrnesrnssenssreese 153 9 2 2 Getting a Read Only Copy of a File from Version Control eee 153 9 2 3 Checking Out a Writable Copy of a File from Version Control 154 9 2 4 Checking In a Writable Copy of a File into Version Control 154 9 2 5 Undoing a Check Out Operation eee ese ceeeeceeeeeeteeeesseeeeeeseeeeaeeas 154 92 6 Viewing the Status O
32. Breakpoint Event Properties Dialog Box Signals Page Probe4 Detects the status of the input probe signal 4 High Detects the high level of the input probe signal Low Detects the low level of the input probe signal Don t care The status of the input probe signal is not detected Probe3 Detects the status of the input probe signal 3 High Detects the high level of the input probe signal Low Detects the low level of the input probe signal Don t care The status of the input probe signal is not detected Probe2 Detects the status of the input probe signal 2 High Detects the high level of the input probe signal Low Detects the low level of the input probe signal Don t care The status of the input probe signal is not detected 287 RENESAS Probe1 Detects the status of the input probe signal 1 High Detects the high level of the input probe signal Low Detects the low level of the input probe signal Don t care The status of the input probe signal is not detected 4 Action page Use this page to decide what action the emulator takes when the defined event occurs Breakpoint Event Properties General Bus Area Signals Action pe id T Start Timer T Stop Timer Delay after detection before break occurs oo bus cycles Required number of event occurrences a Configure Sequence T Enable Sequencing Figure 5 64 Breakpoint Event Properties Dialog
33. CPU Prefetch CPU_PREFETCH CPU prefetch cycles high speed mode CPU Medium CPU_MEDIUM_PREFETCH CPU prefetch cycles medium speed mode Prefetch CPU Medium Data CPU_MEDIUM_DATA CPU data access cycles medium speed mode Sub Active Prefetch SUB_ACTIVE_PREFETCH Subactive prefetch cycles Sub Active Data SUB_ACTIVE_DATA Subactive data access cycles Table 8 10 Area Signals Acquired by the Emulator H8 300 Series Area Trace Display Area Description On chip ROM IN ROM Internal ROM On chip RAM IN RAM Internal RAM On chip I O 1 0 VO Expansion Table 8 11 Area Signals Acquired by the Emulator H8 300L Series Area Trace Display Area Description On chip ROM IN ROM Internal ROM On chip RAM IN RAM Internal RAM On chip I O 1 0 VO LCD MTG RAM LCD MTG RAM Note The signals to indicate bus states and areas are used to set the Bus Area condition of the event point They can also be acquired as the trace information The bus state signals are also used to set the condition not to acquire the trace Suppress option 421 RENESAS 8 1 8 Monitoring Function This emulator does not incorporate the bus monitoring circuit To use the monitoring function the bus monitor board HS6000EBRO1H is required 8 1 9 Trigger Points This emulator does not incorporate the bus monitoring circuit Connecting the bus monitor board HS6000EBRO1H allows use of trigger points that can be set on the
34. Check the appropriate check boxes as necessary 57 RENESAS 3 7 Logging Build Output If you would like to write the results of each build to file then invoke the Customize dialog by selecting Tools gt Customize and select the Log tab figure 3 19 Set the Generate log file check box and then enter the full path of the log file into the Path field or browse to it graphically by clicking the Browse button Customize BIGWSE Figure 3 19 Tools Customize Dialog Log Tab 58 RENESAS 3 8 Changing Toolchain Version If two or more versions of the same toolchain are registered in the HEW you can choose a version of the toolchain on the Change Toolchain Version dialog shown in Figure To invoke the dialog select Tools gt Change Toolchain Version Choose one of the versions from the Toolchain versions drop down list and click the OK button to enforce your choice Change Toolchain ersion s i 2 xi Toolchain name Hitachi SuperH RISC engine Current version 71 1 0 Cancel OPU Family SuperH RISC engine Information Toolchain Hitachi SuperH RISC engine Standard Toolchain version 801 0 id Toolchain build phases OptLinker 8 0 02 SH Assembler 6 0 00 SH C C Compiler 8 0 01 SH C C Library Generator 3 0 01 Figure 3 20 Change Toolchain Version Dialog To show information of toolchain components select a tool f
35. Column Status Column Target Device Configuration Displays memory mapping System Memory Resources Displays the memory resource of the emulator hardware Program Name Displays the program file name 418 RENESAS 2 Platform Sheet Selecting the Platform tab on the Status window displays this sheet Table 8 5 Platform Sheet Items Item Column Status Column Connected To Displays emulator name driver used CPU Displays the target MCU name Mode Displays the selected mode Clock source Displays the selected clock Subclock source Displays the selected sub clock Run status Displays the execution status Break The user program breaks Running The user program is running Cause of last break Displays the cause of the emulator stopped at a break If a program breaks in the sub active state SubActive will be displayed after the cause of the break Ready User program not executed immediately after starting the HEW User Break Break by the user PC Break Break by program breakpoint On Chip Break A Break by hardware PC Break Complex Event System Break by complex event system Stepping Completed Break by stepping completed Stepping Aborted Break by stepping aborted ROM Write Access Break Break by writing to ROM Write protect Access Break Break by writing to a read only memory Unused Area Access Break Break by accessing to a guarded memory Stack In I O Area Break by a stack in the I O are
36. Confirm password by retyping it below field versions of the password which you entered then you will be requested to type your password again Log in x User name HARK Cancel Password pe Confirm password by retyping it below xxxxxx Figure 8 14 Log in Dialog 147 RENESAS 8 4 Controlling Execution The General tab of the Version Control Setup dialog figure 8 13 allows you to control the way in which the version control tool is executed It also shows the full path to the current version control configuration file 8 4 1 Prompt before executing command If this check box is set then before any version control commands are executed a dialog is displayed figure 8 15 which lists all of the files involved in the operation Files may be deselected by clearing the associated check box Clicking OK will apply the command to each of the selected files Clicking Cancel will abort the operation History 21 x demo c c hew demo demo sbrk c c hew demo demo vecttbl sre c hew demo demo Figure 8 15 Command Prompt Dialog 8 4 2 Run in DOS Window By default the output of the version control commands is redirected to the Version Control tab of the Output window If you would rather run each command in a separate DOS window then set this check box 8 4 3 Use forward slash as version control directory delimite
37. Enter the directory in which you would like to search into the top field or browse to it graphically by clicking the Browse button 4 Check the Include subfolders check box if you would like to search the directory specified and all directories below it 5 Click the Start button to begin the search During the search the Start button will change to a Stop button Click the Stop button to halt the search at any time 6 The results of the search are shown in the Located Tools which can be uninstalled list Select a component and click Uninstall to uninstall a component 7 Click Exit to exit the dialog A component may only be uninstalled if it is not currently registered with the HEW If you attempt to uninstall a tool which is registered then the dialog shown in figure 5 9 will be displayed In such a case you must return to the Tools Administration dialog via Tools gt Administration unregister the tool and then invoke the tool uninstaller again 101 RENESAS High performance Embedded Workshop Figure 5 9 Unable to Uninstall Tool Tf a tool is not registered with the HEW then the dialog shown in figure 5 10 will be displayed when the Unregister button is clicked This confirmation dialog displays all of the files and folders that will be deleted If you are certain that these files and folders can be deleted then click the Yes button To abort
38. FFE6 A A The H8 3644 group does not have bits 3 to 5 FFE7 X X FFEA A A The H8 3644 group does not have bits 0 to 2 FFEB FFEC A A FFED A A The H8 3644 group does not have bits 1 to 3 FFEE A A The H8 3644 group does not have bits 3 to 5 FFF7 A A FFFA FFFB X X FFFE X X Note X indicates that a register that does not exist in the actual MCU can be accessed in the emulator Access to the Reserved Area A indicates that the initial value of the register differs between the actual MCU and the emulator The reserved area H FF80 to H FF9F is used by the emulator If this area is assigned to the emulation memory by the map setting operation cannot be guaranteed Do not use this area User Program Execution by the Go Reset Command When the user program is executed by the Go Reset command a reset signal is input for about 500 us to the evaluation chip from the emulator For the execution time measurement result the time for reset signal input is added RENESAS 437 438 RENESAS Appendix A Troubleshooting I have clicked the Stop Build button or selected Build gt Stop Build to abort a build but the build process has not stopped The HEW will stop the build after it has built the current file or executed the current single phase If the builder does not respond after a longer period of time you can select Build gt Terminate Current Tool which will attempt to forcibly terminate the current
39. PTR Address I Data R W Area Clock P NMI IRQ 0 Timestamp s L Timestamp Difference 00087 ffef80 0000 UR 0000h000min000s000ms744us375ns 0000h000min000s000ms000us000ns 00086 ffefs2 4lc6 UR 0000h000min000s000ms744us500ns 0000h000min000s000ms000us125ns 00085 ffers4 0000 UR 0000h000min000s000ms764us875ns 0000h000min000s000ms020us375ns 00084 ffef86 16 e UR 0000h000min000s000ms76Sus000ns 0000h000min000s000ms000us125ns 00083 ffef88 0000 WR 0000h000min000s000ms785us375ns 0000h000min000s000ms020us375ns 00082 ffef a 2781 WR 0000h000min000s000ms785us500ns 0000h000min000s000ms000us125ns 00081 ffef8c 0000 UR 0000h000min000s000ms80Sus875ns 0000h000min000s000ms020us375ns 00080 ffef8e 446b UR O00OhOQOmin000s000ms806us000ns 0000h000min000s000ms000us125ns 00079 ffef90 0000 UR 0000h000min000s000ms826us375ns 0000h000min000s000ms020us375ns 00078 ffef92 794b WR 0000h000min000s000ms826us500ns 0000h000min000s000ms000us125ns 00077 ffef94 0000 WR 0000h000min000s000ms846us875ns 0000h000min000s000ms020us375ns 00076 ffef96 l5fb UR 0000h000min000s000ms847us000ns 0000h000min000s000ms000us125ns 00075 ffef98 0000 UR 0000h000min000s000ms867us375ns 0000h000min000s000ms020us375ns 00074 ffef9a 59e2 UR 0000h000min000s000ms867us500ns 0000h000min000s000ms000us125ns NNn73_ ffefar nnn MR NNOOhHAA Omi nAonsNonNmsssIus87Sns OOO OhAo Omi noNnsnNnNmsN20n3375ns a Figure 6 53 Trace Window Displaying the Result If you have trouble viewing
40. RENESAS E Templates le F3 oolChain Templates Project Templates Figure 4 15 Templates view Any new templates which have been added to the HEW are displayed under the templates folder The toolchain templates folder is for templates which are read only and have been provided for use in the HEW system by the current toolchain Templates in this view can be dragged for insertion into an editor file It is also possible to drag an area of text from the editor into the templates folder for quick template creation Right clicking on this view displays a pop up so that you can quickly add a new template remove the current selection and edit the current selection 4 12 2 Deleting a Template gt To delete a template 1 Select Edit gt Templates gt Define Templates select Templates gt Define Templates from the local menu or click on the define template bookmark toolbar button Th The dialog shown in figure 4 14 will be displayed 2 Use the Template name drop down list to select the name of the template you wish to remove and then click the Remove button 3 Clicking OK saves the template changes and dismisses the dialog 4 12 3 Inserting a Template gt To insert a template 1 Select a template in the toolbar then click the insert template toolbar button T select Edit gt Templates gt Insert Template or select Templates gt Insert Template from the local menu The dia
41. Select the project type to be used Notes 1 When Demonstration is selected in the emulator note the followings The Demonstration is a program for the simulator attached to the H8S H8 300 compiler package To use the generated source file delete the Printf statement in the source file 206 RENESAS 3 Make the required setting for the toolchain When the setting has been completed the following dialog box is displayed 2 xi Miyyyy E6000 Emulator GPU 2000 Micox E6000 Emulator CPU 2600 Target type all Targets x lt Back Finish Cancel Figure 4 9 New Project Step 7 Dialog Box The target for the session file used when the HEW is activated must be selected here Check the box against the target platform and then click the Next button For details on the session file refer to section 4 4 Debug Sessions 207 RENESAS 4 Set the configuration file name The configuration file saves the state of HEW except for the emulator Target name E6000 Emulator CPU 2000 Configuration name Debue_yyyy_E6000_Emulator_GP Detail options Value Modify Figure 4 10 New Project Step 8 Dialog Box If multiple target platforms were selected in the New Project Step 7 dialog box shown in figure 4 9 set the name of a configuration file for each of them each time pressing the Next button to proceed to the next target Setting of the co
42. This is shown in figure 12 1 3 Itis possible to then add additional information concerning the exact issue you have found in the large edit box 4 Once you are happy with your report you can choose the method of sending the report in the submit drop list You can print it e mail it or save it to a disk 5 Then click submit This will send the report by the selected method 167 RENESAS Submit a Bug Report You may submit a Bug Report through e mail or by conventional means The box below contains information gathered from your machine and any additional information about the state of the software if a crash occurred RAM Information Load 26 Total RAM 536 379 392 bytes Free RAM 391 581 696 bytes Page File 1 309 028 352 bytes Page File Free 1 204 985 856 bytes Total Virtual 2 147 352 576 bytes Virtual Free 250 084 864 bytes Project Details No project information available Please type a description of the problem you wish to report How would you like to submit the report Print hd Figure 12 1 Submit bug report dialog RENESAS 13 Navigation facilities The High performance Embedded Workshop has a number of integrated navigation facilities The navigation window is located alongside the project and templates window This view is shown below in Figure 13 1 Workspace eee a LF amp SF_Init INT_OFFSET MAMMAL ANIMAL Many cs Classes
43. This window allows the user to control the debugging platform by sending text based commands A series of predefined command lines can be called from a file and the output can be recorded in a file The command can be executed by pressing the Enter key after the command is input at the prompt lt on the last line For information on the available commands refer to appendix G Command Lines and the on line help If available the window title displays the current batch and log file names separated by colons Pressing the Ctrl T or Ctrl J keys on the last line displays the command line previously executed 5 3 2 Specifying a Command File It is useful to use a command file when a series of predefined command lines need to be executed Create a command file by a text editor and write necessary command lines The default extension of a command file is hde Choose Set Batch File from the popup menu to open the Set Batch File dialog box in which the name of a command file hdc can be specified Clicking the OK button displays the specified command file name as the window title Clicking the Cancel button closes the dialog box without changing the setting 231 RENESAS Set Batch File 2 xi Batch File Play e I gt Browse aa Cancel Figure 5 12 Set Batch File Dialog Box 5 3 3 Executing a Command File Click the Play button in the Set Batch File dialog box or choose Play from the popu
44. To enter a workspace description 1 Select the workspace icon from the Projects tab of the Workspace window 2 Click the right mouse button to invoke the pop up menu and then select the Properties option The dialog shown in figure 6 10 will be displayed 3 Enter the description into the Information field 4 Check the Show workspace information on workspace open check box if you want a workspace properties dialog to be launched on opening a workspace This check box has the same role as the Display workspace information dialog on opening workspace on the Workspace tab of the Options dialog 5 Click OK to save the description on the Information dialog Click the Cancel button not to save the description 120 RENESAS Workspace Properties Name Demo Location C Hew2 Demo Demo hws Last modified 23 06 54 Friday June 20 2003 cne CPU family SuperH RISC engine Tool chain Hitachi SuperH Standard Information No workspace information available IV Show workspace information on workspace open Figure 6 10 Workspace Properties Dialog When a workspace is opened the High performance Embedded Workshop can display this information so that it is possible to determine whether the workspace is the desired workspace To display this information on opening a workspace set the Display workspace information dialog on opening workspace check box
45. as they become relevant However at this stage it is worth taking a few moments to familiarize yourself with the options that each menu provides RENESAS 1 2 3 The Toolbars The toolbars provide a shortcut to the options which you will use the most often There are ten default toolbars Bookmarks Debug Debug Run Editor Search Standard Templates Version Control Difference and Map as shown in figure 1 3 to 1 12 Toolbars can be created modified and removed via the Tools gt Customize menu option see chapter 6 Customizing the Environment for further information Next Bookmark Previous Bookmark Toggle Bookmark Clear All Bookmarks ee Daas Figure 1 3 Bookmarks Toolbar TCL Toolkit View Disassembly Command Line Print the Disassembly window Enable Disable Breakpoint Radix Connect to debue platform Disconnect debue platform Toggle Breakpoint amalas ng 2 ee Figure 1 4 Debug Toolbar Reset CPU Step Over Go to Cursor Step Out Reset Go Set PC to Cursor Step Halt sid ee l B Y P P B Toc Mee w fwn me Figure 1 5 Debug Run Toolbar Save File Copy Match Braces Open File Save All Gut Paste Insert Template New File Print Toggle Bookmark datr ra Figure 1 6 Editor Toolbar Find in Files Find Next peach String Find E Find Previous a gt aia Figure 1 7 Search Toolbar RENESAS Build Build All Current Congifuration Curr
46. click the No button to exit the HEW High performance Embedded Workshop x AN Session has been modified do you want to save it Yes No Cancel Figure 4 21 Session has been modified Message Box 217 RENESAS 218 RENESAS Section5 Debugging This section describes the debugging operations and their related windows and dialog boxes 5 1 Setting the Environment for Emulation 5 1 1 Opening the Configuration Properties Dialog Box Selecting Options gt Emulator gt System or clicking the Emulator System toolbar button EAN opens the Configuration Properties dialog box General User Signals IV User Reset enable Mode 7 advanced mode single chip IV User NMI enable User Sta Vv enable Reme F User Standby enable IV User Bus Request enable Clock Main 1 OMHz Sub 32kHz Timer Resolution 125ns x Flash Memory Control Y IV Enable read and write on the fly IV Break on access error J Enable internal ROM area write User YCC Threshold 4 00 4 E gt Device Driver E5000 USB Driver I Change driver in start up Figure 5 1 Configuration Properties Dialog Box General Page This dialog allows the user to set conditions for the target MCU before downloading a program to the emulator 219 RENESAS General page Device Selects the MCU to be emulated To use an MCU not included in the list select CUSTOM to
47. demo 8 CShark 4 CShark 4 CShark GetClassN ame void s m_nFins E m_nSharpTeeth 8 CCrocodile CCrocodile amp CCrocodile S GetClassN ame void e m_nLivein Water E m_nSharpTeeth 8 CFish CFish amp CFish GetClassN ame void E m_nLivein w ater 8 CGreatwhite S CGreatWhite S CGreatWhite FeedTheShark CCrocodile myGoat FeedTheShark CFish myFishyFood FeedTheShark char pszOtherT ype FeedTheShark CHorse mypHorseyFood FeedTheShark CPerson myPersonFood Project Templates Navigation entries Navigation category Project Class name Class members Navigation Figure 13 1 Navigation view The navigation view contains categories for all supported navigation types In HEW 3 0 the following navigation components are supported as standard C Defines All defines for C and C source files are displayed C Functions All ANSI C standard functions are for C source files displayed C Classes All classes functions and members are displayed for C source files Each category is displayed in the top level of the view Underneath each category each project in the workspace is displayed Then the items belonging to that particular project are displayed below the project icon 169 RENESAS
48. gt To modify an existing mapping 1 Select Version Control gt Configure The dialog shown in figure 8 1 will be displayed Select the Projects tab the dialog shown in figure 8 7 will be displayed 2 Select the mapping to be modified from the Version control directory mappings list and then click the Modify button The dialog shown in figure 8 8 will be displayed 3 Make the necessary changes to the two directories and then click OK to confirm the edits gt To remove an existing mapping 1 Select Version Control gt Configure The dialog shown in figure 8 1 will be displayed Select the Projects tab the dialog shown in figure 8 7 will be displayed 2 Select the mapping to be removed from the Version control directory mappings list and then click the Remove button Once the mappings have been defined you can use the Version control directory placeholder VCDIR to represent the directory in which the project file is stored Consider the scenario shown in figure 8 9 Here are three directories which are mapped from a shared version control drive X to a local drive where the development is being done C LOCAL C Mapped To NETWORK X A g B N Pa 7 E BA a N C work application project1 X ve sw app project1 j c E C work application sre X ve sw app sre Figure 8 9 Example Mappings Now l
49. in the status bar Note When the source file is displayed after a break a path of the source file may be inquired The location of the source file is as follows HEW installation destination directory Tools Renesas DebugComp Platform E6000 2633 Tutorial source The file path differs according to products If necessary replace 2633 with another name 0x00001038 void tutorial void Ox00001044 long a 10 long j int i class Sample p_san Ox00001046 P_sam new Sample 0x0000104e for i 0 i lt 10 i jf 0x00001050 j rand 0x00001058 ifia lt lt O34 0x0000105a j j 0x0000105c ali j 0x00001070 p_sam gt sort a 0x0000107a p_sam gt change a 0x00001082 p_sam gt sO0 a 0 0x0000108a p_sam gt sl a 1 0x00001096 Pp_sam gt s2 a 2 0x000010a2 p_san gt s3 a 3 0x000010ae p_san gt s4 a 4 0x000010ba p_san gt s5 a 5 0x000010c6 p_sam gt s6 a 6 0x000010d2 p_sam gt s7 a 7 0x000010de p_sam gt s8 a 8 0x000010ea p_sam gt s9 a 9 OxO000010f6 delete p_san Ox000010fc Figure 6 8 Source Window Break Status 345 RENESAS The user can see the cause of the break that occurred last time in the Status window e Select Status from the CPU submenu of the View menu After the Status window is displayed open the Platform sheet and check the Status of Cause of last break H8s Z2237 E6000 Emulator CPU 2000 Emulator PCI Card Driver CPU H8572237 M
50. k for i k gap i lt 10 i i gap f for j i gap j gt k j j gap f if a i gt alitgap t ali afi alit gap a jt tgap t else break gap gap 2 Figure 6 21 Source Window Step In e The highlighted line moves to the first statement of the sort function in the Source window RENESAS 355 6 12 2 Executing the Step Out Command The Step Out command steps out of the called function and stops at the next statement of the calling statement in the main function e To step out of the sort function select Step Out from the Debug menu or click the Step Out button in the toolbar Figure 6 22 Step Out Button File Edit View ae Options Build Debug Memory Tools Window Help a Osa Sjs eloTallmip s asleus 2 Pm mn E iia TARA eaat ee etua Eoss 227 Sessimesoon Hes 27a a Aa eo 2 aE Se eam Ral alala EleA m E a f anneress eT T Tutorial 0x00001046 p_sam new Sample mE 0x0000104e for i 0 i lt 10 i 5G Tutorial 0x00001050 j rand EQ C source file 0x00001058 it j lt 0 B dbscte 0x0000105a j j T My haar 0x0000105c ali j C source file resetprg cpp sort cpp 0x00001070 e P_sam gt sort a 0x0000107a gt P_sam gt change a Ox00001082 p_san gt s0 a 0 0x0000108a p_san gt s1 a 1 0x00001096 p_san gt s2 a 2 0x000010a2 p_san gt s3 a 3 0x000010ae p_san gt s4 a 4 0x000010ba p_san
51. only available when a time stamp is acquired Source program Label information that corresponds to the address if defined Displays the difference from the timestamp value shown on the previous line only available when a time stamp is acquired Note Items other than PTR Address Instruction Data R W Area Status Probes Timestamp Source Label and Timestamp Difference vary according to the emulator in use For details refer to section 8 Software Specifications Specific to This Product or the online help It is possible to hide any column not necessary in the Trace window Selecting a column you want to hide from the popup menu displayed by clicking the right hand mouse button on the header column hides that column To display the hidden column select the column from the said popup menu again 294 RENESAS 5 16 3 Specifying Trace Acquisition Conditions The capacity of the trace buffer is limited When the buffer becomes full the oldest trace information is overwritten Setting the trace acquisition condition allows acquisition of useful trace information and effective use of the trace buffer The condition is enabled by the event point to control starting stopping and ending the trace acquisition For event points refer to section 5 15 Using the Event Points The trace acquisition condition is set in the Trace Acquisition dialog box that is displayed by selecting Acquisition from th
52. otherwise enter zero 245 RENESAS 5 6 Viewing the I O Memory A microcomputer contains internal peripheral modules The exact number and type of peripheral modules differ between devices but the typical modules are a DMA controller serial communications interface A D converter integrated timer unit bus state controller and watchdog timer Registers that are mapped to the microcomputer s address space controls the internal peripheral modules The Memory window enables you to look at data in continuous memory addresses as byte word longword single precision floating point double precision floating point or ASCII values However registers of different sizes are allocated to non continuous memory addresses in the I O memory To handle this memory the HEW has the IO window to facilitate checking and setting up of these kinds of registers 5 6 1 Opening the IO Window To open the IO window select View gt CPU gt IO or click the View IO toolbar button Modules that match the internal peripheral modules organize the I O register information When the IO window is first opened only a list of module names is displayed LM o Name Address Value Access l g System Control cr OOFFEDE H 8 E syscr OOFFEDES H 01 Interrupt_Controller Bus_Controller Data_Transfer_Control 1 0_Port_1 I 70 Port_3 I o_Port_4 G I 0_Port_ I 0_Port_9 I O_Port_A I 0_Port_B I 0_Port_C
53. pages Sets a range trace This is only available when the free trace mode is disabled Select either of the following four modes Disabled Point to Point Range and Event e Disabled Disables a range trace Trace Acquisition Figure 5 72 Range Trace Setting Disabled 299 RENESAS e Point to Point Acquires trace information in the specified range cquisition 21x General Stop Delayed Stop 1 2 3 4 r Conditions C Disabled Point to Point C Range C Event Start Address H 00001 OFE Stop Address H 00001 084 M Cyclic Figure 5 73 Range Trace Setting Point to Point Start Address Address where trace acquisition starts Stop Address Address where trace acquisition stops Cyclic When this box is checked the event sequencing is configured so that the events reset themselves which causes tracing to be restarted when the start event occurs after the stop event Sets the event points that are required to start or stop trace acquisition when the start or end address is accessed respectively Point to Point mode is an easy method to set up the event mode The event to start or sop trace acquisition is an access to a single address Select Cyclic to continue acquisition of the trace information only in the specified address range Note This function automatically configures a sequence of event points Note however that an unexpected result may arise
54. pes o al A a Figure 4 15 Toolbar Selection e From the dialog box 1 Select Options gt Debug Sessions This will open the Debug Sessions dialog box figure 4 16 21x Debug sessions oo DefaultSession Sessionyyyy_E6000_Emulator_CP Cancel Sessiomooc_E6000_Emulator_CP Add Remove VE as Properties Current session DefaultSession b Figure 4 16 Debug Sessions Dialog Box 2 Select the session you want to use from the Current session combo box 3 Click the OK button to set the session 212 RENESAS 4 4 2 Adding and Removing Sessions A new session can be added by copying settings from another session or removing a session e To add a new empty session Select Options gt Debug Sessions to display the Debug Sessions dialog box figure 4 16 Click the Add button to display the Add new session dialog box figure 4 17 Check the Add new session radio button Enter a name for the session Click the OK button to close the Debug Sessions dialog box This creates a file with the name entered in step 4 If a file with this name already exists an error is displayed Add new s Figure 4 17 Add new session Dialog Box RENESAS 213 e To import an existing session into a new session file 1 Select Options gt Debug Sessions to display the Debug Sessions dialog box figure 4 16
55. refer to section 5 15 4 Signals to Indicate Bus States and Areas 320 RENESAS 7 Probes page Select the status of four probe signals The selection is not available when a time stamp is acquired Trace Filter xj General Address Data Rew Area Status Probes Rozo T D rm Setting Probe4 Don t care Probe3 Don t care Probe2 Don t care Y Probel Dont care x Cancel Apply Figure 5 91 Trace Filter Dialog Box Probes Page Don t care Detects no probe signal condition when this box is checked Setting Detects the specified probe signal condition Probe4 to Probe1 Select probe conditions not available when Don t care has been checked Don t care Detects no selected probe condition High The status of the probe signal is high Low The status of the probe signal is low 321 RENESAS 8 IRQ7 0 page Select the status of IRQ signals The selection is not available when a time stamp is acquired Trace Filter xj General Address Data Rew Area Status Probes IRQ7 0 IRQ Dontcare Ings Dontcare z IRQS Don t care IRQ4 Don t care IRG3 Don t care IRG2 Don t care IRQ1 Don t care IRQO Dont care 7 ddd Figure 5 92 Trace Filter Dialog Box IRQ7 0 Page Don t care Detects no IRQ input condition when this box is checked Setting Detects the specified IRQ input condition
56. sheet n 1 Address H OOFFDEEO Trigger output XT 2 2 Enable ddress H 00FFD404 Trigger output XT 2 3 Enable Address H 00001140 Trigger output XT 2 4 Enable ddress H 00FFEF8C Trigger output Breakpoint Figure 5 66 Event Window Trigger Sheet Selecting Add or the event point and Edit from the popup menu in this window displays the Set Address For Trigger dialog box Set Addr rigger 2 x Address ioger H 00FFDEE0 M Trigger Cancel M Trigger2 H 00FFD404 M Trigger3 Hro00011 40 M Triggers HOOFFEFEC Figure 5 67 Set Address For Trigger Dialog Box This dialog box allows the user to specify the address to be accessed as the trigger output condition during the user program execution Enable or disable the trigger output point by checking the check box on the left in the screen Trigger Enables the output of trigger channel 1 Trigger2 Enables the output of trigger channel 2 Trigger3 Enables the output of trigger channel 3 Trigger4 Enables the output of trigger channel 4 Address Sets the address condition of the channel 291 RENESAS Notes 1 When the condition set for the trigger output 1 to 4 is satisfied the high level signal will be output from the corresponding pin 1 to 4 of the external probe 2 EXT2 during reading or writing 2 Some emulators may not support the trigger point For details refer to section 8 Software
57. source files from the project are compiled in turn during the assembler phase the assembler source files are assembled in turn During the linker phase all library files and output files from the compiler and assembler phases are linked together to produce the load module This module can then be downloaded and used by the debugger functionality in HEW The build process can be customized in several ways For instance you can add your own phase disable a phase delete phases and so forth These advanced build issues are left to chapter 3 Advanced Build Features In this chapter only the general principles and basic features will be detailed RENESAS 2 2 Project Files In order for the HEW to be able to build your application you must first tell it which files should be in the project and how each file should be built figure 2 2 Add Project Files Remove Project Files Z Project Debug ON i Optimize OFF Set Compiler Options List File YES c Source Fil Debug OFF 5 Optimize OFF Set Assembler Options List File YES Assembler Source Files Debug N Biene eal Set Linker options Map File YES Figure 2 2 Editing a Project 12 RENESAS 2 2 1 Adding Files to a Project Before you can build your application you must first inform the High performance Embedded Workshop which files it is composed of gt To add a files to a proje
58. 0 4 5 5 5 2 0 16 0 15 H8 3502 group 4 5 5 5 4 0 10 0 16 H8 3834 group 4 5 5 5 0 5 5 0 17 H8 3814 group 2 7 5 5 0 5 2 5 4 0 5 5 0 5 5 0 386 RENESAS Table 7 2 Operating Voltage and Frequency Specifications cont No MCU Type Operating Voltage V Operating Frequency MHz 18 H8 3857 group 3 0 4 0 0 5 2 5 4 0 5 5 0 5 5 0 19 H8 3854 group 3 0 4 0 0 5 2 5 4 0 5 5 0 5 5 0 20 H8 3637 group 2 7 3 0 0 5 2 5 3 0 4 5 0 5 4 0 4 5 5 5 0 5 5 0 21 H8 3877 group 2 7 4 0 0 5 2 5 4 0 5 5 0 5 5 0 22 H8 3927 group 2 7 4 0 0 5 2 5 4 0 5 5 0 5 5 0 23 H8 3657 group 2 7 4 0 0 5 2 5 4 5 5 5 0 5 5 0 24 H8 3644 group 2 7 4 0 0 5 5 0 4 5 5 5 0 5 8 0 NOTE For details on the operating voltage and frequency specifications refer to the MCU hardware manual 387 RENESAS 7 2 Installing the Evaluation Chip Follow the procedure listed below to install the evaluation chip on the E6000 emulator 1 Turn off the emulator s power switch and remove the AC adapter from AC outlet 2 Remove the four screws at the side of the emulator and lift up the cover 3 Lift up the IC socket lever and insert the evaluation chip Be sure to align pin 1 location of the evaluation chip as shown in figure 7 1 Align pin 1 pointed corner of the evaluation chip with pin 1 mark a on the gt emulator v Lift up the lever Lift up the lever open 4 open Pus
59. 2 Click the Add button to display the Add new session dialog box figure 4 17 3 Check the Use an existing session file radio button 4 Enter a name for the session 5 Enter the file name of an existing session file that you would like to import into the current project or click the Browse button to select the file location If the Open and maintain link to session file check box is not checked the imported new session file is generated in the project directory If the Open and maintain link to session file check box is checked a new session file is not generated in the project directory but is linked to the current session file If the Make session file link read only check box is checked the linked session file is used as read only 6 Click the OK button to close the Debug Sessions dialog box e To remove a session 1 Select Options gt Debug Sessions to display the Debug Sessions dialog box figure 4 16 2 Select the session you would like to remove 3 Click the Remove button Note that the current session cannot be removed 4 Click the OK button to close the Debug Sessions dialog box e To view the session properties 1 Select Options gt Debug Sessions to display the Debug Sessions dialog box figure 4 16 2 Select the session you would like to view the properties for 3 Click the Properties button to display the Session Properties dialog box figure 4 18 n
60. 2 14 shows three build configurations Default MyDebug and MyOptimized In the first configuration Default each of the phases compile and assemble are set to their standard settings In the second configuration MyDebug each of the files are being built with debug information switched on In the third configuration MyOptimized each of the files are being built with optimization on full and without any debug information The developer of this project can select any of those configurations and build them without having to return to the options dialogs to set them again Default MyDebug MyOptimized Configuration Configuration Configuration I L L I I I A Debug ON Debug ON Debug OFF Optimize OFF Optimize OFF Optimize ON p List File YES List File NO H List File NO H Cc Source Files r r r A Debug OFF Debug ON Debug OFF Optimize OFF Optimize OFF Optimize ON L___ List File YES List File NO List File NO Assembler Source Files C MyProject Default C MyProject MyDebug C MyProject MyOptimized Figure 2 14 Configurations and File Options 23 RENESAS 2 5 1 Selecting a Configuration The current configuration can be select in two ways Either 1 Select it from the drop down list box figure 2 15 in the t
61. 3 Modify the fields as required and then click the OK button to add the modified entry back to the list gt To remove an output file 1 Select the output file that you would like to remove 2 Click the Remove button 52 RENESAS 3 4 3 Dependent Files Tab The Dependent Files tab figure 3 14 is where you can specify the dependent files that are needed by the phase Before each file is passed into this phase the HEW checks that the dependent files are of a more recent date than the input file If so the phase will be executed for that file i e dependent files have been modified since the input file or files were last modified If not the phase is not executed for the files Options Output Files Dependent Files CONFIGDIR IF ile5 ob CONFIGDIR File6 obj CONFIGDIR File obj z CONFIGDIR SFile8 obj Modify c Hew Worksp Project D ebug File1 obj c Hew Worksp Project D ebug File2 obj Remove c Hew Worksp Project D ebug File3 obj c Hew Worksp Project D ebug File4 obj dd i Figure 3 14 Dependent Files Tab in Custom Options RENESAS gt To add a dependent file 1 Click Add The Add Dependent File dialog will be invoked figure 3 15 2 Enter the file path or browse to it using the Browse button 3 Click OK to add this output file to the list Placeholder popup menu Ux File gt Browse Cancel
62. 5 8 Filling a Memory Area with a Value 241 5 5 9 Copying a Memory Area 241 5 5 10 Saving and Verifying a Memory Area 242 5 5 11 Disabling Update of the Window Contents 243 5 5 12 Updating the Window Contents 243 5 5 13 Comparing the Memory Contents 5 5 14 Loading a Memory Area from a File 245 Viewing the VO MGMOry eeit enir vesuezeoseoaeteoceoseteessssetenteneedonssneasevestessedesnnn 246 5 6 1 Opening the TO Window issssisssssorisesesersversrensososrsssesssressrersrresirisivesovesrsscisstes 246 5 6 2 Expanding the I O Register Display ccc eseeeeeeeseeeseceeeeeteeeeeseeeeeeeees 246 5 0 3 Manually loading antO filesinin 247 5 6 4 Modifying the I O Register Contents 0 ec ecceeeceee cece cseeseeeseeeeeetaeeeeeeaes 247 5 6 5 Saving the Currently Displayed Contents 0 0 0 0 eeeeeeeeseneteeeeeeeeeeeeaees 247 Viewing the C rrent Statusss lt sssocscscissecesebessoucseontdgdeedeis inene sieo KEE EEEE ea ESNS TESES 248 Reading and Displaying the Emulator Information Regularly 0 0 0 0 eee 249 RENESAS 5 9 5 10 5 11 5 12 5 13 5 14 5 15 5 8 1 Opening the Extended Monitor Window cece cece cece eseeeeeeeseeeeeeeaeees 249 5 8 2 Selecting Items to be Displayed eee cece ce ces ce ceeeecseeecsesseeesseeeeesaeees 250 Displaying Memory Contents in Realtime ceceeceesceseeseeeeeeeceeeeeeeaeeseeeeeeeeeeeaeeaeeaeees 251 5 9 1 Opening the Mo
63. Box Action Page Action Selects an action that occurs when the event is satisfied This cannot be used for an event point being used as the trace acquisition condition Break Causes a break stop in the user program when the event occurs This is the default action Start Timer Starts the run timer the run timer value is displayed in the Status window Stop Timer Stops the run timer the run timer value is displayed in the Status window Delay after detection before break occurs Sets a 16 bit delay in bus cycles after the event has occurred before the action is taken The delay is only applicable to break events and there is only one delay counter in hardware therefore only one breakpoint can have a non zero delay The range of values is D 0 to D 65 535 only available when Break has been selected This cannot be used for an event point being used as the trace acquisition condition 288 RENESAS Required number of event occurrences Allows a 16 bit pass count to be set The event must occur the specified number of times before the action is taken The range of values is D 0 to D 65 535 Enable Sequencing Allows the event to take part in a sequence of events setting this requires the event to use an event detector Configure Sequence Displays the Event Sequencing dialog box to allow the event sequencing to be configured only available when Enable Sequencing has been selected 5
64. Browse Figure 2 24 Insert Project Dialog To insert an existing project into a workspace 1 Select Project gt Insert Project The Insert Project dialog will be displayed 2 Set the Existing Project option 3 Enter the full path of the project database file HWP file into the edit field or click Browse to search for it graphically 4 Click OK to insert the existing project into the workspace 34 RENESAS 2 11 Specifying Dependencies between Projects The projects within a workspace can be dependent upon one another so that when one project is built all its dependent projects are built first This is useful if another project uses one of the others in the workspace For example imagine that a workspace contains two projects The first project is a library that is included by an application project In this case the library must have been built and up to date before the second application can build correctly To achieve this situation we can specify the library as a dependent i e child project of the application project This would then allow the library to be built first if it is out of date When a dependent project is built the HEW attempts to match the configuration in the dependent project with that of the current project This means that if the current configuration is Debug then the HEW will attempt to build the Debug configuration in the dependent project If
65. C C compiler package has been installed For details on this refer to the manual attached to the H8S H8 300 series C C compiler package 200 RENESAS 4 2 1 Creating a New Workspace Toolchain Not Used 1 In the Welcome dialog box that is displayed when the HEW is activated select Create a new project workspace radio button and click the OK button yy Open a recent project works Figure 4 3 Welcome Dialog Box 201 RENESAS 2 Creation of a new workspace is started The following dialog box is displayed New Project Workspace 21x Projects Workspace Name sample Project Name sample Directory c Hew3 sample Browse CPU family H85 H8 300 Ea Tool chain l None bg Debugger only E6000 E mul Properties Figure 4 4 New Project Workspace Dialog Box Workspace Name edit box Enter the new workspace name Project Name edit box Enter the project name When the project name is the same as the workspace name it needs not be entered Directory edit box Displays the directory in which the workspace will be created Click the Browse button to select a directory name or enter a directory name in the Directory edit box Other list boxes are used for setting the toolchain the fixed information is displayed when the toolchain has not been installed 202 RENESAS 3 Make the required setting for the
66. Continuing Run When your program is stopped the HEW will display an yellow arrow mark in the gutter of the line in the editor and Disassembly windows that correspond to the CPU s current program counter PC address value This will be the next instruction to be executed if you perform a step or continue running To continue running from the current PC address click the Go toolbar button or choose Debug gt Go To continue running from a specified address which is not the stop address change the PC value in one of the following ways and click the Go toolbar button E or choose Debug gt Go e Change the PC value in the Register window Refer to section 5 4 3 Modifying Register Contents e Place the text cursor not the mouse cursor to a target line in the Source or Disassembly window and choose Set PC Here from the popup menu 5 11 3 Running to the Cursor Sometimes as you are going through your application you may want to run only a small section of code that would require many single steps to execute You can do this using the Go To Cursor feature gt How to use the Go To Cursor 1 Make sure that a Source or Disassembly window is open showing the address at which you wish to stop 2 Position the text cursor on the address at which you wish to stop by either clicking in the Address field or using the cursor keys 3 Choose Go To Cursor from the popup menu The debugging platf
67. Environment for Execution of the Tutorial Program eee eee 424 8 2 2 Notes on Use of the H8 300 Group Evaluation Chip Set HS3308EVI60H 424 8 2 3 Notes on Use of the H8 350 Group Evaluation Chip Set HS3508EVI60H 425 8 2 4 Notes on Use of the H8 338 H8 329 Group Evaluation Chip Set HS3398EVI60H 0 0 cece eee eseee cee cseeseeetseeetseteeseeaeees 425 8 2 5 Notes on Use of the H8 3334 Group Evaluation Chip Set HS3334EVI60H 426 8 2 6 Notes on Use of the H8 3257 H8 325 Group Evaluation Chip Set HS3257EVI60H 0 0 0 cece eee eseeseeececseeetseeesseteeeeaeees 427 8 2 7 Notes on Use of the H8 3437 H8 3437Y H8 3297 Group Evaluation Chip Set HS3437EVI60H uu cece eee cse cece csecseeetseseeseteeseeneees 428 8 2 8 Notes on Use of the H8 3217 H8 3318 Group Evaluation Chip Set HS3318EVI60H uu ee eee eee cece ceeceeeetseeeeseteeeeaeees 430 8 2 9 Notes on Use of the H8 3834 H8 3814 Group Evaluation Chip Set HS3834EVI60H 0 eee eee cece ceeceeeseeetseeseaeteceeaeees 431 8 2 10 Notes on Use of the H8 3637 H8 3877 Group Evaluation Chip Set HS3876EVI60H 8 2 11 Notes on Use of the H8 3927 Group Evaluation Chip Set HS3927EVI60H 435 8 2 12 Notes on Use of the H8 3644 H8 3657 Group Emulator HS3644EPI608 436 Appendix A Troubleshooting cici c ccseseeizesedssasssczegcescatsssesesesiassevineesoesesenasszenese 439 Appendix B Regular Expressions cesssccesceceeseesseeseeeeceseeeeeeaeeneee
68. H OOFFBOD8 y monitori H OOFFEF80 Edit Lock Refresh Hide Remove Close Figure 5 36 Selection in the Monitor Window 254 RENESAS Add Adds a new monitoring condition Edit Changes the settings of the selected Monitor window disabled when selecting multiple items Lock Refresh Unlock Refresh Automatically updates or stops updating the display of the selected Monitor window Hide UnHide Displays or hides the selected Monitor window Remove Removes the selected monitoring conditions Close Closes this dialog box 255 RENESAS 5 10 Viewing the Labels When the user program that includes the debugging information is loaded the labels are registered at that time The Disassembly window shows the first eight characters of each label instead of the corresponding address or as a part of an instruction operand Note When a label value matches an operand the corresponding instruction operand is replaced by the label If two or more labels have the same value the one that comes first in alphabetical order is displayed 5 10 1 Listing Labels Choose View gt Symbol gt Labels or click the View Labels toolbar button m to list all labels defined in the current debug session Lab BP Address H 00001000 H 00001034 H 00001038 H o0000110A4 H 0000110C H o00001122 H o0000112C H OOOO112E H 00001132 H oo0001144 H 00001152
69. HEW editor to access C navigation information and provide auto completion help when using C classes and member functions gt To view the Smart edit status 1 Click on the Tools gt Options menu item 2 Select the Editor tab of the tools options dialog 3 The dialog in figure 14 1 is displayed The Enable Smart edit for C files should be checked 4 Click OK 2x Build Editor Workspace Confirmation Network m Spacing Tab size 4 IV Enable auto indentation r General IV Save files before executing any tools IV Show files in notebook J Prompt before saving files I Enable syntax coloring IV Enable Smart edit for C files I Enable tooltip watch m External editor Tl Use extemal editor Modify Figure 14 1 Options Dialog Editor Tab With this option switched on if you are working on a C file the smart edit capability should be enabled Note If the C Class navigation category has been switched off the Smart edit capability of HEW will not be active During normal usage the following editor operations will make the smart edit facilities visible gt If you are using an object and are trying to access the members using the or gt If you do this a pop up will be displayed which may help you select the correct member more efficiently than typing Whilst typing the pop up will keep track of the keys you have pressed to help your s
70. In such cases modify the setting of the sequence in the Event Sequencing dialog box 300 RENESAS e Range Only acquires the trace information that satisfies the specified condition Trace Acquisition Figure 5 74 Range Trace Setting Range Range Event Selects an event point for which a trace acquisition condition has been set Edit Changes the setting for the selected event point Only acquires trace information from all bus cycles that matches the condition set in the selected event This mode uses one event channel or range channel 301 RENESAS e Event Acquires trace information controlling the start and end of trace acquisition with the specified condition Trace Acquisition 2 x General Stop Delayed Stop 1 2 3 4 r Conditions C Disabled Point to Point C Range Event Start Event Edit 7 E H 07E address v Stop Event Edit 8 E H 1084 address X M Cyclic Figure 5 75 Range Trace Setting Event Start Event Selects the event point for which the condition to start trace acquisition has been set Stop Event Selects the event point for which the condition to stop trace acquisition has been set Edit Changes the setting for the selected event point Cyclic When this box is checked the event sequencing is configured so that the events reset themselves which causes tracing to be restarted when the start event occurs after
71. Name field is read only Modify the settings as desired and then click OK 4 Click OK to set the application for the selected file group 21 RENESAS 2 4 Specifying How to Build a File Once you have added the necessary files to the project the next step is to instruct the HEW on how to build each file To do this you will need to select a menu option from the Options menu The contents of this menu depend upon which tools you are using gt To set options for a build phase 1 Select the options menu and find the phase whose options you would like to modify Select this option 2 A dialog will be invoked which allows you to specify the options 3 After making your selections click OK to set them To obtain further information use the context sensitive help button or select the area in which you need assistance and then press F1 22 RENESAS 2 5 Build Configurations The HEW allows you to store all of your build options into a build configuration figure 2 14 This means that you can freeze all of the options and give them a name Later on you can select that configuration and all of the options for all of the build phases will be restored These build configurations also allow the user to specify debugger settings for a build configuration This means that each configuration can be targeted at a different end platform See Emulator Debugger Part in this manual for further information Figure
72. Specifications Specific to This Product or the online help 5 15 9 Editing Event Points Handlings for settings other than PC breakpoints event points and trigger points are common The following describes examples of such handling 5 15 10 Modifying Event Points Select an event point to be modified and choose Edit from the popup menu to open the dialog box that corresponds the event which allows the user to modify the event conditions The Edit menu is only available when one event point is selected 5 15 11 Enabling an Event Point Select an event point and choose Enable from the popup menu to enable the selected event point 5 15 12 Disabling an Event Point Select an event point and choose Disable from the popup menu to disable the selected event point When an event point is disabled the event point will remain in the list but an event will not occur when the specified conditions have been satisfied 5 15 13 Deleting an Event Point Select an event point and choose Delete from the popup menu to remove the selected event point To retain the event point but not have it cause an event when its conditions are met use the Disable option see section 5 15 12 Disabling an Event Point Note No trigger point can be deleted Use the Disable option to clear the settings 5 15 14 Deleting All Event Points Choose Delete All from the popup menu to remove all event points Note No trigger point can be delete
73. Statistic 21x m Statistic Analysis Clear Set New Result End Figure 5 95 Statistic Dialog Box Statistic Analysis Setting required for analysis of statistical information Default Sets a single input value or character string Range Sets the input value or character string as a range Item Sets the item for analysis Start Sets the input value or character string To set a range the start value must be specified here End Specify the end value if a range has been set only available when Range has been selected Set Adds a new condition to the current one New Creates a new condition Result Obtains the result of statistical information analysis Clear Clears all conditions and results of statistical information analysis Close Closes this dialog box All the results displayed in the Result list will be cleared 325 RENESAS This dialog box allows the user to analyze statistical information concerning the trace information Set the target of analysis in Item and the input value or character string by Start and End Click the Result button after setting a condition by pressing the New or Add button to analyze the statistical information and display its result in the Result list Note In this emulator only PTR can be set as a range Each of other items must be specified as a character string In analysis of statistical information c
74. This selection affects to show icon in the Project information dialog 9 You can also decide to change the icon for the project type at this stage The default icon is shown but you can choose to use your own custom icon and this will be displayed on the new workspace dialog 10 When you are happy with the setup of the generator click finish If you click Next button Step 3 dialog box is shown 107 RENESAS What text would you like displayed on the generator dialog Displaying project information Approx size of generator lt Back Newt gt C Enin Cancel Figure 5 17 New project type wizard Step 3 Dialog 11 You can enter project information It will be shown Project information in Project information dialog box 12 You can click Finish button Now the generator will be created in the HEW system pgc directory in your HEW installation It will also automatically appear in the new workspace dialog 108 RENESAS You can see a new project type In this example Current Project Name after creating by custom project generator New Proje P C on SuperH RISC engine ha Hitachi SuperH Standard E Figure 5 18 New Project Workspace Dialog 109 RENESAS You can select a project type and enter workspace and project name then click OK This dialog contents come from Project type wizard Step 2 and step 3 setting Proj
75. Trigger sheet in the Event window 8 1 10 Trace Information Selecting View gt Code gt Trace or clicking the Trace toolbar button displays the Trace window Trace information that can be acquired by the emulator and trace information items to be displayed are as listed below PTR Cycle number in the trace buffer When the most recent record is record 0 earlier record numbers go backwards 1 2 If a delay count has been set the cycle number where the trace stop condition has been satisfied is record 0 For the cycle during delay executed until the trace has stopped earlier record numbers go forward 1 2 the most recent record Address Address 6 digit hexadecimal Instruction Disassembled code of the executed instruction Data Data bus value displayed as 2 digit or 4 digit hexadecimal R W Whether access was read RD or write WR Area Memory area being accessed H8 300 series Internal ROM internal RAM I O or expansion memory H8 300L series Internal ROM internal RAM I O or LCD MTG RAM This item is not available when a time stamp is acquired Status Bus status during this cycle H8 300 series CPU CPU instruction cycles CPU_PREFETCH prefetch cycles CPU_WORD CPU word access cycles or DTU DTU cycles H8 300L series CPU CPU instruction cycles CPU_PREFETCH prefetch cycles SUB_ACTIVE_DATA subactive data access cycles SUB_ACTIVE_PREFETCH su
76. When a device type or device mode without an internal ROM or internal RAM is selected the standard emulation memory is disabled When debugging with only the emulator and the user program and data are stored in an external address space an optional SIMM memory module must be used The optional SIMM memory modules can be separately purchased The emulation memory can be mapped in 64 byte units to any number of separate memory blocks in the MCU address space Each memory block can be specified using the memory mapping function as user Target or emulator SIMM memory module and in each case the access can be specified as read write read only or guarded The definition of each type of memory is as follows Table 3 1 Memory Types Memory Type Description On chip Uses the MCU internal memory User Accesses the user system memory Emulator Accesses the emulator SIMM memory module The contents of a specified block of memory can be displayed using the memory function The contents of memory can be modified at any time even during program execution and the results are immediately reflected in all other appropriate windows Note that modifying memory contents during program execution has the following time requirements 1 MCU internal ROM or RAM or emulator SIMM memory module The emulator modifies the memory contents by temporarily switching the memory bus to the emulator side without stopping the user program execution Therefore
77. a column drag the header vertical bars below the title bar to adjust the width of the column 374 RENESAS 12 Remove the event points that have been set and clear the trace information Clicking the right hand mouse button on the Breakpoints window displays a popup menu Select Delete All from this menu to remove all the event points that have been set Clicking the right hand mouse button on the Trace window displays a further popup menu Select Clear from this menu to clear the trace information To disable time stamping select Disabled in the Clock combo box of the Time Stamp group box on the General page of the Trace Acquisition dialog box 6 16 3 Statistics The number of times the internal RAM has been written to can be included in the acquired trace information a 2 3 Make the setting such that a break occurs at the address on the line that has p_sam gt sO a 0 within the tutorial function H 00001082 in this example for details on this refer to section 6 15 1 PC Break Function Select Reset Go from the Debug menu Processing stops when the break condition is satisfied and the Trace window then displays trace information Select Statistic from the popup menu that is displayed when you click the right hand mouse button on the Trace window A message box appears indicating that the trace data is being loaded and the Statistic dialog box will be displayed
78. a range of character values based on their bit pattern For example A Za z matches all uppercase and lowercase English characters To indicate as a character in the bracket expression it must be the first or last character in the set for example a z or A Z is special only when placed in the first character position within the bracket set Using in the first position complements the set of items to be matched For example a z matches all characters except for lowercase English letters Finally in order to include a as a character in the bracket set you must include it as the first character in the set as in Jabc or Jabc and Group regular expression items into subexpressions which are treated as a single unit For example whereas ab matches a ab abb and so on ab matches the empty string ab abab and so on and are not treated as special characters inside a bracket expression Escapes a regular expression character causing it to be treated as a regular character For example whereas ab indicates a subexpression consisting of ab ab denotes the sequence of characters a b and Note To specify the character in C source code you must specify as the C compiler treats the character as special denoting the beginning of an escape sequence embedded in the C source code In data files or text controls in dialog boxes however the double backslash is not necessary
79. and linker options via an easy to use interface e An integrated text editor with user customizable syntax coloring to improve code readability e A configurable environment to run your own tools e An integrated debugger which allows you to build and debug in the same application e Version control support HEW has been designed with two key aims firstly to provide you the user with a set of powerful development tools and secondly to unify and present them in a way that is easy to use RENESAS About This Manual This manual is comprised of two parts HEW Part and Emulator Debugger Part HEW Part Information on the basic look and feel of the HEW and customizing the HEW environment and detail of the HEW s build function Emulator Debugger Part Preparation before use E6000 emulator functions debugging function tutorial and hardware and software specifications of the E6000 emulator This manual does not intend to explain how to write C C or assembly language programs how to use any particular operating system or how best to tailor code for the individual devices These issues are left to the respective manuals Microsoft MS DOS Windows Windows NT are registered trademarks of Microsoft Corporation Visual SourceSafe is a trademark of Microsoft Corporation IBM is a registered trademark of International Business Machines Corporation All brand or product names used in this manual are trademarks or registered
80. are red i e the color that was selected in the Foreground and Background combo boxes Values will be displayed in black if they have not been updated or a certain period of time has elapsed since the last update monitor monitor H OOFFEF Address OxOOFFEF8O 00 OO 02 8B 00 OO 18 OS 00 00 2D 69 00 00 36 73 OxOOFFEF90 00 OO 3A E9 OO OO 3B D3 00 00 41 FC 00 OO SB BY OxOOFFEFAO 00 OO 64 02 00 OO 6F 4A 00 O2 12 24 OO OO AA AA OxOOFFEFBO 57 70 00 OO OO O1 80 74 00 OO 10 36 00 OO 04 IE OxOOFFEFCO 6A 18 6A 18 GA 18 GA 18 GA 18 6A 18 6A 18 GA 18 Figure 6 65 Monitor Window during Execution 5 After you have finished checking the states in the Monitor window select Halt Program from the Debug menu to halt the program s execution 6 19 What Next This tutorial has described the major features of the emulator and the use of the HEW Sophisticated debugging can be carried out by using the emulation functions that the emulator offers This provides for effective investigation of hardware and software problems by accurately isolating and identifying the conditions under which such problems arise 383 RENESAS 384 RENESAS Section 7 Hardware Specifications Specific to This Product This section describes the hardware specifications on the H8 300 and 300L E6000 emulator 71 H8 300 and 300L E6000 Emulator Specifications The H8 300 and 300L E6000 emulator supports the system development using the followi
81. be Displayed Selecting Properties from the popup menu displays the Extended Monitor Configuration dialog box Extended Monitor Configuration Update millsecond Bunning 100 Break 1000 Cancel Settings User Standby Inactive User NMI Inactive User Reset Inactive User Wait Inactive User System Voltage OK User System Voltage2 Down User Cable Not Connected Running status Break Ready Figure 5 32 Extended Monitor Configuration Dialog Box This dialog box allows the user to set the items to be displayed in the Extended Monitor window Note The items that can be set in this dialog box vary according to the emulator in use For details refer to section 8 Software Specifications Specific to This Product or the online help 250 RENESAS 5 9 Displaying Memory Contents in Realtime Use the Monitor window to monitor the memory contents during user program execution In the Monitor function the realtime operation is retained since the bus monitoring circuit of the emulator sets the read write signal of the MCU as a trigger and holds the address bus and data bus values to update the displayed contents of the memory Up to eight points can be set by using the eight monitoring channels on the bus monitoring circuit 1 to 256 bytes can be monitored at one point It is possible that a part or all of monitoring ranges is overlapped Note Monitoring is impossible for an area such
82. be performed within 8 ns or less User system 47 Q interface cable HD151015 Figure 7 74 User Interface Circuit for RESET and TEST OSC1 and X1 Vcc 4 7 KQ User system 47Q interface cable HD151015 Figure 7 75 User Interface Circuit for OSC1 and X1 409 RENESAS PBO0 ANO to PB7 AN7 Evaluation o User system chip 470 interface cable Figure 7 76 User Interface Circuit for PB0 ANO to PB7 AN7 AVcc and AVss Evaluation chip User system 27kQ interface cable Figure 7 77 User Interface Circuit for AVcc and A Vss Vpp P90 and TEST Terminals to which 12 V Voltage is Applied at Flash Memory Write Flash memory is not supported by this emulator Therefore when debugging the H8 3644 or H8 3657 group microcomputer with flash memory do not apply 12 V voltage to the Vpp P90 or TEST terminal Otherwise the emulator detects test mode The user system interface cable provides the protection circuits against 12 V input to the Vpp P90 or TEST terminal For details refer to each manual for the user system interface cables P60 to P67 CMOS Large Current Ports The P60 to P67 CMOS large current port function for the H8 3644 group is supported by the user system interface cable For details refer to H8 3644 Group User System Interface Cable User s Manual 7 4 Differences between MCU and Emulator When the emulator is turned on or initialized or the system is reset there are som
83. button nal gt To remove all bookmarks in a file 1 Ensure that the window whose bookmarks you want to remove is the active window 2 Select Edit gt Bookmarks gt Clear All Bookmarks or select Bookmarks gt Clear All Bookmarks from the local menu or click the clear all bookmarks toolbar button Phd 4 7 Printing a File gt To print a file 1 Ensure that the window whose contents you want to print is the active window 2 Select File gt Print or click the print toolbar button or press CTRL P 80 RENESAS 4 8 Configuring Text Layout The following sections detail how to set up the layout of the text within the editor windows 4 8 1 Page Set up When you print a file from the High performance Embedded Workshop editor the settings in the print dialog box affect the way in which the file is printed e g double or single sided Control over how the text is formatted on the page can also be controlled via the page set up option This allows you to specify the margins top bottom left and right of your printouts It is often necessary to set this because some printers cannot print to the edges of an A4 page Furthermore some users have their own layout requirements e g a large left hand margin so that code can be placed in an A4 binder gt To set up the page margins 1 Select File gt Page Setup The Page Setup dialog will be invoked figure 4 6 2 Enter into the edit fields the margins
84. by clicking the Browse button 2 Enter the arguments for the command into the Arguments field 3 Enter the initial directory in which you would like to run the executable from into the Initial directory field or browse to it graphically by clicking the Browse button In most cases this should be set to the FILEDIR placeholder i e execute the command from the same directory as the file 4 Set the Executable return code options as described in the following section 5 Click OK to define the new command 8 2 1 Executable return code If the return code of the command s can be used to indicate a failure then you should select the Command has failed if the return code is option and set the two fields to the right as required If the Command has failed if the return code is option is selected then the HEW will check the return code of each command to determine whether a failure occurred If so no further commands will be executed and any other processes which would follow the commands e g build will not be executed If the Return code of tool is not meaningful option is selected then the HEW will not check the return code of each Consequently all commands will execute regardless 139 RENESAS 8 3 Specifying Arguments It is obvious that arguments must be specified correctly otherwise the version control tool executed will not function as intended However it is al
85. can be displayed refer to section 8 Software Specifications Specific to This Product or the online help 360 RENESAS e Close the Event window e To stop the tutorial program at the breakpoint select Reset Go from the Debug menu The program runs until it stops at the breakpoint that has been set 0x00001038 void tutorial void 0x00001044 long a 10 long j ine i class Sample p_sam Ox00001046 p_sam new Sample 0x0000104e for i 0 i lt 10 i jf 0x00001050 j rand 0x00001058 1f j lt 0J 0x0000105a j j 0x0000105c ali j 0x00001070 p_sam gt sort a Ox0000107a p_sam gt change a 0x00001082 p_sam gt sO0 a 0 0x0000108a p_sam gt sl a 1 0x00001096 p_sam gt s2 a 2 0x000010a2 P_sam gt s3 a 3 0x000010ac p_sam gt s4 a 4 0x000010ba p_sam gt s5S a 5 0x000010c6 p_sam gt s6 a 6 0x000010d2 Pp_sam gt s7 a 7 0x000010de p_sam gt s8 a 8 0x000010ea p_sam gt s9 a 9 Ox000010f6 delete p_sam 0x000010fc Figure 6 33 Source Window at Execution Stop PC Break The Status window displays the following contents H8S 2237 E6000 Emulator CPU 2000 Emulator PCI Card Driver CPU H8572237 Mode Clock source Main 10MHz Sub 32ZkHz Run status Break Cause of last break PC Break Event Time Count 00h OOmin 00s O00ms OOO0us O00ns Run Time Count 00h OOmin 00s OOlms O9Zus 500ns Figure 6 34 Displayed Contents of
86. component does the same for the build functionality The components you have registered in the system will modify the look and feel of HEW In some cases you may not have some of the menus which you can see in this manual For instance if the debugger component is not installed you will not have the Debug menu in the HEW main window 10 RENESAS 2 Build Basics This chapter explains the general basic functions of the HEW whilst the more advanced features can be found in chapter 3 Advanced Build Features 2 1 The Build Process The typical build process is outlined in figure 2 1 This may not be the exact build process which your installation of HEW will use as it depends upon the tools that were provided with your installation of HEW e g you may not have a compiler for instance In any case the principles are the same each step or phase of the build takes a set of project files and then builds them if all succeeds then the next step or phase is executed Yaa suo Ba COMPILER Cc ource Files J ASSEMBLER Assembler Source Files J Project LINKER Object m Files Library Files eee ee Load Module Figure 2 1 Typical Build Process In the example shown in figure 2 1 the compiler is the first phase the assembler is the second phase and the linker is the third and final phase During the compiler phase the C C
87. custom version control system allows you to invoke a version control command either by selecting an option from the Tools gt Version Control sub menu or by clicking a version control toolbar button When either of these actions are performed the associated commands are executed and the output is displayed in the Version Control tab of the Output window gt To execute a version control menu option or toolbar button 1 Select whichever items you would like to apply the version control command to from the Workspace window This may include a workspace project s folder s and file s When the command is selected all of the files will be extracted from the selected items and passed in turn to the version control command For example if you select the workspace icon then all of the files in all of the projects will be passed in turn to the version control command This will include any system files For example if you select the project item then 2 Select the required menu option from the Tools gt Version Control sub menu or click the desired version control toolbar button The custom version control support allows you the most flexibility in specifying how a version control system is to be used To configure it select Version Control gt Configure The Version Control Setup dialog will be displayed figure 8 1 133 RENESAS 134 ersion Control Setup Check In File s Check Out File s Ge
88. delay caused by the user system interface cable is about 3 ns The following diagrams show the user system interface signal circuits Default Evaluation chip o User system 47 Q interface cable Figure 7 2 Default User System Interface Circuit RES NMI and MD0 These signals are input to the evaluation chip via HD151015 Therefore the rising falling time must be within 8 ns or less User system 47 Q interface cable HD151015 Figure 7 3 User System Interface Circuit for RES NMI and MDO MD1 Includes a 12 V detection circuit for supporting microcomputers including flash memory 12 V detection User system circuit interface cable monitor register 27 KQ Figure 7 4 User System Interface Circuit for MD1 389 RENESAS EXTAL Clock oscillator circuit is on the user system interface cable User system 47Q interface cable HD151015 Figure 7 5 User System Interface Circuit for EXTAL STBY Hardware standby cannot be used 10 KQ Evaluation chip Figure 7 6 User System Interface Circuit for STBY ANO P70 to AN7 P77 Evaluation o User system chip 470 interface cable Figure 7 7 User System Interface Circuit for ANO P70 to AN7 P77 AVcc and AVss Evaluation chip User system 27KQ b interface cable Figure 7 8 User System Interface Circuit for AVcc and Avss 390 RENESAS 7 3 3 User System Interface Circuits of the H8 350 Group Evaluation Chi
89. dialog box will be displayed Enter a filename specify a directory and then click OK to create the file with the name given in the directory specified 4 3 3 Saving all Files gt To save the contents of every open editor window 1 Select File gt Save All or click the save all files toolbar button Gi 2 If any of the files has not been saved before a file save dialog box will be displayed Enter a filename specify a directory and then click OK to create the file with the name given in the directory specified 3 If any of the files have been saved before then the file will be updated no dialog box will be displayed 73 RENESAS 4 3 4 Opening a File gt To open a file 1 Select File gt Open or click the open file toolbar button B or press CTRL 0 2 An open file dialog box will be displayed Use the directory browser on the right to navigate to the directory in which the file you want to open is located Use the Files of type combo box to select the type of file you want to open or set it to All Files to see every file in a directory 3 Once you have located the file select it and click Open The High performance Embedded Workshop keeps track of the last four files that you have opened and adds them to the file menu under the Recent Files sub menu This gives you a shortcut to opening files which you have used recently gt To open a recently used file Select the File g
90. eee eeeeeceeeseeeeeeeseeeeseseesesaceessseeeeeaseesaseeees 303 5 16 5 Clearing the Trace Information ese eects cseeeeeeeseeesseeeseetaeeeeaeaes 312 5 16 6 Saving the Trace Information in a File cece cee eee eeeeeeeeeeeteeeeeeees 312 5 16 7 Viewing the Source Window ccccecceceeeeceeeeteeseeeeceseeeeeaeeseeaeeseeenseaeeaeeeeates 313 5 16 8 Trimmine the SOURCE ascssssseteassscersvssxerte varacevenssasasedosncesesd sansovtoseeonedsevaoedebassoain ses 313 5 16 9 Acquiring a Snapshot of the Trace Information 0 0 0 eee eects ceeeeeeeee 313 5 16 10 Temporarily Stopping Trace Acquisition cece cess ceeeeeeeeceeeeeeeeeeaee 313 5 16 11 Restarting Trace Acquisition 313 5 16 12 Extracting Records from the Acquired Information 0 e cece eee 314 5 16 13 Calculating the Difference in Time Stamping cece eee eeeeeeeeeeeeeeeee 324 5 16 14 Analyzing Statistical Information 5 16 15 Extracting Function Calls from the Acquired Trace Information 326 Viewing the Function Call History cic esee eee ceeececeececseeecseeeeeessseesseeeeesaeeesaaeaes 327 5 17 1 Opening the Stack Trace Window cece ce cece ceeeeeseeesseeeeeetaeeeeaeeas 327 5 17 2 Viewing the Source Program oo ccs esessescsscsssecssesessssscsssesssssssenseessensssseseenee 327 547 3 Specifying the View scc ricscceosnescceestencsernesusseonesnsteonesssscesrsesseeaeessacbsosesesssensteoanasoie 328 Displaying Memory Contents as an Image 0 cc cece eee cece
91. files which will be searched are listed in the Help tab of the Customize dialog gt To add a new help file 1 Select Tools gt Customize The dialog shown in figure 6 1 will be displayed Select the Help tab see figure 6 7 Customize y 21x Toolbars Commands Menu Placeholders Debugger Log Help Help files Description File Name Add C C Standard Library Help d hew3 tools renesa int emove Default help file C C Standard Library Help Cancel Figure 6 7 Customize Dialog Help Tab 2 Click the Add button The Add Help File dialog will be displayed figure 6 8 3 Enter a description of the help file into the Title field 4 Enter the full path of the help file into the Path field or browse to it graphically by clicking on the Browse button 5 Click OK to define the new help file Title Programming i in ANSIC Path fe flesthelp ansi hip Figure 6 8 Add Help File Dialog 118 RENESAS To make a help file the default choice select it from the Default help file drop down list or set it to None if you would like to be prompted for a help file when F1 is pressed 6 4 Specifying Workspace Options The High performance Embedded Workshop allows you to control several aspects of a workspace via the Options dialog figure 6 9 To invoke it select Tools gt Opti
92. format If pattern search is selected as the search format a byte string of up to 256 bytes can be searched for The end address can also be prefixed by a plus the end address will become the start address entered value Search conditions other than pattern search are data match mismatch and search direction Note that only data match and forward direction can be selected with pattern search Click the OK button or press the Enter key The dialog box closes and the HEW searches the range for the specified data If the data is found it is highlighted If the data could not be found the Memory window display remains unchanged and a message box informing that the data could not be found is displayed If Search Next is selected from the popup menu in the state where data has been found the search will continue from the next address 240 RENESAS 5 5 8 Filling a Memory Area with a Value A value can be set as the contents of a memory address range using the memory fill function To fill a memory range with the same value select Fill from the popup menu of the Memory window or from the Memory drop down menu The Fill Memory dialog box is shown in figure 5 23 Cancel End Data Format fe yte x1 I Verity Figure 5 23 Fill Memory Dialog Box If an address range has been selected in the Memory window the specified start and end addresses will be displayed Select a format from the Format co
93. gt s5 a 5 0x000010c6 p_san gt s6 a 6 0x000010d2 p_san gt s7 a 7 0x000010de p_san gt s8 a 8 0x000010ea p_san gt s9 a 9 0x000010f6 delete p_sam 0x000010fc BR a OxO0ffef80 flongf1 0 0 H QOOOOHE Ox00ffef80 llong R 1 H 000015fb 0x0Offef84 flong R 2 H 0000167e 0x0Offef88 llong 3 H 00001 cfb 0x0Offef8c llong 4 H 00002781 0x0Offef90 long R B H 00003f54 Ox00ffef34 llong R 6 H 000041 c6 0x0Offef98 long ftg H 0000446b 0x00ffef3c llong R 8 H 000059e2 0x00ffefa0 long R 9 H 0000794b 0x0Offefa4 llong i H 000a R4 int SJE Watch A Watch A Watchs A Watcha 7 Break Stepping Completed Read wrte 48 69 i7 INS NM 4 Figure 6 23 HEW Window Step Out The data of variable a displayed in the Watch window is sorted in ascending order 356 RENESAS 6 12 3 Executing the Step Over Command The Step Over executes a function call as a single step and stops at the next statement of the main program e To step through all statements in the change function at a single step select Step Over from the Debug menu or click the Step Over button in the toolbar Figure 6 24 Step Over Button Edit View Project Options Build Debug Memory Tools Window Help l x osug s t relo Ta oralsasale n s 27m mn Ea as al oaae e e 2 Pea coma Hes 227 Sesera A a ala Se palm a ai7 le s alla e a m E a anaa TeS a
94. has occurred e The number of delay cycles after the event has occurred A maximum of eight points can be used as a combination in a sequence The program is activated or halted by an occurrence of the previous event in each sequence 279 RENESAS Range Channels Ch9 to Ch12 The emulator has 4 range channels The range channel can be defined as a combination of one or more of the followings e An address or an address range e Outside of an address range e A read a write or either e Data with a mask specification e Bus state e Area e The value of four external probe signals e The number of delay cycles after the event has occurred 5 15 4 Signals to Indicate Bus States and Areas In the event detection system signals indicating the MCU s bus states and the accessed areas can be specified as the event detection condition These signals are output from the MCU on the emulator the signals to be acquired will vary according to the emulator in use The signals to indicate bus states and areas are used to set the Bus Area condition of the event point They can also be acquired as the trace information The bus state signals are also used to set the condition not to acquire the trace Suppress option and in the Access Count Of Specified Range Measurement mode for measuring the hardware performance Access Type option For the trace function refer to section 5 16 Viewing the Trace Information For the hardware pe
95. header file This default behavior can be modified for this action This can be achieved via the configure view dialog The configure view dialog modifies the way data in the Navigation view is displayed gt To configure the C navigation views data 1 Right click on a C navigation item in the navigation window The pop up menu displayed in figure 13 2 is shown 2 Select the Configure view menu item 3 The dialog in figure 13 6 is displayed Decide what items you wish to modify and click OK to accept the changes Configure iew f x J Jump to definition on double click Cancel Figure 13 6 C Configure view dialog The following items are available on the configure view dialog e Group by access This option groups the display of public protected and private member variables and functions together in the Navigation view 172 RENESAS e Jump to definition on double click By default this option is checked If this option is switched off then a dialog is displayed which asks you where you wish to jump You rather than HEW resolve the ambiguity This dialog is shown in figure 13 7 Select Query Location xi Select the query to jump to Go to Declaration animal h line 12 Go to Definition animal h line 12 Figure 13 7 Select Query Location dialog Another useful facility is the capability of viewing the base or derived classes for a certain selection gt To view the Ba
96. in figure 5 102 waveform Properties Data Address H o0000000 7 Data Size bit 7 Cancel Channel Mono Stereo Buffer Size H o0000000 v Figure 5 102 Waveform Properties Dialog Box Specifies the waveform format The following items can be specified Data Address Specifies the start address of data in memory displayed in hexadecimal Data Size Selects 8Bit or 16Bit Channel Selects Mono or Stereo Buffer Size Specifies the buffer size of data displayed in hexadecimal After the settings have been made in the Waveform Properties dialog box clicking the OK button opens the Waveform View window Even after the Waveform View window is displayed the display contents can be modified by opening this dialog box by choosing Properties from the popup menu 333 RENESAS Figure 5 103 Waveform View Window Displays the memory contents as waveforms The X axis shows the number of sampling data and the Y axis shows the sampling value 5 19 2 Automatically Updating the Window Contents Checking Auto Refresh in the popup menu will allow the window contents to be automatically updated when user program execution stops 5 19 3 Updating the Window Contents Selecting Refresh Now from the popup menu immediately updates the window contents 5 19 4 Zoom In Display Selecting Zoom In from the popup menu displays the waveforms with the horizontal
97. insertion cursor at the point you would like to insert the placeholder select the required placeholder from the combo box and then click the Insert button 443 RENESAS Placeholder Configuration directory x Insert Figure C 3 Placeholder Combo Box In the fourth example type the placeholder into the field directly Ensure that you type the placeholder name in uppercase and that it is preceded by and followed by i e This is correct FILEDIR These are incorrect Filedir FILEDIR FILEDIR 444 RENESAS C 3 Available Placeholders Table C 1 lists the placeholders and their meanings Table C 1 Placeholders Placeholder Meaning FULLFILE Filename including full path FILEDIR File directory FILENAME Filename excluding path and including extension FILELEAF Filename excluding path and extension EXTENSION File extension WORKSPDIR Workspace directory WORKSPNAME Workspace name PROUJDIR Project directory PROJECTNAME Project name CONFIGDIR Configuration directory CONFIGNAME Configuration name HEWDIR HEW installation directory TCINSTALL Toolchain install directory on option dialog TOOLDIR Tool installation directory Tools Administration TEMPDIR Temp directory WINDIR Windows directory WINSYSDIR Windows system directory EXEDIR Command directory USERNAME Us
98. involved File leaf Filename excluding extension of file involved File extension Extension of file involved in operation File directory Directory of file involved in operation Configuration directory Current configuration directory Project directory Current project directory Workspace directory Current workspace directory Temp directory Temporary directory Command directory Version control executable directory Windows directory Directory where Windows is installed Windows system directory Directory where Windows system files exist Workspace name Current workspace name Project name Current project name Configuration name Current configuration name 8 3 1 Specifying File Locations When referring to a file s location be sure to use a placeholder otherwise the command will only relate to a hardwired file For example let s imagine that a version control executable has been selected which uses a GET command to obtain a read only copy of a file The Arguments field could be specified as GET c vc files project main c However when executed this command can only ever get the file MAIN C To resolve this problem HEW uses a system of placeholders and directory mappings The latter tell the HEW which working directories i e where source files are being worked on map to which controlled directories i e where the source files are stored in the version control system Mappings between these two directory
99. launched Specify a keyword in the Keyword field and click OK to close the dialog To remove a keyword select the keyword and click the Remove button Add Keyword Keyword _ AES pa Cancel Figure 4 13 Add Keyword Dialog When you create a new file syntax coloring will not be active as a new file does not initially have an extension new files are named arbitrarily by the editor without an extension In order to activate syntax coloring you must save the new file with a name which has one of the above extensions To disable enable syntax coloring 1 Select Tools gt Options The Options dialog will be displayed Select the Editor tab figure 4 7 2 Set the Enable syntax coloring check box as necessary and then click OK 88 RENESAS 4 12 Templates When developing software it is often necessary to enter the same text repeatedly for instance when typing a function definition for loop or a comment block for a function The High performance Embedded Workshop editor allows you to specify a block of text or template which can be inserted into the currently active editor window Thus once a template has been defined it can be automatically inserted without the need to re enter it manually 4 12 1 Defining a Template gt To define a template 1 Select Edit gt Templates gt Define Templates select Templates gt Define Templates from the local men
100. like to search the directory specified and all directories below it 4 Click the Start button to begin the search During the search the Start button will change to a Stop button Click the Stop button to halt the search at any time 5 The results of the search are shown in the Located components list Select a component and click Register to register an individual component or click Register All to register all located components 6 Click Close to exit the dialog 97 RENESAS 5 3 2 Registering a Single Component The HEW allows you to navigate directly to a single component in order to register it The HEW Registration File HRF is located in the root directory of a component s installation gt To register a component 1 Click the Register button on the Tools Administration dialog A standard file open dialog will be launched with its file filter set to HEW Registration Files hrf 2 Navigate to the HRF file of the component you would like to register select it and then click Select 3 A dialog will be invoked which displays information regarding the selected tool Click Register to confirm that you want to register the tool or click Close to abort the operation 5 4 Unregistering Components The components which are registered with the HEW affect the way in which it behaves For example every compatible system tool which is regist
101. not matter that CHANGEDIR and SETENV are not file names They will be treated as files that do not exist and so the commands will always be executed 457 RENESAS F 3 3 Sub command files If you wish hmake to generate a sub command file for you then the command part of the description block should be specified as follows this replaces lt commandn gt above lt command start gt lt lt lt sub commandl1 gt lt sub command2 gt lt sub commandn gt lt lt lt command end gt This will generate a sub command file in the windows temporary directory which will contain the lines lt sub command1 gt lt sub command2 gt etc This command file will be deleted once the make process has completed The name of the command file will be substituted for all the text between the two lt lt s You do not have to worry about the name of the sub command file This is generated by hmake For example e dirl filel obj c dirl filel c c dirl filel h gt gcc lt lt gt c o dirl filel obj c dirl filel c ger If the sub command file generated has the name c temp hmk111 cmd then the following would be executed by hmake assuming c dirl file1 obj is out of date gece c temp hmk111 cmd The command file c temp hmk111 cmd would contain c o c dirl filel obj c dirl filel c It is possible to include more than one command in the description block and to use combinations of
102. once gt To build multiple projects 1 Select Build gt Build Multiple The figure displayed in figure 2 18 2 The build multiple gives you the choice of which projects and configurations should be built To select which projects and configurations need to be built select the check box next to the project configuration combination you want to build For example in figure 2 18 if you wanted to build the entire hewtest2 project you would check the hewtest2 Debug and the hewtest2 Release selections and leave all other check boxes unchecked 3 When you are happy with your chosen selection click the build button and the HEW will then build the projects and configurations you have chosen If you want to build all the projects which you choose you click the build all button Results from the build are displayed in the build window in the same way as the normal build process Build Multiple x hewtest1 Debug hewtest Release hewtest2 Debug hewtest2 Release hewtest3 Debug hewtest3 Release hewtest4 Debug hewtest4 Release Jhewtest5 Debug hewtest5 Release Cancel Figure 2 18 Build Multiple Dialog 27 RENESAS 2 6 5 The Output Window When a tool executes i e compiler assembler linker etc its output is displayed in the Output window If any of the tools produce any errors or warnings then they are displayed along with the source file name and th
103. onto the Buttons area To remove a user defined toolbar 1 Select Tools gt Customize The dialog shown in figure 6 1 will be displayed 2 Select the user defined toolbar from the Toolbars list and the Reset button in figure 6 1 changes to the Delete button Then click the Delete button To reset a standard toolbar back to its original state 1 Select Tools gt Customize The dialog shown in figure 6 1 will be displayed 2 Select the standard toolbar from the Toolbars list and then click the Reset button To show or hide toolbar tooltips 1 Select Tools gt Customize The dialog shown in figure 6 1 will be displayed 2 Set the Show Tooltips check box as desired To modify the toolbar name of a toolbar created by a user 1 Select Tools gt Customize The dialog shown in figure 6 1 will be displayed 2 In the Toolbars list select a toolbar which has been created by a user and whose name you want to modify 3 Modify the name of the toolbar in the Toolbar name filed 115 RENESAS 6 2 Customizing the Tools Menu The Tools menu can be customized to include your own menu options gt To add a new menu option 1 Select Tools gt Customize The dialog shown in figure 6 1 will be displayed Select the Menu tab see figure 6 4 The first thing for you to decide is whether you are adding a global application wide tool App
104. output trigger signals from external probe 2 EXT2 when specified addresses four points max are accessed Note that however some products do not support the bus monitoring function 3 2 Complex Event System CES In most practical debugging applications the program or hardware errors that you are trying to debug occur under a certain restricted set of circumstances For example a hardware error may only occur after a specific area of memory has been accessed Tracking down such problems using simple PC breakpoints can be very time consuming The emulator provides a very sophisticated system for giving a precise description of the conditions you want to examine called the complex event system This allows you to define events which depend on the state of a specified combination of the MCU signals The complex event system provides a unified way of controlling the trace break and timing functions of the emulator 3 2 1 Event Channels The event channels allow you to detect when a specified event has occurred The event can be defined as a combination of one or more of the followings e Address or address range e Address outside range e Read or Write or either e Data with an optional mask e MCU access type e g DMAC and instruction prefetch e MCU access area e g internal ROM and internal RAM e A signal state on one or more of the four external probes e A certain number of times that the event must be triggered e Del
105. possible to toggle the PC Breakpoints setting by either double clicking in the BP column of the line where the PC breakpoint is set or placing the cursor on the line and pressing the F9 key The setting to be toggled depends on the debugging platform 266 RENESAS 5 13 Elf Dwarf2 Support The HEW supports the Elf Dwarf2 object file format for debugging applications written in C C and assembly language for Renesas microcomputers Key Features e Source level debugging e C C operators e C C expression casting pointers references etc e Ambiguous function names e Overlay memory loading e Watch locals and user defined e Stack Trace 5 13 1 C C Operators The C C language operators are available amp l gt gt lt lt 6 lt gt lt gt amp amp Il Buffer_start 0x1000 R1 B 10001101 pointer 2 increment_size amp H FFFF0000 gt gt D 15 flag ER4 5 13 2 C C Expressions Expression Examples Object value p_Object gt value Class value value amp value array 0 Object value g_value Class function short struct STR value Specifies direct reference of a member C C Specifies indirect reference of a member C C Specifies reference of a member with class C Specifies a pointer C C Specifies a reference C C Specifies an array C C Specifies reference of a m
106. process Do NOT assume that any output from the tool you terminated is valid It is recommended that you delete any output files produced and ensure that the phase is executed again I have a text file in the editor but it does not show any syntax coloring Ensure that you have named the file i e saved it and that the Enable syntax coloring check box is set on the Editor tab of the Tools Options dialog which is launched via Tools gt Options HEW checks a file group to which the file s extension belongs and decides whether the file is colored To view the current defined extensions and their file groups use the File Extensions dialog which is launched via Project gt File Extensions To view coloring information use the Format tab of the Tools Options dialog which is launched via Tools gt Options See the Syntax Coloring section in chapter 4 Using the Editor for details I want to change the settings of a tool but the Tools gt Administration menu option cannot be selected Tools gt Administration cannot be selected while a workspace is open To enter the Tool Administration dialog first close the current workspace I did not edit any of the project files But some of files were built again when I selected Build gt Build A file is built again if any of the following conditions holds 1 The options for the current file have been modified since the last
107. record can be displayed in the following two ways e Select a trace record and choose View Source from the popup menu e Double click a trace record The Source or Disassembly window opens and the selected line is marked with a cursor 5 16 8 Trimming the Source Choose Trim Source from the popup menu to remove the white space from the left side of the source When the white space is removed a check mark is shown to the left of the Trim Source menu To restore the white space choose Trim Source while the check mark is shown 5 16 9 Acquiring a Snapshot of the Trace Information A snapshot can be acquired when you need to check the trace information during execution of the user program This is useful for checking time stamping or probe input signals To acquire a snapshot of trace information select Snapshot from the popup menu Trace acquisition is temporarily stopped to display a record of the latest trace information and then restarted A snapshot of trace information is only acquired during execution of the user program 5 16 10 Temporarily Stopping Trace Acquisition To temporarily stop trace acquisition during execution of the user program select Halt from the popup menu This stops trace acquisition and updates the trace display Use this method to check the trace information without stopping execution of the user program 5 16 11 Restarting Trace Acquisition To restart trace acquisition being stopped during ex
108. several extensions are specified be sure to separate them with a semicolon e g c h 4 Enter the directory in which you would like to search files into the Directory field Alternatively you may browse to the desired directory graphically if you click the Browse button 5 If you would like to search the directory specified and all directories below it then check the Search sub directories check box If you just want to search the single directory specified in the Directory field then ensure that this check box is not checked 6 Ifyou would like to search for character string as a whole word then check the Match case check box When this option is not selected the search will be for any string that is matched by the search string 7 Ifyou would like your search to be case sensitive i e to distinguish between upper and lower case letters then check the Match case check box 8 Click Find to begin the search Any matches found will be displayed in the Find in Files tab of the Output window To jump to an instance of the string double click on the desired entry in the Output window 77 RENESAS 4 5 3 Replacing Text Replacing text is similar to finding text as discussed in the previous section The difference is that when the text is found you have the option to replace it with other text gt To replace text in a file 1 Ensure that the window whose contents you wan
109. starts at the upper left position Display of data starts at the lower left position Specifies the position on the screen from which image display is to start valid when Part Size is selected X Position Y Position Specifies the X coordinate of the start position unless a prefix is included values are treated as decimal numbers Specifies the Y coordinate of the start location unless a prefix is included values are treated as decimal numbers RENESAS Width Height Size Specifies the height and width of an image to be displayed on part of the screen Width Pixel Specifies the width of the display unless a prefix is included values are treated as decimal numbers Height Pixel Specifies the height of the display unless a prefix is included values are treated as decimal numbers After the settings have been made in the Image Properties dialog box clicking the OK button opens the Image View window Even after the Image View window is displayed the display contents can be modified by opening this dialog box by choosing Properties from the popup menu w Image Figure 5 100 Image View Window The memory content is displayed as an image 5 18 2 Automatically Updating the Window Contents Checking Auto Refresh in the popup menu will allow the window contents to be automatically updated when user program execution stops 331 RENESAS 5 18 3 Updating the Window Co
110. subdirectories on your hard disk may contain many source files whereas the directly its mapped to in Visual SourceSafe will be initially empty Firstly you must select Visual SourceSafe as the version control system To add a file or files to Visual SourceSafe 1 Select the file s which you would like to add to Visual SourceSafe You may also select a file folder project folder a workspace folder or combination thereof When selecting the project or workspace folder then the system files will be added to the selected file list For example selecting the project folder will also add the project file to the file list If the project file is then checked out and the version is newer than when it was last loaded you will be asked whether you want to reload the project 2 Click the Add Files toolbar button Eh or select the Tools gt Version Control gt Add Files menu option When you add files to Visual SourceSafe the local versions in your working directory will become read only To check that the add files operation was carried out as you expected or to quickly review the status of all of the files in a project 1 Select the project folder whose files you want to check 2 Click the Status of Files toolbar button or select the Tools gt Version Control gt Status of Files menu option 3 The status of each file will be displayed in the Version Control tab of the Output window The information shown includes
111. that the E6000 is correctly operating When detecting an error the test program displays ERROR and stops execution In such cases the emulator hardware may be malfunctioning Inform a Renesas sales office of the test results in detail RENESAS 473 474 RENESAS Renesas Microcomputer Development Environment System User s Manual H8 300 and 300L E6000 Emulator Publication Date Rev 1 00 October 13 2004 Published by Sales Strategic Planning Div Renesas Technology Corp Edited by Technical Documentation amp Information Department Renesas Kodaira Semiconductor Co Ltd 2004 Renesas Technology Corp All rights reserved Printed in Japan Renesas Technology Corp Sales Strategic Planning Div Nippon Bldg 2 6 2 Ohte machi Chiyoda ku Tokyo 100 0004 Japan CENESAS RENESAS SALES OFFICES http Awww renesas com Refer to http www renesas com en network for the latest and detailed information Renesas Technology America Inc 450 Holger Way San Jose CA 95134 1368 U S A Tel lt 1 gt 408 382 7500 Fax lt 1 gt 408 382 7501 Renesas Technology Europe Limited Dukes Meadow Millboard Road Bourne End Buckinghamshire SL8 5FH U K Tel lt 44 gt 1628 585 100 Fax lt 44 gt 1628 585 900 Renesas Technology Hong Kong Ltd 7th Floor North Tower World Finance Centre Harbour City 1 Canton Road Tsimshatsui Kowloon Hong Kong Tel lt 852 gt 2265 6688 Fax lt 852 gt 2730 6071 Renes
112. the Cancel button closes this dialog box without executing instructions 262 RENESAS 5 11 5 Single Step To debug your code it is very useful to be able to step a single line or instruction at a time and examine the effect of that instruction on the system In the Source window then a step operation will step a single source line In the Disassembly window a step operation will step a single assembly language instruction If the instruction calls another function or subroutine you have the option to either step into or step over the function If the instruction does not perform a call then either option will cause the debugger to execute the instruction and stop at the next instruction e Stepping Into a Function If you choose to step into the function the debugger will execute the call and stop at the first line or instruction of the function To step into the function either click the Step In toolbar button or choose Debug gt Step In e Stepping Over a Function Call If you choose to step over the function the debugger will execute the call and all of the code in the function and any function calls that that function may make and stop at the next line or instruction of the calling function To step over the function either click the Step Over toolbar button or choose Debug gt Step Over e Stepping Out of a Function There are occasions when you may have entered a function finished stepping through the instruct
113. the current file from the current line ma Previous Bookmark Jumps to the previous bookmark in the current file from the current line Tha Clear All Bookmarks Clears all bookmarks in the current file 4 2 5 Templates Toolbar Buttons Tr Define Template Specify template text for subsequent insertion T Insert Template Insert the template selected in the drop down list at the current cursor position 72 RENESAS 4 3 Standard File Operations 4 3 1 Creating a New File gt To create a new editing window Select File gt New or click the new file toolbar button L or press CTRL N The window will be given an arbitrary name by default You can provide a new name when you save the file 4 3 2 Saving a File gt To save the contents of an editing window 1 Ensure that the window whose contents you want to save is the active window 2 Select File gt Save or click the save file toolbar button or press CTRL S 3 Ifthe file has not been saved before a file save dialog box will be displayed Enter a filename specify a directory and then click OK to create the file with the name given in the directory specified 4 Ifthe file has been saved before then the file will be updated no dialog box will be displayed gt To save the contents of an editing window under a new name 1 Ensure that the window whose contents you want to save is the active window 2 Select File gt Save As 3 A file save
114. the emulator uses the memory bus for up to 80 us in reading of 256 bytes 25 MHz internal ROM 2 MCU internal I O DTCRAM or user system memory The emulator stops the user program execution then modifies the memory contents Therefore the user program stops for a maximum of 2 ms in reading 256 bytes 25 MHz emulation memory 197 RENESAS 3 3 2 Clocks The clock can be specified as emulator internal clock or target clock The frequencies that can be specified as the emulator internal clock depend on the MCU For details refer to section 8 Software Specifications Specific to This Product 3 3 3 Probes External probes 1 and 2 EXT1 and EXT2 can be connected to the emulator to make use of signals on the user system for break or trace The signal for external probe 1 can be set as the condition for the event detection system depending on the low or high level Since the signal for external probe 2 outputs high level when the trigger setting 1 to 4 condition is matched in the bus monitor function the signal can be used for the trigger condition for such as an oscilloscope 3 4 Stack Trace Function The emulator uses the stack s information to display the name of the calling function for a function at which the program counter is currently pointing This function can be used only when the load module that has the Dwarf2 type debugging information is loaded For the usage of this function refer to section 6 17 Stack Trace Function
115. the register to open a dialog box to modify the register contents When you have entered the new number or expression click the OK button or press the Enter key the dialog box closes and the new value is written into the register 5 6 5 Saving the Currently Displayed Contents The contents currently displayed in the window can be saved in a text file Select Save to File from the pop up menu 247 RENESAS 5 7 Viewing the Current Status Choose View gt CPU gt Status or click the View Status toolbar button see the current status of the debugging platform Target Device Configuration 00000000 OOO1LFFFF OOFFBOOO OOFFEFBF OOFFF800 OOFFFF3F OOFFFF60 OOFFFFBF OOFFFFCO OOFFFFFF System Memory Resources SIMM Module 1MB SIMM fitted Ram Bases 0 not used l not used 2 not used 3 not used Program Name Memory Loaded Area Internal Internal Internal Internal Internal ator_cp Tutorial abs H ooooo0000 H oo0000003 H 00000400 H 00000425 H 00001000 H OOOO1SFS H 00002000 H 00002139 to open the Status window and Figure 5 30 Status Window The Status window has three sheets e Memory sheet Contains information about the current memory status including the memory mapping resources and the areas used by the currently loaded object file e Platform sheet Contains information about the current status of the debugging platform typically including CPU type a
116. the stop event Starts and stops trace acquisition when the conditions for starting and ending are satisfied respectively Selecting Cyclic allows a continuous acquisition of trace information that can be acquired with the specified condition 302 RENESAS 5 16 4 Searching for a Trace Record Use the Trace Find dialog box to search for a trace record To open this dialog box choose Find from the popup menu The Trace Find dialog box has the following options Table 5 5 Trace Find Dialog Box Pages Page Description General Sets the range for searching Address Sets an address condition Data Sets a data condition R W Selects the type of access cycles Area Selects the area being accessed not available when a time stamp is acquired Status Selects the status of a bus not available when a time stamp is acquired Probes Selects the status of four probe signals not available when a time stamp is acquired IRQ7 0 Selects the status of eight probe input signals not available when a time stamp is acquired Timestamp Specify the time stamp value for bus cycles only available when a time stamp is acquired Note Items other than General Address Data R W Area Status Probes and Timestamp vary according to the emulator in use For details refer to section 8 Software Specifications Specific to This Product or the online help Clicking the OK
117. the user system interface cable is not connected the read value is 1 due to pull up resistors Table 8 17 Differences in I O Registers MCU Group VO Address H8 3256 H8 3257 H8 322 H8 323 H8 324 H8 325 Note FFDF X X X X X X Registers that do not FFE8 X X X X X X exist in the actual MCU can be read in the emulator Write access is ignored Note X indicates that a register that does not exist in the actual MCU can be accessed in the emulator Access to the Reserved Area When accessing the reserved area note the following 1 Part of the reserved area specified in each MCU s memory map can be used as an external address area when the RAME bit of the SYSCR is cleared to 0 On Board or Emulator can be specified for this area with the Configuration settings 2 If the reserved area other than that described in item above is used the operation in the actual MCU cannot be guaranteed If the user program extends to the reserved area during debugging select the MCU having the largest memory capacity for example debug the H8 322 program in the H8 325 mode Use of Internal RAM Area as External Memory The internal RAM area cannot be used as an external address area even when the RAME bit of the SYSCR is cleared to 0 User Program Execution by the Go Reset Command When the user program is executed by the Go Reset command a reset signal is input for about 16 to 17 system clock 0 cycles to the evaluation chip fr
118. the user system allocate this area to the emulation memory copy the code and then set the PC breakpoints 5 15 2 Event Points Event points can be used for higher level conditions such as the data condition as well as specification of the single address Up to 12 event points can be set by using event channels and range channels in the event detection system When the condition is satisfied event points are also used as the start end conditions for execution time measurement or trace acquisition in addition to halting the user program Several event points can be used to set more complex conditions Note Event points acquire the data test conditions and execute an action such as halting the user program by the hardware circuit of the emulator Therefore a delay of several cycles will occur from the satisfaction of the condition to the execution of an action 5 15 3 Event Detection System In addition to the 4 range channels the emulator also has 8 event channels The event channels have more functions such as sequencing or counting than the range channels Event Channels Ch1 to Ch8 The emulator has 8 event channels The event channel can be defined as a combination of one or more of the followings e An address or an address range e Outside of an address range e A read a write or either e Data with a mask specification e Bus state e Area e The value of four external probe signals e The number of times the event
119. then click OK to add the new variable to the Environment tab Placeholder pop up menus are included to ensure that the environment can be specified as flexibly as possible For a detailed description of placeholders see appendix C Placeholders To modify an environment variable select the variable that you want to modify from the Environment tab and then click the Modify button Make the required changes to the Variable and Value fields and then click OK to add the modified variable to the Environment tab To remove an environment variable select it and then click the Remove button Environment Yariable 2 xi Variable a Value Placeholder c dos c mytools c Wwindows c temp popup menu Figure 5 7 Environment Variable Dialog 100 RENESAS 5 6 Uninstalling Components The HEW provides a built in uninstaller method which can remove unregistered components gt To uninstall a component 1 Select Tools gt Administration 2 Click on the uninstaller button The Uninstall HEW Tool dialog is invoked figure 5 8 Uninstall HEW Tool 21x Close Select the directory in which to begin the search for tools xe winkdebug Browse IV Include subfolders Located Tools which can be uninstalled Component Version Installation Directory Uninstall i pip Search Status Idle Figure 5 8 Uninstall HEW Tool 3
120. there are some differences in I O registers between an actual MCU and the emulator as shown in table 8 15 Note these differences when accessing the I O registers I O port is in the input state at default The I O register contents indicate the emulator port status When the user system interface cable is not connected the read value is 1 due to pull up resistors Table 8 15 Differences in I O Registers I O Address H8 338 Group H8 329 Group Note FF8F X oO FFDF X X FFE9 X X Accessing these registers will change the FFEB X x aak e Sd register Do not FFFO X O FFF2 FFFF X 0 Note X indicates that a register that does not exist in the actual MCU can be accessed in the emulator Access to the Reserved Area When accessing the reserved area note the following 1 Part of the reserved area specified in each MCU s memory map can be used as an external address area when the RAME bit of the SYSCR is cleared to 0 On Board or Emulator can be specified for this area with the Configuration settings 2 Ifthe reserved area other than that described in item above is used the operation in the actual MCU cannot be guaranteed Use of Internal RAM Area as External Memory The internal RAM area cannot be used as an external address area even when the RAME bit of the SYSCR is cleared to 0 User Program Execution by the Go Reset Command When the user program is executed by the Go Reset command a reset sign
121. time possible for measurement will be displayed with prompt gt that indicates that the counter has overflowed Enable read and write on the fly When this box is checked it is possible to access the target system memory while the user program is running Do not check this box if you require realtime emulation Note When the content of the memory is modified during the user program execution e g modification in the Memory window or by the MEMORY_EDIT command HEW reads the content to update the value HEW also reads the memory content when the content has been updated by operations such as selecting Memory gt Refresh In this case the content of memory is read and then updated in each of the windows To prevent unnecessary reading of the memory content close the window displaying the memory content such as the Memory or Disassembly window or make the settings so that the content will not be updated The Monitor window or the Watch window that satisfies the conditions listed below displays the memory content Note that however opening these windows does not prevent realtime operation because the method of updating the memory content in these windows is different Conditions 1 Registered symbols are only allocated to general purpose registers 2 Registered symbols are only allocated to the monitor range set by the Monitor function the mark R is colored in blue 3 Registered symbols are
122. to the Memory window display choice that you wish to change Either double click on the memory unit or press the Enter key The dialog box shown in figure 5 21 is displayed Edit Memory Current Value HFF Cancel New Value pan Figure 5 21 Edit Memory Dialog Box A number or C C expression can be entered in the New Value field After you have entered the new number or expression click the OK button or press the Enter key Then the dialog box closes and the new value is written into memory The memory contents can also be modified by moving the cursor on the memory unit and entering the new value in hexadecimal through the keyboard 5 5 6 Selecting a Memory Range If the memory address range is in the Memory window you can select the range by clicking on the first memory unit according to the Memory window display choice and dragging the mouse to the last unit The selected range is highlighted 239 RENESAS 5 5 7 Finding a Value in Memory To find a value in memory open the Memory window and select Search from the popup menu or from the Memory drop down menu The Search Memory dialog box shown in figure 5 22 is displayed Data m Search Data As Byte amp 1 z IV Search Equal Data I Search Backward Figure 5 22 Search Memory Dialog Box Enter the start and end addresses of the range in which to search and the data value to search for and select the search
123. toolbar button or click the right mouse button on a project icon in the Projects tab of the Workspace window and select Build All from the pop up menu 2 6 2 Building Individual Files The High performance Embedded Workshop lets you build project files individually To build an individual file 1 Select the file which you want to build from the project window 2 Select Build gt Build File click the build file toolbar button S29 or press CTRL F7 or click the right mouse button on a file icon in the Projects tab of the Workspace window and select Build lt file gt from the pop up menu 26 RENESAS 2 6 3 Stopping a Build The High performance Embedded Workshop allows you to halt the build process gt To stop a build 1 Select Build gt Stop Build or click the stop build toolbar button The build will be stop after the current file has been built 2 Wait until the message Compiler Finished appears in the Output window before continuing gt To forcibly terminate a current tool 1 Select Build gt Terminate Current Tool The HEW will attempt to stop the tool immediately Note Do NOT assume that any output from the tool you terminated is valid It is recommended that you delete any output files produced and ensure that the phase is executed again 2 6 4 Building Multiple Projects The High performance Embedded Workshop lets you build multiple projects and configurations at
124. trademarks of their respective companies or organizations Document Conventions This manual uses the following typographic conventions Table 1 Typographic Conventions Convention Meaning Menu gt Menu Option Bold text with gt is used to indicate menu options for example File gt Save As FILENAME C Uppercase names are used to indicate filenames enter this string Used to indicate text that must be entered excluding the quotes Key Key Used to indicate required key presses For example CTRL N means press the CTRL key and then whilst holding the CTRL key down press the N key gt When this symbol is used it is always located in the left hand margin The how to symbol It indicates that the text to its immediate right is describing how to do something Components Check all the components described in the component list unpacking If the components are not complete contact a Renesas sales office RENESAS Contents HEW Part 1 COW OLVICW vsssseassessceitesaseyacestgeniesnagasiaaneyonees paneeiaesasuvacesigasiveaeginacastierss 1 1 1 Workspaces Projects and Files cccssecssceeseeseeseeeeceeeeeceeceaeeaeeaeeaeeeeeeeeaeeaeeaeeeeeeseneeaees 1 12 The Maiti Window ereinen aea AAE EA 2 12i SWS Title Banoa ieee EEE EE EEEE OOE REENE 2 122 ThE Medu Ball siscssssccccssvactecsswestessdveteccduanteasSuswteasvesudiasdvassiestnitiestvecatessve
125. trigger output condition for EXT 2 88 TRIGGER_SET TGS Sets the trigger output condition for EXT 2 89 UPDATE_ALL_ UD Updates the dependencies for the current project DEPENDENCIES 90 USER_SIGNALS US Enables or disables the user signal information For the syntax of each command refer to the online help RENESAS 467 468 RENESAS Appendix I Diagnostic Test Procedure This section describes the diagnostic test procedure using the E6000 test program I 1 System Set Up for Test Program Execution To execute the test program use the following hardware do not connect the user system interface cable user system or expansion I O board For the H8 300 series E6000 emulator e E6000 emulator HS3008EPI60H e H8 300 series evaluation chip set which is one of the followings H8 300 group evaluation chip set HS3308EVI60H H8 350 group evaluation chip set HS3508EVI60H H8 338 H8 329 group evaluation chip set HS3398EVI60H H8 3334 group evaluation chip set HS3334EVI60H H8 3257 H8 325 group evaluation chip set HS3257EVI60H H8 3437 H8 3337Y H8 3297 group evaluation chip set HS3437EVI60H H8 3217 H8 3318 group evaluation chip set HS3318EVI60H For the H8 300L series E6000 emulator e E6000 emulator HS3LO8EPI60H e H8 300L series evaluation chip set which is one of the followings H8 3834 H8 3814 group evaluation chip set HS3834EVI60H H8 3637 H8 3877 group evaluation chip set HS3876EVI60H H8 3927 group evaluation ch
126. two tabs which are concerned with the ordering of phases Build Order and Build File Order And then you can click OK button 45 RENESAS 3 3 1 Build Phase Order The Build Order tab figure 3 6 displays the current order in which phases will be executed when the build or build all operation is selected The check box to the left of each phase indicates whether or not it is currently enabled By clicking this box the phase can be toggled on or off Build Phases x Build Order Build File Order File Mappings Build phase order VSH C C Library Generator Add VISH C C Compiler VISH Assembler Modi OptLinker Remove Mave Up LL Move Down Figure 3 6 Build Phases Dialog Build Order Tab In addition the following operations can be performed gt To remove a phase 1 Select the phase that you would like to remove 2 Click the Remove button 3 Click the Yes button if a confirmation dialog box gt To view the properties of a system phase 1 Select the system phase that you would like to examine 2 Click the Modify button 3 System properties are shown as dialog box Click the OK button gt To move a phase 1 Select the phase that you would like to move 2 Click the Move Up or Move Down button gt To import a phase 1 Click the import button A dialog is disp
127. u hows the ID number of ct he upper board of the 6000 always 1 ica Shows the revision number of the upper board of the E6000 Loading the test program Shows the check results for the registers in the E6000 normal completion Shows the results of decoding test and marching test for the dual port RAM in the E6000 normal completion Shows the results of decoding test for the firmware RAM in the E6000 normal completion Shows the results of marching test for the firmware RAM in the E6000 normal completion 471 Downloading firmware 04 05 06 07 08 09 472 Testing Trace RAM Decode Test page H 0xx of range H 000 Decode Test page range H 000 H 04f Marching Test page H 0xx of range H 000 Marching Test page range H 000 H 04f Testing Mapping RAM Decode Test page H 2xx of range H 200 Decode Test page range H 200 H 21f Marching Test page H 2xx of range H 200 Marching Test page range H 200 H 21f Testing Emulation RAM Decode Test gig sesecessessasasaadass OK Marching TES 4 5 wiccme cma sem ms ees 3 OK Testing STEP Operation Mode 1 Single Step Operation OK Mode 1 Step Into Operation OK Mode 2 Single Step Operation OK Mode 2 Step Into Operation OK Testing Key Break KEY BIBIR 6o5 55 5 55 5HH9 5 H5DHHHH H 5 H4 905 OK Testing Emulation RAM Hardware Break GRD Break WPT Break RENESAS Loading the
128. when a time stamp is acquired Probes Selects the states of four probe signals not available when a time stamp is acquired IRQ7 0 Selects the states of eight IRQ input signals not available when a time stamp is acquired Timestamp Specifies the time stamp value for bus cycles only available when a time stamp is acquired Note Items other than General Address Data R W Area Status Probes and Timestamp vary according to the emulator in use For details refer to section 8 Software Specifications Specific to This Product or the online help Set filtering conditions and then press the OK button This starts filtering according to the conditions Clicking the Cancel button closes the Trace Filter dialog box which holds the settings at the time when the dialog box was opened In filtering only the trace information that satisfies one or more filtering conditions set in the above pages will be displayed in the Trace window Filtering conditions can be changed several times to analyze data because the content of the trace buffer is not changed by filtering 314 RENESAS 1 General page Set the range for filtering Trace Filter Status Probes IRQ 0 General Address Data RAW Area Co Enable Filter oe L Not designation Trace display range Start PTR End PTR Cancel Apply Figure 5 85 Trace Filter Dialog Box Gen
129. you are using a toolchain supported by HEW errors and warnings can be double clicked to jump to the source files The help link should also be supported Note when using the HMAKE exe system the build all button will pass a command to HMAKE to force a re build all operation When using GNUMake this is not supported 66 RENESAS 3 12 Customizing the HEW linkage order Object module are linked as alphabetical order in HEW default You can specify the linkage order if you wish to gt To switch on manual linkage order facilities 1 Click the Build gt Linkage Order menu item 2 On the dialog displayed click the Use custom linkage order check box figure 3 25 3 Then you can move the objects into whichever order you need Simply select the module and click the up and down buttons to position it in the desired location Each module has a different icon depending on where it originated 5 Click OK to verify and save the settings Linkage order 29 xi IV Use custom linkage order Object order Cancel main obj OK resetpra obj Move up intprg obi EA _ runtime_library lib 4 projectname lib user_edit_options lib Intermediate file File in project User library from options Current configuration Debug 7 Copy to Figure 3 25 Linkage order Dialog When you are using multiple configurations it is likely that the linkage order will be very similar To do this effectivel
130. 0 Event Window Before Setting a PC Breakpoint e Click the Event window with the right hand mouse button and select Add from the popup menu e The Breakpoint Event Properties dialog box is displayed RENESAS 359 Breakpoint Event Properties 2 x General Type m Address PC Break Dont Care Address Range Address Lo oo fH 00001082 Address Hi oo aaa F Outside Range Data Compare Direction F Compare F Use Mask Read Value pmo ahi write Word ho Either Figure 6 31 Breakpoint Event Properties Dialog Box e Check the PC Break radio button in the Type group box e Use the Source window to refer to the address on the line that has p_sam gt sO a 0 within the tutorial function and enter this address in the Address Lo edit box of the Address group box In this example enter H 00001082 Note This dialog box differs according to the product For the items of each product refer to section 8 Software Specifications Specific to This Product or the online help e Click the OK button The PC breakpoint that has been set is displayed in the Event window lene TT Program Enable PC H 00001082 Tutorial cpp 47 Break 4 gt Breakpoint Figure 6 32 Event Window PC Breakpoint Setting Note The items that can be displayed in this window differ depending on the product For the items that
131. 00 emulator and for the combination of the E6000 user system interface cables and optional boards RENESAS 385 7 1 2 Operating Voltage and Frequency Specifications Table 7 2 shows the MCU operating voltage and frequency specifications supported by the E6000 emulator If the emulator is used in an environment that exceeds the operating voltage range and operating frequency range guaranteed for the MCU operation normal emulator operation is not guaranteed Note that the operation with low voltage or high frequency is not supported in some MCUs Table 7 2 Operating Voltage and Frequency Specifications No MCU Type Operating Voltage V Operating Frequency 0 MHz 1 H8 330 group 4 5 5 5 0 5 10 0 H8 350 group 4 5 5 5 4 0 10 0 H8 338 group 2 7 5 5 0 5 5 0 4 5 5 5 0 5 10 0 4 H8 329 group 2 7 5 5 0 5 5 0 4 5 5 5 0 5 10 0 5 H8 3332 group 2 7 5 5 0 5 5 0 H8 3334 group 4 5 5 5 0 5 10 0 6 H8 3257 group 2 7 5 5 2 0 5 0 4 5 5 5 2 0 10 0 H8 325 group 4 5 5 5 0 5 10 0 H8 3437 group 2 7 5 5 2 0 10 0 4 0 5 5 2 0 12 0 4 5 5 5 2 0 16 0 9 H8 3337Y group 2 7 5 5 2 0 10 0 4 0 5 5 2 0 12 0 4 5 5 5 2 0 16 0 10 H8 3534 group 4 5 5 5 2 0 10 0 11 H8 3522 group 4 5 5 5 2 0 10 0 12 H8 3297 group 2 7 5 5 2 0 10 0 4 0 5 5 2 0 12 0 4 5 5 5 2 0 16 0 13 H8 3217 group 2 7 5 5 2 0 10 0 4 0 5 5 2 0 12 0 4 5 5 5 2 0 16 0 14 H8 3218 group 2 7 5 5 2 0 10 0 4 0 5 5 2 0 12
132. 05C address Figure 6 47 Trace Acquisition Dialog Box Setting Completed 8 Make the setting such that the break occurs after the instruction at the address on the line that has a i j within the tutorial function H 0000105C in this example has been executed five times for details on this refer to section 6 15 2 Breaking Execution at Event Points 9 Select Reset Go from the Debug menu Processing stops when the break condition is satisfied and the Trace window then displays the following content Generic Trace 2 0 x PTR Address Instruction Data R W Area Status Clock Probes NMI IRQ7 0 Timestamp Source Timestamp Difference 00004 00105c EXTS L ER4 17f4 RD ROM PROG 1 ALLL 1 ILILILILIL 00003 00105c EXTS L ER4 17f4 RD ROM PROG 1 illl 1 11111111 00002 00105c EXTS L ER4 17f4 RD ROM PROG i llll 1 11111111 00001 00105c EXTS L ER4 17 4 RD ROM PROG 1 iil 1l 11111111 RD 1 1 400000 00105c EXTS L ER4 17f4 ROM PROG illl 11111111 Figure 6 48 Trace Window Displaying the Result If you have trouble viewing a column drag the header vertical bars below the title bar to adjust the width of the column 10 Remove the event points that have been set and clear the trace information Click the right hand mouse button on the Event window to display a popup menu Select Delete All from this menu to remove all of the event points that have be
133. 0H lt Drive gt Diag HS3876EVI60H HS3927EVI60H lt Drive gt Diag HS3927EVI60H HS3644EPI60H lt Drive gt Diag HS3644EPI60H Enter one of the following commands according to the PC interface board in use to initiate the test program 1 PCI bus interface board HS6000EICO1H or HS6000EICO2H HS3308EVI60H gt TM330 PCI RET HS3508EVI60H gt TM350 PCI RET HS3398EVI60H gt TM339 PCI RET HS3334EVI60H gt TM3334 PCI RET HS3257EVI60H gt TM3257 PCI RET HS3437EVI60H gt TM3437 PCI RET HS3318EVI60H gt TM3318 PCI RET HS3834EVI60H gt TM3834 PCI RET HS3876EVI60H gt TM3876 PCI RET HS3927EVI60H gt TM3927 PCI RET HS3644EPI60H gt TM3644 PCI RET 2 PCMCIA interface card HS6000EIP01H HS3308EVI60H gt TM330 PCCD RET HS3508EVI60H gt TM350 PCCD RET HS3398EVI60H gt TM339 PCCD RET HS3334EVI60H gt TM3334 PCCD RET HS3257EVI60H gt TM3257 PCCD RET HS3437EVI60H gt TM3437 PCCD RET HS3318EVI60H gt TM3318 PCCD RET HS3834EVI60H gt TM3834 PCCD RET HS3876EVI60H gt TM3876 PCCD RET HS3927EVI60H gt TM3927 PCCD RET HS3644EPI60H gt TM3644 PCCD RET The HEW must be installed before the test program is executed Be sure to initiate the test program from lt Drive gt Diag HS3437EVI60H Do not initiate it from a directory other than lt Drive gt Diag HS3437EVI60H such as gt lt Drive gt Diag HS3437EVI60H TM3437 PCI RET If th
134. 2 The addresses figured out are just for reference In some cases the end address of a function may be different Check the last instruction of the function in the Disassembly window to correct the value set in End Address so that it will be the address of the last instruction in general the last instruction of a function is a RTS instruction A label name or an expression can be entered instead of an address value in boxes where an address should be entered 5 20 3 Starting Performance Data Acquisition Execute the ANALYSIS command in the Command Line window to enable measurement of the execution time rate Executing the user program automatically starts measuring the rate of execution time Stopping the user program displays the result of measurement in the Performance Analysis window Note For details on the ANALYSIS command refer to the online help 5 20 4 Deleting a Measurement Condition Select Reset from the popup menu with a measurement condition selected to delete the condition 5 20 5 Deleting All Measurement Conditions Choose Reset All from the popup menu to delete all the conditions that have been set 337 RENESAS 338 RENESAS Section 6 Tutorial 6 1 Introduction The following describes the main functions of the emulator by using a tutorial program The tutorial program is based on the C program that sorts ten random data items in ascending or descending order The tutorial program performs the f
135. 3 25 1 Selecting a Configuration sessies esei iii eisai 24 2 5 2 Adding and Deleting Configurations sesssssssesessssssresssssessserestrestntstnesesesesesent 25 2 6 Buildms a Project en i E Ea OE EE OSN TEE EEEE 2 6 1 Building a Project 2 6 2 Building Individual Files ssissisessssssivssessrissvessosvesssssseessreseresressirssavassrasivisveesss ii 26 2 6 3 Stopping a Build wl 2 6 4 Building Multiple Projects 21 2 6 5 The Output Window 0 eee eee 28 2 6 6 Controlling the Content of the Output Window 0 eee eee eeeeeeee teens 28 2 6 7 Displaying out of date files in the workspace WindowW ccceeeeeeseeeee tees 30 27 File DEPENden cies naroa oieri rinie S OENE E ESES ENEA cess 31 2 8 Configuring the Workspace WindoW s s sessssssssssssssssssresssssstsisrsenrsinrnrnrnrnrnrrsesrseseersee 31 2 8 1 Show Dependencies under Each File oo cece ese cee ceeeeceeeeeeeeseeeeeeeeeeeaeees 31 2 8 2 Show Standard Library Includes cee cse cess sees sseeseesaeseeeeteeeeeseeees 32 283 Show PileiPAths ssssevszisesskcaceussatesctssscedadosacess sasvieseded ecasedenctsenssvosssaabieassnodvarssaaevecs 32 28A Sort files by time Ordetiss cc cccctcessccsscisecetcesssectisssvestesconessoacsecvnesestostensseondisnneoncdes 33 2 9 Setting the Current Project 233 2 10 Inserting a Project into a Workspace esesessssesssssrsesrsrsrrsreresesssssenesrntsrnenenentnenenenenerere 34 2 11 Specifying Dependencies between Projects
136. 35 RH to 80 RH no condensation Vibration Operating 2 45 m s max Storage 4 9 m s max Transportation 14 7 m s max Ambient gases No corrosive gases may be present 1 4 Emulator External Dimensions and Mass Table 1 2 Emulator External Dimensions and Mass Item Specifications Dimensions 219 x 160 x 54 mm Mass Approximately 970 g RENESAS 181 182 RENESAS Section 2 Preparation before Use 2 1 Emulator Preparation Unpack the emulator and prepare it for use as follows A WARNING READ the reference sections shaded in figure 2 1 before using the emulator product Incorrect operation will damage the user system and the emulator product The USER PROGRAM will be LOST Reference Unpack the emulator Component list Check the components against the component list Setup Section 3 Set up the emulator Insert the optional board Install the HEW Connect the interface cable Turn on the user system Section 4 Only when the user system is connected Turn on the emulator Activation Start the HEW Figure 2 1 Emulator Preparation Flowchart 2 2 Installing Emulator s Software To install the HEW refer to the Setup Guide for the E6000 Emulator supplied together with the emulator 183 RENESAS 2 3 Connecting to the User System To connect the emulator to a user system proceed as follows e Connect the user system interface cable head to the user system e P
137. 51015 Figure 7 12 User System Interface Circuit for EXTAL STBY Hardware standby cannot be used 10 KQ Evaluation chip Figure 7 13 User System Interface Circuit for STBY ANO P70 to AN7 P77 Evaluation o User system chip 470 interface cable Figure 7 14 User System Interface Circuit for ANO P70 to AN7 P77 AVcc and AVss Evaluation chip User system 27KQ j interface cable Figure 7 15 User System Interface Circuit for AVcc and A Vss 392 RENESAS 7 3 4 User System Interface Circuits of the H8 338 H8 329 Group Evaluation Chip HS3398EVI60H All user system interface signals are directly connected to the evaluation chip in the emulator with no buffering except for those listed below which are connected to the evaluation chip through control circuits e RES NMI e MDO e MDI e EXTAL The circuits that interface the evaluation chip in the emulator to the user system include pull up resistors that cause signal delays Note that when an input terminal is in the high impedance state the pull up resistor forces the terminal to be at a high level Adjust the user system hardware to compensate for these effects The delay caused by the user system interface cable is about 3 ns The following diagrams show the user system interface signal circuits Default o User system interface cable Figure 7 16 Default User System Interface Circuit RES NMI and MDO These signals are input
138. 6 4 4 Save workspace before executing any tools To force the High performance Embedded Workshop into saving the current workspace before executing any build phases i e build build all or build file operations or version control commands set the Save workspace before executing any phases check box 6 4 5 Prompt before saving workspace In addition to the above check box set this to prompt before saving 6 4 6 Prompt before saving session Checking this option will force the High performance Embedded Workshop into displaying a prompt before the session is saved to disk 121 RENESAS 6 4 7 Save auto recovery info When you click this option every ten minutes as default HEW saves workspace project and session temporality Any changes you have made will be saved to temporary files If you open your workspace and the following dialog is displayed it means that the last time the workspace was used problems were encountered To recover the files check the checkbox alongside the filenames you wish to recover and click OK Clicking cancel will discard the auto recovery files and load from the original files HEW Workspace Auto Recovery 2 x HE W failed to shutdown correctly the last time you used this workspace Would you like to recover the following files rather than use the saved versions Filename Director demonstration hws c hew3 demonstration demonstration hwp c hew3 demonstration demonstrati defaul
139. 7 Setup the makefile options HMAKE allows the user to specify project or configuration selection options so that different builds can be launched from the same file Again this item is configuration based so you can have a different makefile options for each configuration For further details on HMAKE refer to Appendix F HMAKE User Guide F 1 3 Parameters 8 The final option is the generate make file before build This will launch the default make file creation utility before the makefile is executed This means the makefile will always be up to date with the HEW project system 9 Click OK to save the changes 65 RENESAS LT Ax Build Editor Workspace Confirmation Network m Errors and warnings I Stop build if the number of errors exceeds 0 J Stop build if the number of warnings exceeds 0 r Show I Command line J Initial directory I Environment J Mark out of date files m Makefile build Command excluding parameters SIHEWDIRNhmake exe gt Browse IV Use makefile build system Makefile options A Makefile path S WORKSPDIR make PROJECTNAME mak gt Browse IV Cancel Figure 3 24 Option Dialog Build tab Once this system is setup the build button menu and keyboard shortcuts are linked to the makefile tool execution All output is directed to the output window as in the case of the normal build If
140. 7 to FFD1 FFD2 FFD3 Bits 4 to 7 do not exist FFD4 FFD6 FFD7 FFD8 to FFDC FFDD Bits 4 to 7 do not exist FFDF to FFE1 FFE2 FFE3 Bits 4 to 7 do not exist FFE4 FFE5 FFF6 FFE7 FFE8 to FFEC FFED Bits 4 to 7 do not exist FFEE FFEF FFF4 Bits 0 and 1 do not exist FFF5 FFF6 Bit 5 does not exist FFF7 Bits 0 and 1 do not exist FFF8 FFFA to FFFF x X D DX D X D BD X D D D X D D XI D D D X X X D D X x X X DI X Note X indicates that a register that does not exist in the actual MCU can be accessed in the emulator A indicates that the initial value of the register differs between the actual MCU and the emulator e User Program Execution by the Go Reset Command When the user program is executed by the Go Reset command a reset signal is input for about 500 us to the evaluation chip from the emulator For the execution time measurement result the time for reset signal input is added 434 RENESAS 8 2 11 Notes on Use of the H8 3927 Group Evaluation Chip Set HS3927EVI60H e T O Register Differences Between Actual MCU and Emulator In the E6000H emulator one evaluation chip emulates several types of MCU Therefore there are some differences in I O registers between an actual MCU and the emulator as shown in table 8 23 Note these differences when accessing the I O registers The I O port is in the input state at defa
141. 70 interface cable Figure 7 28 User System Interface Circuit for ANO P70 to AN7 P77 396 RENESAS AVcc and AVss Evaluation chip User system 27KQ j interface cable Figure 7 29 User System Interface Circuit for AVcc and A Vss 7 3 6 User System Interface Circuits of the H8 3257 H8 325 Group Evaluation Chip HS3257EVI60H All user system interface signals are directly connected to the evaluation chip in the emulator with no buffering except for those listed below which are connected to the evaluation chip through control circuits e RES e NMI e MDO e MDI e EXTAL The circuits that interface the evaluation chip in the emulator to the user system include pull up resistors that cause signal delays Note that when an input terminal is in the high impedance state the pull up resistor forces the terminal to be at a high level Adjust the user system hardware to compensate for these effects The delay caused by the user system interface cable is about 3 ns The following diagrams show the user system interface signal circuits Default o User system 47 Q interface cable Figure 7 30 Default User System Interface Circuit RES NMI and MD0 These signals are input to the evaluation chip via HD151015 Therefore the rising falling time must be within 8 ns or less User system 479 interface cable HD151015 Figure 7 31 User System Interface Circuit for RES NMI and MDO 397 RENES
142. AS MD1 Includes a 12 V detection circuit for supporting microcomputers including flash memory 12 V detection User system circuit interface cable monitor register 27 kQ Figure 7 32 User System Interface Circuit for MD1 EXTAL Clock oscillator circuit is on the user system interface cable User system 47Q interface cable HD151015 Figure 7 33 User System Interface Circuit for EXTAL STBY Hardware standby cannot be used 10 KQ Evaluation chip Figure 7 34 User System Interface Circuit for STBY P70 to P77 Evaluation o User system chip 470 interface cable Figure 7 35 User System Interface Circuit for P70 to P77 398 RENESAS AVcc and AVss Evaluation chip 27 ka User system interface cable Figure 7 36 User System Interface Circuit for AVcc and AVss 7 3 7 User System Interface Circuits of the H8 3437 H8 3337Y H8 3297 Group Evaluation Chip HS3437EVI60H All user system interface signals are directly connected to the evaluation chip in the emulator with no buffering except for those listed below which are connected to the evaluation chip through control circuits e RES e NMI e MDO e MDI e FVpp e EXTAL The circuits that interface the evaluation chip in the emulator to the user system include pull up resistors that cause signal delays Note that when an input terminal is in the high impedance state the pull up resistor forces the terminal to be at a
143. BGR YCbCr R red G green and B blue B blue G green and R red Y luminance Cb color difference for blue and Cr color difference for red Specifies bits pixel valid when RGB or BGR is selected Specifies the format of sampling valid when YCbCr is selected Specifies chunky planar valid when YCbCr is selected Specifies the area to store data size and the address of the palette Specifies the first address in memory of the area for display as image data in hexadecimal notation Specifies the first address in memory of the color palette data in hexadecimal notation valid when 8Bit has been selected for RGB or BGR Width Pixel Height Pixel Buffer Size Width Height Size Specifies the width and height of the image Specifies the width of the image unless a prefix is included values are treated as decimal numbers Specifies the height of the image unless a prefix is included values are treated as decimal numbers Displays the size of the buffer required for image display as obtained from the width and height in hexadecimal notation Specifies the location size and data start location of the part to be displayed among the entire image Specifies whether display is on all or part of the screen Full Size Part Size Top Bottom The image is displayed on the whole screen The image is displayed on part of the screen Display of data
144. Click the function you wish to select in the Select Function Name list box and click the gt button You will see the selected function in the Set Function Name list box To select all functions in the Select Function Name list box click the gt gt button Deselecting a Function Click the function you wish to deselect from the Set Function Name list box and click the lt button To deselect all functions click the lt lt button The deselected function will be moved from Set Function Name list box back to the Select Function Name list box 268 RENESAS Setting a Function Click the OK button to set the functions displayed in the Set Function Name list box The functions are set and the Select Function dialog box closes Clicking the Cancel button closes the dialog box without setting the functions 5 13 4 Debugging an Overlay Program This section explains the settings for using the overlay functions Displaying Section Group When the overlay mode is used that is when several section groups are assigned to the same address range the address ranges and section groups are displayed in the Overlay dialog box Open the Overlay dialog box by choosing Memory gt Configure Overlay Section Name Figure 5 48 Overlay Dialog Box at Opening This dialog box has two areas the Address list box and the Section Name list box 269 RENESAS The Address list box displays the addres
145. ENESAS 5 5 13 Comparing the Memory Contents The contents of two memory blocks can be compared Open the Compare Memory dialog box by selecting Memory gt Compare from the main menu or by selecting Compare from the popup menu of the Memory window Compare Memory Cancel Start Compare Format Byte G amp D 7 Figure 5 27 Compare Memory Dialog Box Enter the comparison format Format the start address Begin and end address End of the source memory area and the start address Start Compare of the destination memory area If the memory block is already highlighted in the Memory window the start and end addresses will be automatically filled in when the Compare Memory dialog box is opened If there is a mismatch the address where it was found is displayed in a message box 244 RENESAS 5 5 14 Loading a Memory Area from a File A file can be loaded to the debugging platform s memory Select Load from the popup menu of the Memory window to open the Load Program dialog box Load Program Binary v Fle name A Offset address H oo000000 Access size fi pa Cancel Format __ Cancel J Perform memory verify during download Figure 5 28 Load Program Dialog Box Enter the file format Format and the file name File name If the load address value is to be changed enter the offset value in the offset field Offset address
146. ESAS 343 6 5 Setting Registers Set a value of the program counter before executing the program e Select Registers from the CPU submenu of the View menu The Register window is displayed Register lol x Register Value ERO H 00000000 ERL H 00000000 ERZ H 00000000 ERS H 00000000 ER4 H 00000000 ERS H 00000000 ER6 H 00000000 ER H 00000010 PC H 000400 CCR H 80 I0 EXR H O 111 Figure 6 5 Register Window e To change the value of the program counter PC double click the value area in the Register window with the mouse The following dialog box is then displayed and the value can be changed Set the program counter to H 00000400 in this tutorial program and click the OK button Value Hoo Set As Cancel Whole Register v Figure 6 6 Register Dialog Box PC 344 RENESAS 6 6 Executing the Program Execute the program as described in the following e To execute the program select Go from the Debug menu or click the Go button on the toolbar ee Figure 6 7 Go Button While the program is executing the current address bus value and the operating state of the MCU are displayed on the status bar The program will be executed up to the breakpoint that has been inserted and an arrow will appear on the Editor column in the Source window to show the position that the program has halted with the message Break PC Break
147. Electronics products or if you have any other inquiries Note 1 Renesas Electronics as used in this document means Renesas Electronics Corporation and also includes its majority owned subsidiaries Note 2 Renesas Electronics product s means any product developed or manufactured by or for Renesas Electronics C 7 D mh on lt D D tENESAS H8 300 and 300L E6000 Emulator User s Manual H8 300 and 300L E6000 HS3008EPI60HE U2 Renesas Microcomputer Development Environment System H8 Family H8 300L Super Low Power Series Renesas Electronics Rev 1 00 2004 10 www renesas com Keep safety first in your circuit designs Renesas Technology Corp puts the maximum effort into making semiconductor products better and more reliable but there is always the possibility that trouble may occur with them Trouble with semiconductors may lead to personal injury fire or property damage Remember to give due consideration to safety when making your circuit designs with appropriate measures such as i placement of substitutive auxiliary circuits ii use of nonflammable material or iii prevention against any malfunction or mishap Notes regarding these materials These materials are intended as a reference to assist our customers in the selection of the Renesas Technology Corp product best suited to the customer s application they do not convey any license under any i
148. Enter key The HEW searches the label list for a label name containing the text that you entered 259 RENESAS Note Only the label is stored by 1024 characters of the start therefore the label name must not overlap mutually in 1024 characters or less Labels are case sensitive 5 10 9 Searching for the Next Label Choose Find Next from the popup menu to find the next occurrence of the label containing the text that you entered 5 10 10 Viewing the Source Corresponding to a Label Select a label and choose View Source from the popup menu to open the Source or Disassembly window containing the address corresponding to the label 260 RENESAS 5 11 Executing Your Program This section describes how you can execute your program s code You will learn how to do this by either running your program continuously or stepping single or multiple instructions at a time 5 11 1 Running from Reset To reset your user system and run your program from the reset vector address choose Debug gt Reset Go or click the Go Reset toolbar button The program will run until it hits a breakpoint or a break condition is met You can stop the program manually by choosing Debug gt Halt or by clicking the Stop toolbar button Note The program will start running from whatever address is stored in the Reset Vector location Therefore it is important to make sure that this location contains the address of your startup code 5 11 2
149. File Edit View Project Options Build Debug Memory Tools Window Help zixl L KRH E E JE JE IE E JE JE IE JE JE JE IE JE JE JE JE JE JE JE IE JE JE JE E JE JEJE E EEEE EE p Tutorial FILE Tutorial cpp Ey C source file E dbsct c E sbik c E C source file JE resetprg cpp 4 sort cpp 4 tutorial cpp EJ Download modules Tutorial abs 5 6 Dependencies sbrk h sort h stacksct h zj E Projects E Templates lt J Navigation 4 Connected D DESCRIPTION Main Program This file is generated by Hitachi Project LP FEIE IE JEJEJE JE JEDE JE JEE JE JEJE JE JEE JE JEJE JE JEJE EJE JEE JE JEE JE JEJE JE JEJEJEJE JEE JEJE IE ifdef __ cplusplus extern C endif void abort void ifdef _ cplusplus tendif include sort h of Hi aad tot Lib gt tutorial cpp Find in Files A Version Control Read write 1 69 Figure 2 16 HEW Window 192 RENESAS 2 7 Communication Problems The following message box will be displayed when the emulator power is turned off or the PC interface cable is not correctly connected xxxxx 6000 Emulator 5 x 4 verification error has occurred during the transfer of a firmware file This is probably because the emulator has been turned off or another emulator has been connected Figure 2 17 Error Message For information on other errors refer to the Setup Guide for the E6000 Emulator 2 8 Other Methods for Activat
150. File s Remove selected file s from version control system Get File s Get a read only local copy of the selected file s from version control system Check In File s Put back i e update the selected file s in version control system with the local copy Check Out File s Get a writable local copy of the selected file s from version control system Status of File s View the status of the selected file s 135 RENESAS gt To modify a system menu toolbar option 1 2 Select Version Control gt Configure The dialog shown in figure 8 1 will be displayed Select the option to be modified from the System menu options and toolbar buttons list and then click the Modify button The dialog shown in figure 8 3 will be displayed This figure shows a dialog when Add File s has been selected for example Commands are added via the Add button See the section Defining Version Control Commands later in this chapter for further information Close the Define Command for lt command gt dialog by clicking OK Close the Version Control Setup dialog by clicking OK Define Commands for Add File s 2 x Commands 0 Remove Move up Moye down 136 Figure 8 3 Modify System Menu Option Example RENESAS 8 1 2 User menu options You can create as many user defined menu options as you like name them how you want and defin
151. GND GND 12 3 4 Tuvcc Tsv een Input pins Trigger output pins Figure 2 7 External Probe Connector The interface circuit for the external probe is shown in figure 2 8 UVcc 10 kQ HD151015 Figure 2 8 External Probe Interface Circuit O External probes 1 to 4 229 The trigger output is controlled by event channel 8 and is low active The trigger output is available as either TSV probe color white within the range from 2 5 to 5 0 V and does not depend on the user V level or TU probe color yellow the user V level When the TU is used user system cannot be evaluated at the power voltage of 1 8 V the voltage must be within the range 2 0 to 5 0 V 187 RENESAS 2 5 5 Voltage Follower Circuit CAUTION 1 Do not connect the user system interface cable to the emulator without user system connection 2 Turn on the user system before starting up the emulator A voltage follower circuit is implemented on the emulator which allows the user system voltage level from the user system to be monitored This monitored voltage level is automatically supplied to the logic on the emulator and is derived from the emulator power supply unit This means that no power is taken from the user system board If no user system interface cable is connected to the emulator the emulator will operate at a specified voltage and all clock frequencies will be available to the user If the user system interface c
152. H 00001158 H 0000115C H 00001168 H OOOO11BE H OOOO011E0 H OOOO11E4 H OOOO1LEE H 00001226 H 00001232 H 0000123C el lo x Name _sbrk _main tutoriali _abort __INITSCT loopl loopz next_loopZ next_loopl loop3 loop4 next_loop4 next_loop3 operator newlunsigned long __ CALL INIT __CALL_END operator delete void _Yrand _srand DIVL 3 not_negX v Figure 5 37 Label Window You can view symbols sorted either alphabetically by ASCII code or by address value by clicking on the respective column heading Double clicking in the BP column can set or clear a software breakpoint at the start of the function 256 RENESAS 5 10 2 Adding a Label Choose Add from the popup menu and open the Add Label dialog box to add a label Add Label AES me O O a Address fHoooo0000 x Cancel Figure 5 38 Add Label Dialog Box Enter the new label name into the Name field and the corresponding value into the Address field and press OK The Add Label dialog box closes and the label list is updated to show the new label When an overloaded function or a class name is entered in the Address field the Select Function dialog box opens for you to select a function For details refer to section 5 13 3 Supporting Duplicate Labels 5 10 3 Editing a Label Choose Edit from the popup menu and open the Edit Label dialog box to edit a label Edit Label _ma
153. Interface Circuit for AVcc and A Vss 7 3 8 User System Interface Circuits of the H8 3217 H8 3318 Group Evaluation Chip HS3318EVI60H All user system interface signals are directly connected to the evaluation chip in the emulator with no buffering except for those listed below e RES NMI e MDO e MDI e EXTAL The circuits that interface the evaluation chip in the emulator to the user system include pull up resistors that cause signal delays Note that when an input terminal is in the high impedance state the pull up resistor forces the terminal to be at a high level Adjust the user system hardware to compensate for these effects The delay caused by the user system interface cable is about 3 ns The following diagrams show the user system interface signal circuits Default Evaluation chip Figure 7 44 Default User System Interface Circuit o User system 47 Q interface cable RES NMI and MD0 These signals are input to the evaluation chip via HD151015 Therefore the rising falling time must be within 8 ns or less User system 472 interface cable HD151015 Figure 7 45 User System Interface Circuit for RES NMI and MDO 401 RENESAS MD1 Includes a 12 V detection circuit for supporting microcomputers including flash memory 12 V detection User system circuit interface cable MD1 monitor register 27 kQ Figure 7 46 User System Interface Circuit for MD1 EXTAL Clock os
154. It is possible to disable scanning for certain navigation categories if you do not require the information gt To switch off a navigation category 1 Right click on the Navigation window The pop up menu displayed in figure 13 2 is shown Select the Select Categories menu item The dialog in figure 13 3 is displayed Uncheck any categories you are not interested in seeing definitions for Click OK OP oe bP Go to Declaration Go to Definition Configure View Select Categories vw Allow Docking Hide Figure 13 2 C Navigation pop up menu Select Categories x Please select the categories to scan for C Defines C Functions Cancel C Classes 4 Figure 13 3 C Navigation select categories dialog Note The navigation items are displayed gradually as the files are scanned This means it may take some time if there are many files to fully complete the Navigation view update Files are rescanned when they are saved This means that navigation information will not be available for new classes and functions until the file or files are saved 170 RENESAS 13 1 C Navigation component The C navigation component is the most complicated of the three supported navigation components It supports the following structures in the view for C source files The basic structure of the information is shown below in figure 13 4 TT 6h
155. K The Create SourceSafe Project dialog is invoked figure 9 2 7 The Project name field displays the name of the project i e folder to be created in the database If necessary you can change this name to another 8 The tree underneath the Project name field shows the structure of the database specified in step 6 Select the folder into which you would like to create the folder specified in the Project name field 9 Click OK 10 HEW will require you to repeat steps 7 9 for as many projects as are present in the current workspace SourceSafe Login 2 xi Username Password Cancel Database path Browse Figure 9 1 SourceSafe Login Dialog 151 RENESAS Create SourceSafe Project 2 xi Project name proiect Cancel project Baas C agip ariel bp commit def x Figure 9 2 Create SourceSafe Project dialog The HEW has now created the necessary projects within Visual SourceSafe and sets up the version control toolbar and menu for immediate access However although the Visual SourceSafe projects themselves have been created no files have been added to them 9 1 2 Adding files to Visual SourceSafe The previous section has only established the mappings between the project directory on your hard disk i e the working directory and the project directory in Visual SourceSafe i e the controlled directory Although the project directory and any
156. LE REM Deletes the specified file from the current project 64 SLEEP Delays command execution 65 SAVE_SESSION SE Saves the session of the current project 66 STEP ST Steps program by instructions or source lines 67 STEP_MODE SM Sets the step mode 68 STEP_OUT SP Steps out of the current function 69 STEP_OVER SO Steps program not stepping into functions 70 STEP_RATE SR Sets or displays rate of stepping 466 RENESAS Table H 1 HEW Commands cont No Command Name Abbreviation Function 71 SUBMIT SU Executes a command file 72 SYMBOL_ADD SA Defines a symbol 73 SYMBOL CLEAR SC Deletes a symbol 74 SYMBOL LOAD SL Loads a symbol information file 75 SYMBOL SAVE SS Saves a symbol information file 76 SYMBOL VIEW SV Displays symbols 77 TCL Enables or disables the TCL 78 TIMER TI Sets or displays the timer resolution 79 TOOL INFORMATION TO The information on the tool registered is outputted by the file 80 TRACE TR Displays trace information 81 TRACE ACQUISITION TA Sets or displays trace acquisition parameters 82 TRACE_BINARY_ TBC Compares a trace binary file with the current trace COMPARE information 83 TRACE_BINARY_SAVE TBV Outputs trace information into a binary file 84 TRACE FILTER TF Filter the trace information 85 TRACE_STATISTIC TST Analyzes statistic information 86 TRIGGER_CLEAR TGC Deletes the trigger output condition for EXT 2 87 TRIGGER_DISPLAY TGD Displays the
157. M will be LOST 1 Check all components against the component list after unpacking the emulator 2 Never place heavy objects on the casing Pa e Do not place the emulator in places where e The temperature becomes high such as in direct sunlight or near a heater For details refer to section 1 3 Environmental Conditions e The temperature or humidity changes greatly e There is a lot of dust e There is a lot of vibration For details refer to section 1 3 Environmental Conditions Protect the emulator from excessive impacts and stresses Only supply the specified voltage and power supply frequency When moving the emulator take care not to vibrate or damage it After connecting the cable check that it is connected correctly For details refer to section 2 Preparation before Use Supply power to the connected equipment after connecting all cables For the supplying procedures refer to section 2 6 System Check Cables must not be connected or disconnected while the power is on 180 RENESAS 1 3 Environmental Conditions CAUTION Observe the conditions listed in table 1 1 when using the emulator Failure to do so will cause illegal operation in the user system the emulator product and the user program Table 1 1 Environmental Conditions Item Specifications Temperature Operating 10 C to 35 C Storage 10 C to 50 C Humidity Operating 35 RH to 80 RH no condensation Storage
158. MAKE_ GM Creates a makefile to be built outside the HEW FILE 34 GO GO Executes user program 35 GO_RESET GR Executes user program from reset vector 36 GO_ TILL GT Executes user program until temporary breakpoint 37 HALT HA Halts the user program 38 HELP HE Displays the syntax of a command 39 INITIALIZE IN Initializes the debugging platform 40 LOG LO Controls command output logging 41 MAP_DISPLAY MA Displays memory mapping 42 MAP_SET MS Sets memory mapping 43 MEMORY_COMPARE MC Compares memory contents 44 MEMORY_DISPLAY MD Displays memory contents 45 MEMORY_EDIT ME Modifies memory contents 46 MEMORY FILL MF Modifies the content of a memory area by specifying data 47 MEMORY FIND MI Searches for data within the memory range 48 MEMORY_MOVE MV Moves a block of memory 49 MEMORY_TEST MT Tests a block of memory 50 MODE MO Sets or displays the CPU mode 51 MODULES MU Sets up or displays the on chip peripheral functions 52 MONITOR_CLEAR MOC Deletes a monitor point 53 MONITOR_DISPLAY MOD Displays the content of the monitor 54 MONITOR_REFRESH MOR Controls an automatic update of the content of the monitor 55 MONITOR_SET MOS Sets or displays a monitor point 56 OPEN_WORKSPACE OW Opens a workspace 57 QUIT QU Exits HEW 58 RADIX RA Sets default input radix 59 REFRESH RF Updates windows related to memory 60 REGISTER_DISPLAY RD Displays CPU register values 61 REGISTER_SET RS Sets CPU register contents 62 RESET RE Resets CPU 63 REMOVE FI
159. PLAY 12 BREAKPOINT_ENABLE BE Enables or disables a breakpoint 13 BREAKPOINT_ BS Sets sequential breakpoints SEQUENCE 14 BUILD BU Starts a build operation on the current project 15 BUILD_ALL BL Starts a build all operation on the current project 16 CHANGE_ CC Sets the current configuration CONFIGURATION 17 CHANGE_PROJECT CP Sets the current project 18 CHANGE_SESSION CS Changes the session of the current project 19 CLOCK CK Set the CPU clock rate in the emulator 20 CONFIGURE_ CPF Sets the debugging environment for the emulator PLATFORM 21 DEFAULT_OBJECT_ DO Sets the default object program format FORMAT 22 DEVICE TYPE DE Selects a device type to emulate 23 DISASSEMBLE DA Disassembles memory contents 24 ERASE ER Clears the Command Line window 25 EVALUATE EV Evaluates an expression 26 EXMONITOR_DISPLAY EXMD Displays the content of the expansion monitor 27 EXMONITOR_SET EXMS Selects whether or not to display the items in the expansion monitor 28 EXMONITOR_ EXMSR Sets the time to update the expansion monitor during SETRATE emulation or a break 29 FILE_LOAD FL Loads an object program file 30 FILE_SAVE FS Saves memory to a file 31 FILE_ UNLOAD FU Unloads a file 32 FILE_VERIFY FV Verifies file contents against memory 465 RENESAS Table H 1 HEW Commands cont No Command Name Abbreviation Function 33 GENERATE_
160. Platform Remark H8 300 E6000 Emulator CPU 300 For emulation of the following MCUs that have the H8 300 CPU as the core HS3308EVI60H H8 330 HS3508EVI60H H8 350 HS3398EVI60H H8 338 H8 337 H8 336 H8 329 H8 328 H8 327 and H8 326 HS3334EVI60H H8 3334 and H8 3332 HS3257EVI60H H8 3257 H8 3256 H8 325 H8 324 H8 323 and H8 322 HS3437EVI60H H8 3534 H8 3522 H8 3437 H8 3437F H8 3436 H8 3434 H8 3434F H8 3397 H8 3396 H8 3394 H8 3337Y H8 3337YF H8 3336Y H8 3334Y H8 3334YF H8 3297 H8 3296 H8 3294 and H8 3292 HS3318EVI60H H8 3502 H8 3318 H8 3315 H8 3217 H8 3216 H8 3214 H8 3212 and H8 3202 H8 300L E6000 Emulator CPU 300L For emulation of the following MCUs that have the H8 300L CPU as the core HS3834EVI60H H8 3837 H8 3836 H8 3835 H8 3834 H8 3833 H8 3832 H8 3814 H8 3813 and H8 3812 HS3834EVI60H with HS3857EIO60H H8 3857 H8 3857F H8 3856 and H8 3855 HS3834EVI60H with HS3854ElO60H H8 3854 H8 3854F H8 3853 and H8 3852 HS3876EVI60H H8 3877 H8 3876 H8 3875 H8 3637 H8 3636 H8 3635 H8 3627 H8 3626 H8 3625 H8 3624 H8 3623 and H8 3622 HS3927EVI60H H8 3927 H8 3926 H8 3925 and H8 3924 HS3644EPI60H H8 3657 H8 3656 H8 3655 H8 3654 H8 3653 H8 3652 H8 3644 H8 3644F H8 3643 H8 3643F H8 3642 H8 3642F H8 3641 and H8 3640 411 RENESAS 8 1 3 Configuration Properties Dialog Box General Page Items that can be set in this dialog box are listed below
161. Processing Add temoye Up Down I Connect up to target on debug go V Download modules after build I Reset CPU after download module Cancel Figure 4 14 Debug Settings Dialog Box Options Page The command chain that is automatically executed at the specified timing is registered The following three timings are available e At connecting the emulator e Immediately before downloading e Immediately after downloading Specify the timing for executing the command chain in the Command batch file load timing combo box In addition register the command chain file that is executed at the specified timing in the Command Line Batch Processing list box 211 RENESAS 4 4 Debug Sessions The HEW stores all of your builder options into a configuration In a similar way the HEW stores your debugger options in a session The debugging platforms the programs to be downloaded and each target platform s options can be stored in a session Sessions are not directly related to a configuration This means that multiple sessions can share the same download module and avoid unnecessary program rebuilds Each session s data should be stored in a separate file in the HEW project Debug sessions are described in detail below 4 4 1 Selecting a Session The current session can be selected in the following two ways e From the toolbar Select a session from the combo box figure 4 15 in the toolbar ex
162. Properties 2 xi Name Sessiomoox_E6000_Emulator_CP Location C Hew2 sample sample Sessiomoox _E6000 Last modified 17 37 11 Thursday December 12 2002 Canca I Read only Figure 4 18 Session Properties Dialog Box 214 RENESAS e To make a session read only 1 Select Options gt Debug Sessions to display the Debug Sessions dialog box figure 4 16 2 Select the session you would like to make read only 3 Click the Properties button to display the Session Properties dialog box figure 4 18 4 Check the Read only check box to make the link read only This is useful if you are sharing debugger setting files and you do not want data to be modified accidentally 5 Click the OK button e To save a session with a different name 1 Select Options gt Debug Sessions to display the Debug Sessions dialog box figure 4 16 Select the session you would like to save Click the Save as button to display the Save Session dialog box figure 4 19 Specify the location to save the new file Ct ee be If you want to export the session file to another location leave the Maintain link check box unchecked If you would like the HEW to use this location instead of the current session location check the Maintain link check box Click the OK button a 2x Saven sme denam a Sessionsoox _E6000_Emulator_CP hsf Debug_yyyy_E6000_Emulator_cP Debug
163. RAM and user memory other than those in item 2 mentioned above It is possible to recognize the method for updating the value during user program execution according to the color of the R mark Blue outline R The variable s address is within the range that has been set for the monitoring function and the data is readable by using the monitoring function Blue R An updated value of the data at this location has been read by the monitoring function Black outline R The variable s address is outside the range that has been set for the monitoring function and the data is not readable by using the monitoring function Black R A value has been updated by reading the normal data Notes 1 This function can be set per variable or per element or body for structures of data 2 The color of an R in the Name column changes according to the trace and monitoring settings 3 A variable that is allocated to a register cannot be selected for monitoring 273 RENESAS Adding a Watch Item Use the Add Watch dialog box in the Watch window to add Watch items to the Watch window gt To use Add Watch from a Watch window Open the Watch window Choose Add Watch from the popup menu The Add Watch dialog box opens Add Wate Variable or expression OK Cancel Figure 5 54 Add Watch Dialog Box Enter the name of the variable that you wish to watch and click OK The variable is added to the Watch w
164. REOF WARRANTIES AS TO MARKETABILITY MERCHANTABILITY FITNESS FOR ANY PARTICULAR PURPOSE OR USE OR AGAINST INFRINGEMENT OF ANY PATENT IN NO EVENT SHALL RENESAS BE LIABLE FOR ANY DIRECT INCIDENTAL OR CONSEQUENTIAL DAMAGES OF ANY NATURE OR LOSSES OR EXPENSES RESULTING FROM ANY DEFECTIVE EMULATOR PRODUCT THE USE OF ANY EMULATOR PRODUCT OR ITS DOCUMENTATION EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGES EXCEPT AS EXPRESSLY STATED OTHERWISE IN THIS WARRANTY THIS EMULATOR PRODUCT IS SOLD AS IS AND YOU MUST ASSUME ALL RISK FOR THE USE AND RESULTS OBTAINED FROM THE EMULATOR PRODUCT tENESAS State Law Some states do not allow the exclusion or limitation of implied warranties or liability for incidental or consequential damages so the above limitation or exclusion may not apply to you This warranty gives you specific legal rights and you may have other rights which may vary from state to state The Warranty is Void in the Following Cases Renesas shall have no liability or legal responsibility for any problems caused by misuse abuse misapplication neglect improper handling installation repair or modifications of the emulator product without Renesas prior written consent or any problems caused by the user system All Rights Reserved This user s manual and emulator product are copyrighted and all rights are reserved by Renesas No part of this user s manual all or part may be reproduced or duplicated in any f
165. Select its tab at the bottom of the editor window When a file has been edited an asterisk is appended to the window s title bar The asterisk remains there until the file is saved The asterisk is also removed if all of the edited changes are undone in the current window SL HHH E E JE ELK JE KKK JE KKK KKK JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE E JE ME E E E E FILE idbsct c DATE Thu Jun 26 2003 DESCRIPTION Setting of B R Section 7 CPU TYPE This file is generated by Renesas Project Generator Ver 3 0 Z EHHH EE E E JE E E JE E JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE E JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE E JE E E E EEE pragma section DSEC static const struct char rom_s Start address of the initialized data se char rom_e End address of the initialized data sect char ram_s Start address of the initialized data se DTBL z gt WE dbsct c cle resetprg c Figure 4 1 Editor Window 69 RENESAS 4 2 Working with Multiple Files The file area is where you will work with the files of your project The editor allows you to have many files open at one time to switch between them to arrange them in different configurations and to edit them in whichever order you want to The operations that you can perform upon the windows are typical of
166. T kis 0x00001046 p_sam new Sample 0x0000104e for i 0 i lt 10 i 0x00001050 j rand 0x00001058 if j lt O f 0x0000105a Jaj Tutorial S Tutorial B E C source file dbsetc sbtk c 5 6 C source file resetprg cpp sort cpp 3 0x0000105c ali 3 0x00001070 e P_sam gt sort a 0x0000107a P_sam gt change a 0x00001082 gt p_san gt s0 a 0 0x0000108a p_san gt sl a 1 0x00001096 p_san gt s2 a 2 0x000010a2 p_san gt s3 a 3 0x000010ae p_san gt s4 a 4 0x000010ba p_san gt s5 a 5 0x000010c6 p_san gt s6 a 6 0x000010d2 p_san gt s7 a 7 0x000010de p_san gt s8 a 8 0x000010ea p_san gt s9 a 9 0x000010f6 delete p_sam 0x000010fc p Download modules D Tutorial abs BR a OxOOffef80 llong 10 H 0000794b 0x0Offef80 llong R I H 000059e2 0x00ffef84 long R 2 H 0000446b 0x0Offef88 llong E H 000041c6 0x0Offef8c llong 4 H 00003f54 Ox00ffef90 long R 6 H 00002781 0x00ffef34 long R 6 H 00001 cfb Ox00ffef98 long ftg H 0000167e 0x00ffef3c llong R 8 H 000015fb 0x00ffefa0 llong R 9 H OOOOOHE Ox0Offefa4 llong i H 000a R4 int SJE Watch A Watch A Watchs A Watcha 7 Break Stepping Completed Read write 48 69 Figure 6 25 HEW Window Step Over 357 RENESAS 6 13 Forced Breaking of Program Executions The HEW can force a break in
167. The Output Window The Output window by default has four tabs on display The Build tab shows the output from any build process e g compiler assembler and so on If an error is encountered in a source file then the error will be displayed in the build tab along with the source file name and line number To quickly locate a problem double click on the error to jump to the source file and line Lex Build A Debug A Find in Files A Version Control 7 Figure 1 19 Output Window The Debug tab shows the output from any debugger process Any debug component that needs to display information will send its output to this window RENESAS The Find in Files tab displays the results of the last Find in Files action To activate find in files select the Edit gt Find in Files menu option the toolbar button For further details on how to use find in files refer to chapter 4 Using the Editor The Version Control tab displays the results of version control actions The tab is only displayed if a version control system is in use For further details on version control refer to chapter 7 Version Control 1 2 7 The Status Bar The status bar displays information as to the current state of the HEW Figure 1 20 shows the eight sections of the status bar Displays HEW status messages Virtual desktop Read only status Line number Insertion mode Num Lock Column number Caps Loc
168. To our customers Old Company Name in Catalogs and Other Documents On April 1 2010 NEC Electronics Corporation merged with Renesas Technology Corporation and Renesas Electronics Corporation took over all the business of both companies Therefore although the old company name remains in this document it is a valid Renesas Electronics document We appreciate your understanding Renesas Electronics website http www renesas com April 1 2010 Renesas Electronics Corporation Issued by Renesas Electronics Corporation http www renesas com Send any inquiries to http Awww renesas com inquiry 2CENESAS 10 11 12 Notice All information included in this document is current as of the date this document is issued Such information however is subject to change without any prior notice Before purchasing or using any Renesas Electronics products listed herein please confirm the latest product information with a Renesas Electronics sales office Also please pay regular and careful attention to additional and different information to be disclosed by Renesas Electronics such as that disclosed through our website Renesas Electronics does not assume any liability for infringement of patents copyrights or other intellectual property rights of third parties by or arising from the use of Renesas Electronics products or technical information described in this document No license express implied or otherwise is gra
169. WR Detects write cycles when this box is checked not available when Don t care has been checked 318 RENESAS 5 Area page Select the area being accessed The selection is not available when a time stamp is acquired Trace Filter Status Probes IRQ 0 General Address Data RAV Area im ROM RAM 170 16 170 8 EXT 16 EXT 8 RAM DTC Figure 5 89 Trace Filter Dialog Box Area Page Don t care Detects no area condition when this box is checked Setting Detects the specified area condition not available when Don t care has been checked Note Available area conditions vary according to the emulator in use For details refer to section 5 15 4 Signals to Indicate Bus States and Areas 319 RENESAS 6 Status page Select the status of a bus The selection is not available when a time stamp is acquired Trace Filter General Address Data Rew Area Status Probes Razo O PROG DATA REFRESH DMAC DTC OTHER Cancel Apply Figure 5 90 Trace Filter Dialog Box Status Page Don t care Detects no bus condition when this box is checked Setting Detects the specified bus condition not available when Don t care has been checked Note Available bus conditions vary according to the emulator in use For details
170. _ xox _E6000_Emulator_cP Release a DefaultSession hsf a Sessionyyyy _E6000_Emulator_CP hsf Save as type Sessions hsf 7 Cancel I Maintain link A Figure 4 19 Save Session Dialog Box 4 4 3 Saving Session Information e To save a session Select File gt Save Session 215 RENESAS 4 5 Connecting the Emulator Select either of the following two ways to connect the emulator a Connecting the emulator after the setting at emulator activation Select Debug Settings from the Options menu to open the Debug Settings dialog box It is possible to register the download module or the command chain that is automatically executed at activation For details on the Debug Settings dialog box refer to section 4 3 Setting at Emulator Activation When the dialog box is closed after setting the Debug Settings dialog box the emulator will automatically be connected b Connecting the emulator without the setting at emulator activation Connect the emulator by simply switching the session file to one in which the setting for the emulator use has been registered DE Yor popa onere BA In Uno Hep Posaa S6 seelOTallemlpl eieatewezienila akeallth F Ys cs ttt 2 rome zi fession m Em rl GP ae s a alaaa r d HHM OTT Ss Sessionzzz oe Emulator CHA EE DefaultSession Ey Dependencies sbrkh E stackscth T Projects Tempe naan Lee Build Debug A F
171. a Invalid breakpoint Break by a break instruction without PC Break Event Time Count Displays the measured result of the timer between events Run Time Count Displays the total execution time of the program 3 Events Sheet Selecting the Events tab on the Status window displays this sheet Table 8 6 Events Sheet Item Item Column Status Column Resources Displays the resource information and the information on events such as the breakpoint 419 RENESAS 8 1 6 Extended Monitor Function Selecting View gt CPU gt Extended Monitor or clicking the Extended Monitor toolbar button displays the Extended Monitor window This emulator displays the following items Table 8 7 Extended Monitor Window Items Item Column Value Column User NMI User Reset Displays the status of the NMI pin Displays the status of the reset pin User System Voltage Displays whether or not the user VCC is equal to or exceeds the value set in User VCC Threshold on the General page of the Configuration Properties dialog box User Cable Displays whether or not the user cable is connected Running status Displays the address bus value in the MCU and the status of the CPU while the user program is running and the cause of a break while the user program is halted Break lt Cause of break gt Displays the cause of a break Address lt Address bus value gt Displays the address bus v
172. a project into a workspace 1 Select the project from the Projects tab of the Workspace window and click the right mouse button to invoke a pop up menu 2 Select the Load Project option gt To unload a project from a workspace 1 Select a non active project from the Projects tab of the Workspace window and click the right mouse button to invoke a pop up menu 2 Select the Unload Project option Note You can load or unload plural projects at a time 36 RENESAS 2 14 Relative projects paths in the workspace In the High performance Embedded Workshop when you add a project to the workspace you can choose to add the project to the workspace using a relative path This allows you to position a project above the workspace directory and it will still be relocated correctly if you relocate the HEW workspace The project is always relative to the workspace so if the project is one directory above the workspace before it is moved the HEW will try to find the project in the same relative location after the relocation procedure This is especially useful if you are using a project shared between more than one workspace In older versions of the HEW this project would not have been relocated and would have still tried to access the original project path The older version of the HEW could only relocate the projects which were in a subdirectory of the workspace directory This is still the standard behavior for the Hig
173. able is attached the emulator will match the voltage supplied to the user target in all cases i e even when the user V is below the operating voltage for the MCU You must be careful not to select an invalid clock frequency When the emulator is connected to the user system and the user system is turned off the voltage follower circuit output voltage level is 0 V In this case the emulator will not operate correctly You can set a user V lt threshold in the range Vcc max 0 V by using the emulator configuration dialog box If the user V drops below this threshold User System Voltage in the Extended Monitor window will display Down otherwise OK is displayed ns eis Be eee ve ee n User Vcc level threshold OV User Vcc K en ie ce Biv fer ane threshold D own 3 3 V E6000 Vcc level OV The user system interface cable is not connected Figure 2 9 Voltage Level Monitoring Example for Vcc 3 3 V 188 RENESAS 2 6 System Check When the software is executed use the procedure below to check that the emulator is connected correctly Here use the workspace for a tutorial provided on the product Refer to section 2 8 Other Methods for Activating the Emulator for the other activating method to create a new project or use a workspace for the HEW of the old version 1 Connect the emulator to the host computer 2 Conne
174. abort H 0000110C __INITSCT H o00001122 loopl H o0000112C loop H oOO0112E next_loopZ H 00001132 next_loopl H oo0001144 loop3 H o00001152 loop4 H o00001158 next_loop4 H oooo0115C next_loop3 H 00001168 operator new unsigned long H OOOO11BE __CALL INIT H OOOO11E0 __CALL_ END H oooo1lE4 operator delete void H OOOO1LEE _rand H 0000l226 _srand H 00001232 DIVL 3 H 00000123C not_negX H 00001244 not_negY H ooo0124E not_negZ Figure 6 11 Label Window 348 RENESAS 6 9 Viewing Memory When the label name is specified the user can view the memory contents that the label has been registered in the Memory window For example to view the memory contents corresponding to _main in byte size Select Memory from the CPU submenu of the View menu to enter_main in the Start address edit box and ff in the End address edit box respectively and to select Byte in the Format combo box _main Cancel End f Format Byte x1 Display Value As fansi character e Bytes Count For One Line 16 Byte Figure 6 12 Format Dialog Box Click the OK button The Memory window showing the selected area of memory is displayed usTpT Ph E N d pTpm m Figure 6 13 Memory Window RENESAS 349 6 10 Watching Variables As the user steps through a program it is possible to watch that the values of variables used in the user program are changed F
175. ace log Tl Generate log for projects Figure 6 16 Tools customize log tab 6 9 Using the virtual desktop HEW has implemented the concept of the virtual desktop This allows window configurations to be defined that can be switched with the click of a button When a particular button is clicked the windows are hidden or displayed depending on the current settings of that window configuration It is possible to have a maximum of 4 desktop configurations in use When the session is saved the window positions for each configuration are saved to the session file You can then switch simply between each configuration to gain access to the other windows The toolbars and windows are dependent on the virtual desktop configuration Source files are independent of the virtual desktop system and will remain in view 127 RENESAS gt To rename your configuration to a more meaningful name Click the Window gt Virtual Desktop menu item Select is cascaded menu Select the Desktop Manager dialog Select the window configuration you wish to change the name for Click the rename button Enter the new meaningful name in the edit field and click OK Co BNE Click OK to keep the changes and revert to the HEW main window gt To switch desktop configurations There are a number of ways to switch desktop configuration The first and easiest method is using the virtual desktop buttons located on the status bar These are shown in figure 6 17
176. aeenaeeneeens 441 Appendix Placeholder sunnecioniidina an ni aia AS 443 C1 Whatisa Placeholder ioscineiioreoeliisorssisiroiis ieii isre nErinn E eskena 443 C 2 Inserting a Placeholder iirsesisrirseinricesernieissrepoettstrorid irts tsss ieurs ts ier EEE EVAREN EEEIEE 443 C3 Ayailable PlaceholderS serorei eein eT E O AS 445 CA Placeholder ips isiscssjsscstesicssiai crete E E EEV 447 Appendix D VO Pile Format sssrinin innn 449 D 1 File format Bit Field Not Supported eee cece ceececeeeetseeeseeteeescseseeeesseeeneees 449 xii D 2 File format Bit Field Supported cece eee eeescee cesses sseeesessesesseneeesaseeeseeees 451 Appendix E Symbol File Format sesresesesesesesesesevrsreresesesrsrsrnesesrsrereresesesess 453 Appendix F HMAKE User Guide ccccccccccscesseseesesesscssssesesesesessensssenes 455 Bal Command Tne iaeoe eye aE Sa EEEE hoas A TR 455 PI BaSiG StrinCtre seess erin i Ere EE N E EE AES 455 l S PAE ESS 016 E AA E E AE 455 E13 Parameters ceccscisvergserssnccsenyoeedccessascearsecetenssseessarosesdeosyaestentsacdyensdeonsaavsacteasabecvcess 455 E2 Pile Sy tari neoe ETA A E NEOS 456 BQ Variable declarations cissie irean e E NENEA 456 E3 Description Dlocksssvesei csieesddsaxescansduesasssnesseassvonssesvass NAAT RVE EEEE 457 F34 BasicOutline iia siscesssseescdssvesassscovonesssusealsesivoucsvauessliescesaeteeseseateasesenzensecedzovesesves 457 F32 Specials COmMand s i iieii cevsvesnsswo
177. al is input for about 16 to 17 system clock cycles to the evaluation chip from the emulator For the execution time measurement result the time for reset signal input is added 425 RENESAS 8 2 5 Notes on Use of the H8 3334 Group Evaluation Chip Set HS3334EVI60H e I O Register Differences Between Actual MCU and Emulator In the E6000H emulator one evaluation chip emulates several types of MCU Therefore there are some differences in I O registers between an actual MCU and the emulator as shown in table 8 16 Note these differences when accessing the I O registers T O port is in the input state at default The I O register contents indicate the emulator port status When the user system interface cable is not connected the read value is 1 due to pull up resistors Table 8 16 Differences in I O Registers MCU Group V O Address H8 3332 H8 3334 Note FFAA FFAB X X Accessing these registers will change the contents of addresses FFA8 to FFAQ do not access these registers FFDF X xX FFE1 X X Accessing these registers will change the contents of the A D FFE3 x x converter control register do not access these registers FFE5 X X FFE7 X X FFE9 X X FFEB X X Note X indicates that a register that does not exist in the actual MCU can be accessed in the emulator e Access to the Reserved Area When accessing the reserved area note the following 1 Part of the reserved area specified in each MCU s memory
178. alue during the user program execution While in subactive mode SubActive is displayed after the address bus value Status lt Status of the CPU gt Displays the status of the CPU H8 300 series CPU CPU instruction cycles CPU_PREFETCH CPU instruction prefetch cycles CPU_WORD CPU word access cycles DTU DTU cycles H8 300L series CPU CPU instruction cycles CPU_PREFETCH CPU instruction prefetch cycles SUB_ACTIVE_DATA Subactive data access cycles SUB_ACTIVE_PREFETCH Subactive instruction prefetch cycles CPU_MEDIUM_DATA CPU data access cycles medium speed mode CPU_MEDIUM_PREFETCH CPU instruction prefetch cycles medium speed mode Target Mode Displays the mode input from the user system Note In this emulator the update interval in the Extended Monitor window cannot be selected or changed 420 RENESAS 8 1 7 Signals to Indicate Bus States and Areas The following tables show examples of signals to indicate the bus states and areas that can be acquired by the emulator Table 8 8 Bus State Signals Acquired by the Emulator H8 300 Series Bus State Trace Display Status Description CPU CPU CPU instruction cycles CPU Prefetch CPU_PREFETCH CPU prefetch cycles CPU Data CPU_WORD CPU word access cycles DTU DTU DTU cycles Table 8 9 Bus State Signals Acquired by the Emulator H8 300L Series Bus State Trace Display Status Description CPU CPU CPU instruction cycles high speed mode
179. ame and then click OK For further information on templates refer to the Templates section later in this chapter fo Toggle Bookmark The High performance Embedded Workshop editor provides standard bookmark capabilities To set a bookmark select the line to mark and click this button a green mark will then appear in the blank on the left side of the editor window To remove a bookmark select the line to remove a bookmark and click this button the mark in the blank on the left side of the editor window will disappear For further information on bookmarks refer to the Bookmarks section later in this chapter 71 RENESAS 4 2 3 Search Toolbar Buttons Sy Find in Files To search several files for a text string then click this button All find results are displayed in the Find in Files tab of the Output window For further information refer to the Searching and Navigating Through Files section later in this chapter ay Find Click this button if you want to find a certain text string in the current file It invokes a find dialog box where you can specify the search parameters amp FindNext Finds the next occurrence of the current search string B Find Previous Finds the previous occurrence of the current search string 4 2 4 Bookmarks Toolbar Buttons mm Toggle Bookmarks Sets a bookmark at the current line or clears a bookmark at the current line fo Next Bookmark Jumps to the next bookmark in
180. ample of its use is in a large C file where you may want to set a bookmark on each function definition Once a bookmark has been set it exists until it is removed or the file is closed To set a bookmark 1 Place the insertion cursor on the line to mark 2 Select Edit gt Bookmarks gt Toggle Bookmark press CTRL EF2 select Bookmarks gt Toggle Bookmark from the local menu or click the toggle bookmark toolbar button QA 3 A green mark appears in the blank on the left side of the line to indicate the presence of an active bookmark gt To remove a bookmark 1 Place the insertion cursor on the marked line 2 Select Edit gt Bookmarks gt Toggle Bookmark press CTRL F2 select Bookmarks gt Toggle Bookmark from the local menu or click the toggle bookmark toolbar button QA 3 The mark will be removed and the line will return to normal text gt To jump to the next bookmark in a file 1 Ensure that the insertion cursor is somewhere within the file to be searched 2 Select Edit gt Bookmarks gt Next Bookmark press F2 or select Bookmarks gt Next Bookmark from the local menu or click the next bookmark toolbar button co gt To jump to the previous bookmark in a file 1 Ensure that the insertion cursor is somewhere within the file to be searched 2 Select Edit gt Bookmarks gt Previous Bookmark press SHIFT F2 or select Bookmarks gt Previous Bookmark from the local menu or click the previous bookmark toolbar
181. an Overlay Program eee cece cece eeeeseeeseeeeeeesaeteeeetaeeeeeeaes 269 Viewing the Variables vs cc icnissecsiesscesscesdacacesavzveundecdesavaisgeousdsosceddevesospesacesontessasaseansisentensd 271 DAT Tooltip WALCH wives ices sactucsszsuned nerian sn aE an E NE r EES EEEE 271 5 14 2 Instant Watch 271 5 14 3 Watch Window peed 5 14 4 Locals Window Using the Event Points 5 15 1 PC Breakpoints 5 15 2 Event Points 279 5 15 3 Event Detection System 0 279 5 15 4 Signals to Indicate Bus States and Areas cs 5 15 5 Opening the Event Window 281 5 15 6 Setting PC Breakpoints 5 15 7 Setting Event Points 5 15 8 Setting Trigger Points 5 15 9 Editing Event Points 5 15 10 Modifying Event Points ie 5 15 11 Epabling an Event Point csscccescscsscsasecstovssecssoaesaconeessasesesosacconsasaieossesacapeatecses 292 5 20 Section 6 Tutorial 6 1 Introduction 6 2 Running the HEW 5 15 12 Disabling an Event Point 5415 13 Deleting an Event Pott casi ccvssscecsssyssxcesoyicxcsvoss r ONES 5 15 14 Deleting All Event Points 5 15 15 Viewing the Source Line for an Event Point cece eeeeeeeteeeeeeeees 292 Viewing the Trace Information 293 5 16 1 Opening the Trace Window 54 293 5 16 2 Acquiring Trace Information 293 5 16 3 Specifying Trace Acquisition Conditions 00 0 cece eee ceeeceeteeeeeeees 295 5 16 4 Searching for a Trace Record
182. ange can be set in the From and To options respectively 316 RENESAS 3 Data page Set a data condition Status Probes IRQ 0 General Address Data Raw Area Point Range From F To Cancel Apply Figure 5 87 Trace Filter Dialog Box Data Page Don t care Detects no data when this box is checked Setting Detects the specified data Point Specifies single data not available when Don t care has been checked Range Specifies a data range not available when Don t care has been checked From Enter single data or the minimum value of the data range not available when Don t care has been checked To Enter the maximum value of the data range only available when Range has been selected Note Along with setting the data range the minimum and maximum values can be set in the From and To options respectively 317 RENESAS 4 R W page Select the type of access cycles Trace Filter Status Probes IRQ 0 General Address Data RAV Area Setting RD WR Cancel Apply Figure 5 88 Trace Filter Dialog Box R W Page Don t care Detects no read write condition when this box is checked Setting Detects the specified read write condition RD Detects read cycles when this box is checked not available when Don t care has been checked
183. anges gt To remove an existing user to the system 1 Log in with a user who has administrator access rights The process for doing this is described above Select Tools gt Options The HEW tools options dialog is displayed Select the network tab This is displayed in Figure 10 2 Click the access rights button The dialog displayed in Figure 10 4 is displayed 2 3 4 5 Select the user you wish to remove in the users list 6 Press the remove button 7 Then click OK to save the access rights changes 160 RENESAS User access rights sg 2 x User access rights Users Access level Admin Access Administrator Fullread write access Read write file access only Read only access Figure 10 4 User access rights dialog 10 1 4 Changing your password To change your password 1 Log into the HEW network database you are changing your password for Select Tools gt Options The HEW tools options dialog is displayed Select the network tab This is displayed in Figure 10 2 Click the password button Enter your new password and confirm it in the second edit box Click OK Then click OK to save the password change NOW PN 10 1 5 Using the network HEW service When you connect to a networked project for the first time the HEW automatically connects you to the correct network HEW service This is defined using machine name If the service cannot be found
184. are This opens a new compare window so that some new files can be comapred and the differences displayed e Export results to file This opens a dialog which allows you to choose a file to export the current difference results to a textual format e Ignore white space The ignore white space option which is on the advanced options dialog can be toggled via this menu item e Find Displays a standard find dialog This uses the same find dialog as the HEW editor e Find next Finds the next string that meets the find requirements e Find previous Finds the next previous string that meets the find requirements e Previous Difference Automatically jumps the view to the next previous difference e Next Difference Automatically jumps the view to the next difference e Refresh comparison Refreshs the view to manually run the difference comparison again This can be used if either file has been modified since the last comparison The difference window also allows the colours in the view to be customised This procedure is outlined below gt To change the colors viewed in the difference window 1 Select Tools gt Format Views The format views dialog is displayed 2 Expand the difference view The dialog is shown and looks the same as figure 11 6 3 Select the category you want to change The color display tab is displayed and allows modification The categories available are Left hand side moved lines Left hand side different lines Ri
185. area with the Configuration settings 2 Ifthe reserved area other than that described in item above is used the operation in the actual MCU cannot be guaranteed If the user program extends to the reserved area during debugging select the MCU having the largest memory capacity for example debug the H8 3214 program in the H8 3217 mode Use of Internal RAM Area as External Memory The internal RAM area cannot be used as an external address area even when the RAME bit of the SYSCR is cleared to 0 430 RENESAS e User Program Execution by the Go Reset Command When the user program is executed by the Go Reset command a reset signal is input for about 16 to 17 system clock 0 cycles to the evaluation chip from the emulator For the execution time measurement result the time for reset signal input is added 8 2 9 Notes on Use of the H8 3834 H8 3814 Group Evaluation Chip Set HS3834EVI60H e T O Register Differences Between Actual MCU and Emulator In the E6000 emulator one evaluation chip emulates several types of MCU Therefore there are some differences in I O registers between an actual MCU and the emulator as shown in table 8 20 Note these differences when accessing the I O registers T O port is input at default The I O register contents indicate the emulator port status When the user system interface cable is not connected the read value is due to pull up resistors Table 8 20 Differences in I O Registers
186. ariables isis csceest siceossassicettecssseatenssaeseesonteoeecensetendovsseontecsweccdunineengeteaborebensdtse 350 6 11 Displaying Local Variables srice ssasisrsnessrstsciierrssrssssiasosessnuversossivss iseasi ti rossii 353 6 12 Stepping Through a Program eee cece eesecseeeeseeseeesceeesecseeeesesseeessesassesseeeeetaseeeees 354 6 12 1 Executing the Step In Commando cee ceecaeeececseseeseeeenetseeeeneas 354 6 12 2 Executing the Step Out Command eee eee cece cseceeeetseeeeeesaeeeeneees 356 6 12 3 Executing the Step Over Command eee eee ceeecseceeeeseeeeeeeesseeeaeees 357 6 13 Forced Breaking of Program Executions 0 0cc cece eeceecseeeeeesseeeeseseeseteetseetaeeeeeeeaes 358 614 R settine thes MCUs sescsscsvnct sisestessieedteces sir iE EErEE rE IEE ENE E EN EOSO 358 GAS Break Function 2 2005 sneen lt csesestesensanvcsousanesdaviescdernnengsaesacndsavsoarssasnescdsvsnnresensastesebsenesensbonedion 359 O15 PO Break FUNGUO isons sires teeni asen E NEVE aime ait cnss 359 6 15 2 Breaking Execution at Event Points s ssssssssssssesesssssssssrsssisisrsrsrsrsrnrrsesrsrsessss 362 6 16 Trace FUNCHONS ssenarisi rea ai a EE A E E E 365 6 16 1 Displaying a Trace when Time Stamping is not Available 366 6 16 2 Displaying a Trace when Time Stamping is Available eee 372 616 3 Statisties scccrsscccersiscocersenceserponsscsnssnencenardebearosescservaeddierduensceesrsnsseeseonddennesedieonesdsie gt 375 0164 PONCHO Calls iisc
187. as Technology Taiwan Co Ltd 10th Floor No 99 Fushing North Road Taipei Taiwan Tel lt 886 gt 2 2715 2888 Fax lt 886 gt 2 2713 2999 Renesas Technology Shanghai Co Ltd Unit2607 Ruijing Building No 205 Maoming Road S Shanghai 200020 China Tel lt 86 gt 21 6472 1001 Fax lt 86 gt 21 6415 2952 Renesas Technology Singapore Pte Ltd 1 Harbour Front Avenue 06 10 Keppel Bay Tower Singapore 098632 Tel lt 65 gt 6213 0200 Fax lt 65 gt 6278 8001 Colophon 2 0 H8 300 and 300L E6000 Emulator User s Manual 2CENESAS Renesas Electronics Corporation 1753 Shimonumabe Nakahara ku Kawasaki shi Kanagawa 211 8668 Japan REJ10B0155 0100H
188. as an internal timer counter where no internal read write signal is generated to update a value 5 9 1 Opening the Monitor Window To open the Monitor window select View gt CPU gt Monitor gt Monitor Setting or click the Monitor toolbar button to display the Monitor Settings dialog box Monitor Setting 2 x Monitor Setting Name monitort m Options Address H OOFFEFAD Size byte Ha o Access Format fevTewsci M Auto Refresh at rate ms bp oos50 IV Reading the Initial Value r Color Change Indicator Change be Foreground i M Background C M IV Mayfly m Detail DETAIL NOT SUPPORTED Detail History Figure 5 33 Monitor Setting Dialog Box 251 RENESAS Name Decides the name of the monitor window Options Sets monitor conditions Address Sets the start address for monitoring Size Sets the range for monitoring Access Sets the access size to be displayed in the monitor window Auto Refresh at rate ms Sets the interval for acquisition by monitoring 500 ms at minimum Reading the Initial Value Selects reading of the values in the monitored area when the monitor window is opened Color Sets the method to update monitoring and the attribute of colors Change Indicator Selects how to display the values that have changed during monitoring available when Reading the Initial Value has been se
189. ase Dialog Step 3 43 RENESAS The fourth and final step figure 3 3e allows you to specify any environment variables which the phase requires New Build Phase Step 4 of 4 BEI W Does the command require any environment variables to be set If so enter them into the list below I Read Output On Fly lt Back Finish Cancel Figure 3 3e New Build Phase Dialog Step 4 To add a new environment variable click the Add button the dialog shown in figure 3 4 will be invoked Enter the variable name into the Variable field and the variable s value into the Value field and then click OK to add the new variable to the list of the fourth step To modify an environment variables select the variable in the list and then click the Modify button Make the required changes to the Variable and Value fields and then click OK to add the modified variable to the list To remove environment variables select the variable that you want to remove from the list and then click the Remove button Environment Variable 2 xi Variable a Value Placeholder c dos c mptools c windows c temp popup menu Figure 3 4 Environment Variable Dialog If the tool you are adding can display its output as the tool is running then use the Read Output On Fly option This will display the tool output as each line of output happens If this option is s
190. asonable protection against harmful interference when the equipment is operated in a commercial environment This equipment generates uses and can radiate radio frequency energy and if not installed and used in accordance with the instruction manual may cause harmful interference to radio communications Operation of this equipment in a residential area is likely to cause harmful interference in which case the user will be required to correct the interference at his own expense VI tENESAS Introduction The E6000 emulator is an advanced realtime in circuit emulator which allows programs to be developed and debugged for the H8 family microcomputers The E6000 emulator can either be used without a user system for developing and debugging software or connected via a user system interface cable to a user system for debugging user hardware High performance Embedded Workshop hereafter referred to as HEW is a Graphical User Interface intended to ease the development and debugging of applications written in C C programming language and assembly language for Renesas microcomputers Its aim is to provide a powerful yet intuitive way of accessing observing and modifying the debugging platform in which the application is running HEW is a powerful development environment for embedded applications targeted at Renesas microcontrollers The main features are e A configurable build engine that allows you to set up compiler assembler
191. assuceansegserseegcenaseescenpecedceuaseece 51 343 Dependent Files Tabss isc ccsssscssspsososscsavsesecsovebeaszesesosencassonesasnsecessadsetenoaniaconaeaize 53 Pile Mappings isivasinwnsacs iiiacivenunencinensinen vere nineties aie 55 Gontrolling the Build irese nasrai rE EA NEEE EEE EEE ENERET 57 LOS ENE Build Output sesereiinreicrseiiseassovavoseosssv triv ersi vesventi toV cesedesbsenensoneseousedesvoneees 58 Changing Toolchain Versiohessissrenuriesrrressisirsirioinian ees itiiti erosie EEEn 59 Using an External Debug get cvssccscenssesecessseeccesonesesssusessessbneseceontinesersacngsaovesnsseodosteseesstves 60 Generating d Makefile arero neee a NA AEE S 63 Using a makefile inside the HEW system eee cee cceeeseeeeeeeseeesseeseeesaeteeeeeaes 65 Customizing the HEW linkage order s sssesssisesesesssesersssrsisssessessrersvsrsersserisevisevavosirss ses s 67 WSIS tHe Editor scssiesieessesstesssacssesessestvesbecstedeestesedetesedvscsverienedvtiilvs 69 We Editor WANK OW icossecsscetsecncstvsesecenaccetcessseotsasoncensosoassseossnessenebnnngendaceecenstedcenasoeteqroseenes 69 Working with Multiple Pilesicccccsssscsssssssecsossiscsseascacsvecusacovovesacsvasvacessaievecennaaacesavatesdssaaesas 70 ADA The Editor TOOLS ssstsascsssvessexesssavsxcsty ers EEA AARE 70 4 2 2 Editor Toolbar Buttons 70 4 2 3 Search Toolbar Buttons 72 4 2 4 Bookmarks Toolbar Buttons 72 4 2 5 Templates Toolbar Buttons 72 Standard File Operations
192. at which you want the program to stop 3 You will see a red circle appear in the gutter to indicate that a PC breakpoint has been set 4 The current breakpoint set can be enabled or disabled by using Enable Disable Breakpoint in the popup menu Now when you run your program and it reaches the address at which you set the PC breakpoint execution halts with the message PC Break displayed in the Debug sheet of the Output window and the Source or Disassembly window is updated with the PC breakpoint line marked with an arrow in the gutter Note When a break occurs the program stops just before it is about to execute the line or instruction at which you set a program PC breakpoint If you choose Go or Step after stopping at the PC breakpoint then the line marked with an arrow will be the next instruction to be executed 265 RENESAS e To set a PC breakpoint by using the Breakpoints dialog box Selecting Edit gt Source Breakpoint displays the Breakpoints dialog box Milowsre chLine 12 Cancel Edit Code Remove All Figure 5 46 Breakpoints Dialog Box The Breakpoints dialog box allows the user to view the current breakpoints set Clicking the Edit Code button displays the source where each breakpoint is set The Remove or Remove All button deletes one or all breakpoints respectively The check box of each breakpoint enables or disables the breakpoint e To toggle PC breakpoints It is
193. ault User System Interface Circuit 405 RENESAS RES TEST NMI NMI is only for the H8 3877 group These signals are input to the evaluation chip via HD151015 Therefore the rising falling time must be within 8 ns or less User system 47 Q interface cable HD151015 Figure 7 60 User System Interface Circuit for RES TEST NMI OSC1 and X1 These signals are input to the evaluation chip via HD151015 Therefore the rising falling time must be within 8 ns or less Veco 4 7kQ User system 47Q interface cable HD151015 Figure 7 61 User System Interface Circuit for OSC1 and X1 PBO ANO to PB7 AN7 PB4 AN4 to PB7 AN7 are only for the H8 3877 group Evaluation o User system chip 470 interface cable Figure 7 62 User System Interface Circuit for PB0 ANO to PB7 AN7 AVcc AVss A Vref and Vtref AVref is only for the H8 3877 group Evaluation chip User system 27KQ interface cable Figure 7 63 User System Interface Circuit for AVcc AVss A Vref and VTref P20 to P27 Evaluation User system chip interface cable Figure 7 64 User System Interface Circuit for P20 to P27 406 RENESAS V1 V2 and V3 H8 3877 group only Evaluation User system chip interface cable Figure 7 65 User System Interface Circuit for V1 V2 and V3 TONED and TONEM TONEM is only for the H8 3877 group Evaluation User system chip interface cable Figure 7 66 User System In
194. axis enlarged 5 19 5 Zoom Out Display Selecting Zoom Out from the popup menu displays the waveforms with the horizontal axis reduced 5 19 6 Resetting the Zoom Display Selecting Reset Zoom from the popup menu displays the waveforms in its original size 5 19 7 Setting the Zoom Magnification In the Zoom Magnification submenu of the popup menu the zoom magnification can be selected from 2 4 or 8 5 19 8 Setting the Horizontal Scale In the XScale submenu of the popup menu the size of the X axis can be selected from 128 256 or 512 pixels 334 RENESAS 5 19 9 Non Display of Cursor Selecting Clear Cursor from the popup menu hides the cursor display 5 19 10 Displaying the Sampling Information Selecting Sample Information from the popup menu displays the Sample Information dialog box Sample Information Data Size 8bit Channel Mono x H 00000310 y H 23 Value Figure 5 104 Sample Information Dialog Box Displays the sampling information of the cursor location in the Waveform View window The following information is displayed Data Size Displays 8bit or 16bit Channel Displays the data channel Value X Displays the X axis of cursor location Y Displays the Y axis of cursor location displays Y axes for both the upper and lower plots when Stereo is selected 335 RENESAS 5 20 Analyzing Performance Use the performance analysis function t
195. ay cycles after an event Up to eight events can be combined into a sequence in which each event is either activated or deactivated by the occurrence of the previous event in the sequence For example you can cause a break if an I O register is written to after a specified area of RAM has been accessed 3 2 2 Range Channels The range channels can be set up to be triggered on a combination of one or more of the following e Address or address range inside the range e Read or Write or either e Data with an optional mask e MCU access type e g DMAC and instruction prefetch e MCU access area e g internal ROM and internal RAM e A signal state on one or more of the four external probes e Delay cycles after an event The complex event system can be used to control the following functions of the emulator 196 RENESAS 3 2 3 Breaks Use breaks to interrupt program execution when a specified event or sequence of events is activated For example you can set up a break to halt execution when the program reads from one address and then writes to another address The break can also optionally be delayed by up to 65535 bus cycles 3 2 4 Timing You can set up two events and then measure the execution time of the program between the activation of the first event and second event 3 3 Hardware Features 3 3 1 Memory The emulator provides standard emulation memory as the substitute for internal ROM memory and internal RAM memory
196. bactive prefetch cycles CPU_MEDIUM_DATA data access cycles in medium speed mode or CPU_MEDIUM_PREFETCH prefetch cycles in medium speed mode This item is not available when a time stamp is acquired Clock Number of clock cycles in bus cycles not available when a time stamp is acquired Probes A 4 bit binary number showing the four probe pins in the order of Probe 4 Probe 3 Probe 2 and Probe 1 from the left not available when a time stamp is acquired NMI Status of the NMI input signal not available when a time stamp is acquired Timestamp Time stamp of the record Time stamps start from zero each time the user program is executed The timer resolution depends on the time stamp clock rate selected in the trace acquisition only available when a time stamp is acquired Source Source program Label Label information for the address if defined Timestamp Difference from the timestamp value shown on the previous line only available Difference 422 when a time stamp is acquired RENESAS 8 1 11 Searching for a Trace Record While using the emulator the Trace Find dialog box has the following pages Table 8 12 Trace Find Dialog Box Pages Page Description General Sets the range for searching Address Sets an address condition Data Sets a data condition R W Selects the type of access cycles Area Selects the area being accessed not available when a tim
197. bly window Command Line Ctrl L Opens the Command Line window TCL toolkit Shift x Opens the Console window GaL Workspace Alt K a Opens the Workspace window Output Alt U Opens the Output window Difference Opens the Difference an window CPU Registers Ctrl R Opens the Registers window Memory Ctrl M Opens the Memory window IO Ctrl I Ea Opens the IO window Status Ctrl U m Opens the Status window Extended Monitor E Opens the Extended Monitor zt window Monitor Monitor Shift Ey Opens the Monitor window Setting Ctrl E Windows Opens the Windows Select Select dialog box to list add or edit the Monitor window Sym Labels Shift Opens the Labels window bol Ctrl A Watch Ctrl W zl Opens the Watch window Locals Shift fal Opens the Locals window Ctrl W Code Eventpoints Ctrl E E Opens the Eventpoints window Trace Ctrl T Opens the Trace window Stack Trace Ctrl K Opens the Stack Trace window 461 RENESAS Table G 1 GUI Menus cont Menu Option Toolbar Shortcut Button Remarks View Gra Image Shift LJ Opens the Image window cont phic Ctrl G Waveform Shift Opens the Waveform Ctrl V window Per Performance Opens the Performance form Analysis ance Shift Ctrl P Analysis window Options Debug Sessions Opens the Debug Sessions dialog bo
198. bugging function The Source window provides a very simple way of setting a PC breakpoint at any point in a program For example to set a PC breakpoint at the sort function call e Select by double clicking the Editor column on the line containing the sort function call ral Tutorial GH Tutorial Ey C source file B dbsct c El sbrk c C source file B resetprg cpp E sort cpp BB vical con Download modules 4 Tutorial abs Dependencies E sbrk h sort h stacksct h oy om 0x00001038 Ox00001044 Ox00001046 O0x0000104e 0x00001050 0x00001058 O0x0000105a 0x0000105c 000001070 Ox0000107a 0x00001082 0x0000108a 0x00001096 0x000010a2 0x000010ae 0x000010ba 0x000010c6 0x000010d2 0x000010de 0x000010ea 0x000010f6 0x000010fc void tutorial void long a 10 long j int i class Sample p_sam P_sam new Sample for i 0 i lt 10 i j rand if j lt D4 Jiste api arj p_sam gt sort a p_sam gt change a p_sam gt sO a 0 p_sam gt sl a 1 p_sam gt s2 a 2 p_sam gt s3 a 3 p_sam gt s4 a 4 p_sam gt sS a 5 p_sam gt s6 a 6 p_sam gt s7 a 7 p_sam gt s8 a 8 p_sam gt s9 a 9 delete p_sam Figure 6 4 Source Window Setting a PC Breakpoint The symbol will appear on the line containing the sort function This shows that a PC breakpoint has been set REN
199. build 2 If any of the output files are missing 3 Any of the source files have a newer date than the phase s output files 4 Any of the dependent files have a newer date than the phase s output files 5 Ina user defined custom build phase the Don t check for input file s existence before executing check box is checked To see the status of this check box select Options gt Build Phases select the phase in the Build Phase Order list in the Build Order tab and click the Modify button Then you will see the Don t check for input file s existence before executing check box on the Command tab 6 A subcommand file is selected in Optimizing Linkage Editor I want to exclude a file in a project from build temporarily Push the right button of your mouse on the file in the Projects tab of the Workspace window and select Exclude Build lt file gt where lt file gt is the selected file Then the file is excluded from build To include the file in build again push the right button of your mouse on the file and select Include Build lt file gt I opened a workspace from my PC and one of my colleagues opened the same workspace simultaneously from another PC I changed the settings of the workspace and saved it He or she saved the workspace after me I opened the workspace again and found that the settings of the workspace differed from what I had set before The settings sa
200. but Renesas Electronics does not warrant that such information is error free Renesas Electronics assumes no liability whatsoever for any damages incurred by you resulting from errors in or omissions from the information included herein Renesas Electronics products are classified according to the following three quality grades Standard High Quality and Specific The recommended applications for each Renesas Electronics product depends on the product s quality grade as indicated below You must check the quality grade of each Renesas Electronics product before using it in a particular application You may not use any Renesas Electronics product for any application categorized as Specific without the prior written consent of Renesas Electronics Further you may not use any Renesas Electronics product for any application for which it is not intended without the prior written consent of Renesas Electronics Renesas Electronics shall not be in any way liable for any damages or losses incurred by you or third parties arising from the use of any Renesas Electronics product for an application categorized as Specific or for which the product is not intended where you have failed to obtain the prior written consent of Renesas Electronics The quality grade of each Renesas Electronics product is Standard unless otherwise expressly specified in a Renesas Electronics data sheets or data books etc Standard Computers
201. button after setting conditions in those pages stores the settings and starts searching Clicking the Cancel button closes this dialog box without setting of conditions When a trace record that matches the search conditions is found the line for the trace record will be highlighted When no matching trace record is found a message dialog box will appear Only the trace information that satisfies all the conditions set in above pages will be searched If a find operation is successful selecting Find Next from the popup menu will move to the next found item 303 RENESAS 1 General page Set the range for searching mem x Status Probes IRQ 0 General l Address Data RAw Area Tr I Upward search Start PTR 32767 End PTR po o Oo O Cancel Apply Figure 5 76 Trace Find Dialog Box General Page Trace search range Sets the range for searching Not designation Searches for information that does not match the conditions set in other pages when this box is checked Upward search Searches upwards when this box is checked Start PTR Enters a PTR value to start a search End PTR Enters a PTR value to end a search Note Along with setting the range for searching PTR values to start and end searching can be set in the Start PTR and End PTR options respectively 304 RENESAS 2 Address page Set an address condition Figure 5 77 Trace F
202. ce Window Figure 6 61 shows that the position of the program counter is currently at the selected line of the sort function and that the sort function is called from the tutorial function To remove the PC breakpoint double click the Editor column in the sort function again 380 RENESAS 6 18 Monitor Function function is stored The emulator allows monitoring of the content of specified addresses in memory during execution of the user program In this example we monitor the content of the address range where variable a of the tutorial 1 Select the CPU submenu from the View menu Then selecting Monitor Setting from the Monitor submenu displays the Monitor Setting dialog box Monitor Setting Monitor Setting Name monitori m Options Address JHroooooo00 Size byte 2 Access Format eyte esen o d IV Auto Refresh at rate ms Doos JV Reading the Initial Value r Color Change Indicator Change x Foreground Background m fA M Mayfly m Detail Figure 6 62 Monitor Setting Dialog Box RENESAS 2 Set the items in the Monitor Setting dialog box as follows e Enter monitor in the Name edit box e Set the parameters in the Options group box as follows a Use the Locals window to refer to the address on the line where variable a which is defined within the tutorial function is allocated and enter this ad
203. ceecseeeeeeeeeeesseeeeeesseeeeseeaes 329 5 18 1 Opening the Image View Window 0 cece eee ce eeceeceeesseteeeetaeeeeeeas 329 5 18 2 Automatically Updating the Window Contents 331 5 18 3 Updating the Window Contents sessssssessssisreterseettsesesssessessnesrnenrnenestsenenrnene 332 5 18 4 Displaying the Pixel Information s sssssssssssisreserstssrsrssessesressnestnenrnesenessnesrreet 332 Displaying Memory Contents as Waveforms ccceceeeeeese cess eeeseeeeeeeeeseeeeeetaeeeeneaes 333 5 19 1 Opening the Waveform View Window ccce cece ceeesseeeeseteeeeseeeeenaes 333 5 19 2 Automatically Updating the Window Contents eee eee eteeeeeeaes 334 5 19 3 Updating the Window Contents 00 0 ccc eceecceeseeseeecseeseeeeseeetaeeeesesaeeeeeeeseeane 334 DADA Zoomin Display ccsecerssssessesssesvesssirsuesesvevaesrosevasteoteoseteesesestevtseentonsecendevdetostordwtes 334 5 19 5 ZOOM OULDISPlAY ssccis dives vdessssvcssssvsucses suvesscedesaetoecessentdnessesedesesastsesbensoaesneesedestw 334 5 19 6 Resetting the Zoom Display cece eceeeseesceeeseeeceeseesseeteesesaseeeseeeseeaees 334 5 19 7 Setting the Zoom Magnification 0 cece cece ese ceeee cece eeeeseeeseeeseeteeeeseeees 334 5 19 8 Setting the Horizontal Scale z 5 199 Non Display Of CursOtic iccsicssuncdissvseseosveasheosvcessestnasstestuassuestescecssvenekcosvoensessessses 5 19 10 Displaying the Sampling Information s s ssssssessrssssesststssrsresrresenest
204. changes gt To float a toolbar 1 Double click on the control bar of a docked toolbar or 2 Drag the control bar of a docked toolbar and draw it away from the edge of the HEW main frame and from an edge of the other docked windows toolbar 1 2 4 The Workspace Window The Workspace window has three panes The Projects tab shows the current workspace projects and files figure 1 14 You can quickly open any project file or dependent file by double clicking on its corresponding icon Workspace Iof x E Demo Demo 3 8 Assembly source file 2 lowlviste C source file dbsct c Demo c intprg c L lowsre c resetprg c Dems vecttbl c Dependencies Navigation Tab Templates Tab Project Tab T erje a Figure 1 14 Workspace Window Projects Tab RENESAS The Navigation tab provides jumps to various textual constructs within your project s files What is actually displayed within the navigation tab depends upon what components are currently installed Figure 1 15 shows ANSI C functions See chapter 2 Build Basics for more information on the Workspace window The Templates tab displays template settings See 4 12 Templates for more information about a template Workspace ioj x i Demo amp sbrk amp _CLOSEALL _INIT_IOLIB change amp close amp Dummy INT_Ille
205. chine is currently changing the toolchain options all of the other machines can only see read only versions of this data Note The performance of HEW does suffer when using the network facilities If working in a small team it might be more suitable to use the single user mode and version control 157 RENESAS 10 1 1 Enabling network access gt To use network access 1 Select Tools gt Options The HEW tools options dialog is displayed 2 Select the network tab This is displayed in figure 10 2 3 Click the enable network access checkbox This should add an administrator to the system without a password The administrator is the only user that can add additional users to the system and change user access rights The administrator has the highest level of access 4 Before leaving the network dialog the administrator must set their password It is not possible to leave this dialog until this is completed This is described below 10 1 2 Setting the administrator user s password gt To set the password 1 Continue from the previous sections steps Click the password button This should have been enabled when the network data access was enabled The password dialog is displayed This is shown in figure 10 3 The user name is read only in the top field In this case it should be Admin Type the new password into both of the fields and click OK This should set the user and password on the Tools gt Options network tab It is n
206. cified address is used directly 5 lt format gt format for register output Valid values are H for Hexadecimal D for decimal and B for binary 6 lt bitfields gt section defining the bits within the register Bitfield sections define the bits within a register each entry is of the type bit lt no gt lt name gt 1 lt no gt is the bit number 2 lt name gt is a symbolic name of the bit Comment lines are allowed and must start with a character gt An example is shown below 451 RENESAS Comment Module Module definition Register name Example H8S 2655 Series I O Register Definitions File Modules FileVersion 2 BaseAddress 0 Module1 Power_Down_Mode_Registers Module2 DMA_Channel_Common Module3 DMA_Channel_0 Module42 Bus_Controller Module43 System_Control Module44 Interrupt_Controller DMA_Channel_Common reg0 regDMAWER reg1 regDMATCR reg2 regDMACROA reg3 regDMACROB reg4 regDMACR1A reg5 regDMACR1B reg6 regDMABCRH reg7 regDMABCRL dep regMSTPCRH 7 0 Bit Value Register definition Register name regDMAWER id DMAWER Oxffff00 B A H dmawer_bitfields Address Size Absolute address flag Format Bit field dmawer_bitfields Bit field bit3 WE1B definition bit2 WE1A bit1 WEOB bit0 WE0A 452 RENESAS Appendix E Symbol File Format To decode the symbol file correctly the file must be formatted as a Pentica B file 1 The f
207. cified area condition String Select an area condition not available when Don t care has been checked Note Available areas vary according to the emulator in use For details refer to section 5 15 4 Signals to Indicate Bus States and Areas 308 RENESAS 6 Status page Select the status of a bus The selection is not available when a time stamp is acquired mem x General Address Data RAw Area Status Probes S mazo O ro Setting String PROG 7 Cancel Apply Figure 5 81 Trace Find Dialog Box Status Page Don t care Detects no bus condition when this box is checked Setting Detects the specified bus condition String Select a bus condition not available when Don t care has been checked Note Available bus conditions vary according to the emulator in use For details refer to section 5 15 4 Signals to Indicate Bus States and Areas 309 RENESAS 7 Probes page Select the status of four probe signals The selection is not available when a time stamp is acquired mem x General Address Data Rew Area Status Probes Rozo a r Setting Probe4 Don t care Probe3 Dont care 7 Probe2 Dont care 7 Probet Dont care 7 Cancel Apply Figure 5 82 Trace Find Dialog Box Probes Page Don t care Detects no probe signal condition when this box is checked Setting Detects the specified prob
208. cillator circuit is on the user system interface cable User system 47Q interface cable HD151015 Figure 7 47 User System Interface Circuit for EXTAL STBY Hardware standby cannot be used 10 KQ Evaluation chip Figure 7 48 User System Interface Circuit for STBY P70 AN0 to P77 AN7 H8 3318 group only Evaluation o User system chip 470 interface cable Figure 7 49 User System Interface Circuit for P70 ANO to P77 AN7 402 RENESAS AVcc and AVss Evaluation chip 27 ka User system interface cable Figure 7 50 User System Interface Circuit for AVcc and AVss 7 3 9 User System Interface Circuits of the H8 3834 H8 3814 Group Evaluation Chip HS3834EVI60H All user system interface signals are directly connected to the evaluation chip in the emulator with no buffering except for those listed below e RES e MDO e OSCI XI e TEST The circuits that interface the evaluation chip in the emulator to the user system include pull up resistors that cause signal delays Note that when an input terminal is in the high impedance state the pull up resistor forces the terminal to be at a high level Adjust the user system hardware to compensate for these effects The delay caused by the user system interface cable is about 3 ns The following diagrams show the user system interface signal circuits Default Evaluation chip Figure 7 51 Default User System Interface Circuit
209. ck and drag its control bar to the new location Close button al Figure 1 17 Control Bar of Docking Window gt To dock the Workspace window or the Output window Allow Docking must be checked on the pop up menu of the window to dock the Workspace window or the Output window The pop up menu will be displayed when you click the right mouse button anywhere inside the window Then you have two ways to dock the window 1 Double click on the control bar of a floating window or 2 Drag the title bar of a floating window and draw it toward an edge of a docked window menu bar or toolbar or the HEW main frame on whose edge you would like to dock the window until the shape of the floating window changes gt To float the Workspace window or the Output window Allow Docking must be checked on the pop up menu of the window to float the Workspace window or the Output window The pop up menu will be displayed when you click the right mouse button anywhere inside the window Then you have two ways to float the window 1 Double click on the control bar of a docking window or 2 Drag the control bar of a docked window and draw it away from the edge of the HEW main frame and from an edge of the other docked windows menu bar or toolbar gt To hide the Workspace window or the Output window Click on the close button which is located in the top right c
210. comprised of those with the conditions 1 and 2 listed above 413 RENESAS General page cont Break on access error When this box is checked a break the user program stops occurs if your program accesses an access prohibited area or writes to a write protected area Enable Boot Mode When this box is checked the boot programming mode of flash memory will be set Execute Go Reset to actually use this mode This option is selectable only when an MCU with flash memory is in use User VCC Threshold Sets the voltage level for the user system Down will be displayed in User System Voltage of the Extended Monitor window when the actual user VCC of the target system is lower than the specified value User Signals When this box is checked the reset and NMI signals from the user system are enabled Driver Displays the E6000 driver that is currently installed Change driver in start up When this box is checked selection of a driver will be available next time the emulator is connected 414 RENESAS The MCUs selectable by the Device option and options that depend on the MCUs are listed below To emulate an MCU with a description in the Expansion Hardware column connect the correct expansion hardware Table 8 2 Environment for the H8 300 E6000 Emulator CPU 300 Debugging Platform Evaluation SubClock Expansion Hardware Chip Set Device Option Clock Option Op
211. contains one or more projects and each project contains one or more files Figure 1 1 illustrates this graphically PROJECT PROJECT PROJECT WORKSPACE Figure 1 1 Workspaces Projects and Files Workspaces allow you to group related projects together For example you may have an application that needs to be built for different processors or you may be developing an application and library at the same time Projects can also be linked hierarchically within a workspace which means that when one project is built all of its child projects are built first However workspaces on their own are not very useful we need to add a project to a workspace and then add files to that project before we can actually do anything RENESAS 1 2 The Main Window The HEW main window appears as shown in figure 1 2 lt lo xj Dee EAR Wew Project Ostera Gid Qebug Memory Tods Window teip alaj x OSG St belorToal se io sesle ne mm ENE A Jaga TI z CEFEJA EA Hlg SHI dA e TA SS sa la DEEE LEA AAE E EEC E amal BS RS BF Ta 0x000020ac rosa sort long a F E I Assembly sorce tile long e E mpane int 1 J k gap 15 vests 0x000020b2 gap 5 D vherder ve 0x000020b4 while gap gt D S Couce tte 0x000020b8 for k O kegap k E cbectc 0x000020be for imktgap 1 lt 10 iritgap 0x000020ca tor 3 1 gap j gt k j J gap i SE 0x00002042 itll j gap
212. ct 1 Select Project gt Add Files or click the right mouse button on a project icon in the Projects tab of the Workspace window and select Add Files from the pop up menu see figure 2 3 or press INS when the Workspace window is selected Open dbsct c Build dbsct c Build Options L Add Files INS Remove Files Exclude Build dbsct c version Control gt Configure View Show Differences v Allow Docking Hide Properties Figure 2 3 Projects Tab Pop up Menu 2 The Add dialog will be displayed 3 Select the file s that you want to add and then click Add RENESAS There are a number of other ways to add new files to the project These are described below e Clicking right button on an open file in the editor window displays a pop up menu option figure 2 4 If the file is already in the project then the Add File to Project menu option is disabled Selecting the Add File to Project then adds the file to the current project Build File dbsct c Instant Watch Cut Ctrl x Copy Ctrl C Paste Gory Add File To Project r Find Ctrl F Find In Files F4 Replace Ctrl H Goto Line Ctrl G Match Braces Shift Ctrl M Bookmarks k Templates Toggle Breakpoint F9 f Enable Disable Breakpoint Gtr F9 Define Column Format Columns Go To Cursor Set PC Here Di
213. ct the user system interface cable to the connector of the emulator 3 Turn on the emulator 4 Activate the HEW from the Programs in the Start menu figure 2 10 a Windows Update Pro gt EA High performance Embedded Workshop Help a High performance Embedded aed Read Me D High performance Embed Documents 2 amp Settings gt A search 1D vel Run Shut Down Figure 2 10 Start Menu Note If LAN Driver is not selected at installation Tools is not displayed 189 RENESAS 5 The Welcome dialog box is displayed eg Cancel 2 Open a recent project workspace Administration a Browse to another project workspace Figure 2 11 Welcome Dialog Box To use a workspace for the tutorial select the Browse to another project workspace radio button and click the OK button When the Open Workspace dialog box is opened specify the following directory HEW installation destination directory Tools Renesas DebugComp Platform E6000 xxxx Tutorial After the directory has been specified select the following file and click the Open button Open Workspace 2 x Look in Tuori ss e a e ES Debug_H8S_2237_E6000_Emulator_CP Source File name Tutorial hws Files of type Workspaces hws hd Cancel 4 Figure 2 12 Open Workspace Dialog Box 190 RENESAS When no compiler package or that of a diff
214. ction and the numbering of each module must be sequential Each module corresponds to a register definition section and within the section each entry defines an I O register The BaseAddress definition is for devices where the location of I O registers moves in the address space depending on the CPU mode In this case the BaseAddress value is the base address of the I O registers in one specific mode and the addresses used in the register definitions are the address locations of the registers in the same mode When the I O register file is actually used the BaseAddress value is subtracted from the defined register address and the resultant offset added to the relevant base address for the selected mode The Register definition entry is entered in the format lt name gt lt address gt lt size gt lt absolute gt 1 lt name gt register name to be displayed 2 lt address gt address of the register 3 lt size gt which may be B W or L for byte word or longword default is byte 4 lt absolute gt which can be set to A if the register is at an absolute address This is only relevant if the I O area address range moves about on the CPU in different modes In this case if a register is defined as absolute the base address offset calculation is not performed and the specified address is used directly Comment lines are allowed and must start with a character An example is shown below 449 RENESAS Example
215. d If Delete All is selected the settings of all channels become disabled 5 15 15 Viewing the Source Line for an Event Point Select an event point and choose Go to Source from the popup menu to open the Source or Disassembly window at address of event point The Go to Source menu is only available when one event point that has the corresponding source file is selected 292 RENESAS 5 16 Viewing the Trace Information The emulator acquires the results of each instruction execution into the trace buffer as trace information and displays it in the Trace window The conditions for the trace information acquisition can be specified in the Trace Acquisition dialog box Since trace information in bus cycles is acquired by the hardware circuit and stored in the trace buffer the realtime operation is retained The Trace window displays the content of the trace buffer which records up to 32 768 bus cycles from the last program run and is always updated 5 16 1 Opening the Trace Window To open the Trace window choose View gt Code gt Trace or click the Trace toolbar button 5 16 2 Acquiring Trace Information When the emulator does not set the acquisition condition of the trace information all bus cycles are acquired by default without any condition free trace mode In the free trace mode trace acquisition is started with the execution of the user program and stopped by halting the user program The acquired
216. d system Makefile options M Makefile path WORKSPDIR make PROJECT NAME mak gt Browse F Generate makefile before build commenc Cancel Figure 2 19 Options Dialog Build Tab 29 RENESAS 2 6 7 Displaying out of date files in the workspace window Files updated later than the file generated by the previous build i e out of date files are marked in the workspace window In figure 2 20 below file demo c is out of date When you click build next time this file will be re built This is also displayed for dependent projects of the current project The view of these files is updated whenever something that affects the build occurs e g options changing file addition dependencies changing files modified etc Workspace 3 Assembly source file LE intprg sre vecttbl src 2 vhandler src Ey C source file 2 dbsct c LE demo c LE lowsre c E resetprg c LE sbrk c H E Download modules Ei demo abs Dependencies lowste h sbrk h stacksct h Fj E Projects Templates lt Navigation Figure 2 20 Displaying out of date files gt To display out of date files in the workspace window 1 Select Tools gt Options The Options dialog will be displayed 2 Select the Build tab figure 2 19 3 Check the Mark out of date files check box 4 Click OK 30 RENESAS 2 7 File Dependencies
217. d when possible 64 RENESAS 3 11 Using a makefile inside the HEW system The HEW also allows you to configure the internal build to use a particular make file rather than the internal HEW system when build is clicked The standard HEW integrated build should be fine for all of your building requirements However in some cases you may feel the need to use makefiles rather than relying on the HEW internal make system The techniques to do this are described below gt To set up the internal makefile execution 1 Create a base HEW workspace in which to launch your makefile in It makes sense if this is the same toolchain as the one to be used in your makefile Although this is not essential Click on Tools gt Options 3 Click the build tab figure 3 24 Select the makefile command which should be used By default this is set to the Renesas make tool shipped with HEW This is called HMAKE exe and is located in the HEW installation directory HEWDIR 5 Click the Use makefile build system check box This tells the HEW that when the build button is clicked that makefile should be executed rather than the internal build 6 Setup the makefile path This defaults to the location which HEW will generate makefiles to This item is configuration based so you can have a different makefile for each configuration Note You do not need to use a makefile generated by HEW It can be any format as long as your make tool supports it
218. de Range r Data Compare Direction I Compare F Use Mask C Bead Value D0 5 ahi C White Figure 6 43 Breakpoint Event Properties Dialog Box after Setting an Event 367 RENESAS 4 The event that has been set is now displayed in the Event combo box of the Trace Events group box on the General page of the Trace Acquisition dialog box Trace Acquisition Add est Figure 6 44 Trace Acquisition Dialog Box Adding an Event 368 RENESAS 5 To enable the event condition that has been set uncheck the Free Trace check box on the General page This will add pages 1 to 4 to the Trace Acquisition dialog box Trace Acquisition a Sp Delyedseo 1 J2 19 le a E x a dd en Dete oaan Figure 6 45 Trace Acquisition Dialog Box Pages Added 369 RENESAS 6 Select page 1 and click the Range radio button in the Conditions group box This will display the Range Event combo box and the Edit button Trace Acquisition Figure 6 46 Trace Acquisition Dialog Box Displaying Page 1 370 RENESAS 7 Select the event you have registered from the Range Event combo box The event is now enabled Click the OK button to complete the trace setting Trace Acquisition 2 x General Stop Delayed Stop 1 2 3 4 Conditions Disabled Point to Point Range C Event Range Event Edit 9 R H 1
219. der Tips Placeholders are there to allow you to create flexible paths to the various files used by the system e If there is a placeholder popup menu e next to an edit field into which you are about to enter a path or file you should consider how you can use a placeholder to make that path or file definition flexible e If you use several configurations then the CONFIGDIR placeholder is very useful to ensure that files can be written to and from the current configuration s directory e Wherever possible use a placeholder They can always be removed or added later so don t be afraid to experiment 447 RENESAS 448 RENESAS Appendix D I O File Format HEW formats the IO window based on information it finds in an I O Register definition file When you select a debugging platform HEW will look for a lt device gt 1O file corresponding to the selected device and load it if it exists This file is a formatted text file that describes the I O modules and the address and size of their registers You can edit this file with a text editor to add support for memory mapped registers or peripherals you may have specific to your application e g registers in an ASIC device mapped into the microcomputer s address space The following describes two formats of the lt device gt IO file that supports or not the bit field D 1 File format Bit Field Not Supported Each module name must be defined in the Modules definition se
220. der certain use conditions Further Renesas Electronics products are not subject to radiation resistance design Please be sure to implement safety measures to guard them against the possibility of physical injury and injury or damage caused by fire in the event of the failure of a Renesas Electronics product such as safety design for hardware and software including but not limited to redundancy fire control and malfunction prevention appropriate treatment for aging degradation or any other appropriate measures Because the evaluation of microcomputer software alone is very difficult please evaluate the safety of the final products or system manufactured by you Please contact a Renesas Electronics sales office for details as to environmental matters such as the environmental compatibility of each Renesas Electronics product Please use Renesas Electronics products in compliance with all applicable laws and regulations that regulate the inclusion or use of controlled substances including without limitation the EU RoHS Directive Renesas Electronics assumes no liability for damages or losses occurring as a result of your noncompliance with applicable laws and regulations This document may not be reproduced or duplicated in any form in whole or in part without prior written consent of Renesas Electronics Please contact a Renesas Electronics sales office if you have any questions regarding the information contained in this document or Renesas
221. dify File Extension Dialog 20 RENESAS 3 Select None to remove any association select Editor to open this type of file in the internal external editor or select Other if you want to open this type of file with a specific application If you select Other then you can select from any previously defined application from the drop down list or specify a new application Click Add to define a new application The Add Application dialog will be displayed figure 2 13 Enter the name of the tool into the Name field Enter the full path to the tool in the Command field do not include any parameters Enter the parameters that are required to open a file in the Parameters field Be sure to use the FULLFILE placeholder to specify the location file see appendix C Placeholders for more information on placeholders and their uses Enter the initial directory in which you would like the application to run into the Initial directory field Click OK to create the application Add Application 2 xi Name Cancel Command excluding parameters Doo M Browse Parameters gt Initial directory ft Browse Figure 2 13 Add Application Dialog Click Modify to modify an application The Modify Application dialog will be displayed This dialog is the same as the Add Application dialog described above except that the
222. dress in the Address edit box In this example enter H OOFFEF80 b Enter H 50 in the Size edit box c Select BYTE HEX from the Access combo box d Check the Auto refresh at rate check box and enter D 00500 e Check the Reading the Initial Value check box e Set the parameters in the Color group box as follows a Select Change from the Change Indicator combo box b Select red and white in the Foreground and Background combo boxes respectively c Check the Mayfly check box Note Depending on the operating system in use the foreground and background colors may not be selectable Monitor Setting 2 x Monitor Setting Name monitor m Options Address HOOFFE F80 Size byte H50 i Access Format BYTE HEX 7 IV Auto Retresh at rate ms p 00500 JV Reading the Initial Value Color Change Indicator Change 7 Foreground as Background CI JV Mayfly Detail DETAIL NOT SUPPORTED Detail m History Figure 6 63 Monitor Setting Dialog Box Setting Completed 382 RENESAS 3 Click the OK button to open the Monitor window monitor monitor H OOFFEFSO Address OxOOFFEF80 OxOOFFEFSO OxOOFFEFAO OxOOFFEFEBO OxOOFFEFCO Figure 6 64 Monitor Window 4 Select Reset Go from the Debug menu When the content of the address range changes with execution the updated values
223. ds provided choose a suitable name for the placeholder and a description of what the placeholder means 5 Then choose a directory which relates to this placeholder It is possible to use placeholders that are already defined in this field such as PROJDIR New Custom Placeholder x Placeholder Cancel Description Directory Figure 6 15 New Custom Placeholder Dialog 126 RENESAS 6 8 Using the workspace and project log facilities The HEW 3 0 has workspace and project logging facilities integrated into the application These facilities can be switched on via the log tab on the Tools customize dialog This option is especially useful when the network database is in operation This is because user names and changes are logged to this file This dialog is shown in figure 6 16 When the workspace log is clicked any workspace changes will be logged to a file with the same name as the workspace with a log extension This file will be located in the same directory as the workspace file When the generate log for projects log is clicked any projects in the current workspace that have changes made to them will be logged to a file with the same name as the project with a log extension This file will be located in the same directory as the project file The log file is updated when the workspace is saved 21x Toolbars Commands Menu Placeholders Debugger Log Help I Generate worksp
224. e Channeli rE EEEN ENNEN EIEEE OT RESE 196 ILI ISAK aior a AEA E E ERE E NEEESE 197 32A TIME Greccecssvectecrsssctacssecsnessyuestieviceycssvesstesesasad OTENE RETAS 197 33 lt Hatd ware PAGES vis s csessesesicocssenscccnsovsnronsecsweseusaduveedsosvesedooanenssuessovessossoueseonehecsedapveess 197 BS MEMORY T E EN 197 332 CLOCKS rori atisi Etn r EE E EEEE REESE OEEO A 198 KII Probes riene EA E E EE AE 198 IA Stack Trace FUNGUO sorso A EE EE E ES 198 39 Online Help eroen eener RaO EE VERNE EEs EE ENE RE 198 Section 4 Preparation before Use 199 4 1 Workspaces Projects and Files 199 4 2 Method for Activating HEW cetera 200 4 2 1 Creating a New Workspace Toolchain Not Used 4 2 2 Creating a New Workspace Toolchain Used gt 4 2 3 Selecting an Existing Workspace 00 209 4 3 Setting at Emulator Activation i 4 4 Debug Sessions 212 4 4 1 Selecting a Session 00 212 4 4 2 Adding and Removing Sessions 4 4 3 Saving Session Information 4 5 Connecting the Emulator 216 4 6 Reconnecting the Emulator 217 4 7 Ending the Emulator 5 0c lt sussocesaasecedeveveiecentvac ecestodeversecdecestesseansnscyesssaedeeoveuacgenssacugennvineseos 217 SECHON DS DeEDU GRINS sinsicciecesccesevesscctscnsstesscetsnedstesseetsvedonedseossneastonsestsressvensessseess 219 vii 5 1 5 2 5 3 5 4 5 5 5 6 5 7 5 8 viii Setting the Environment for Emulation s seseeeeseseseee
225. e and project files and also the source files e Full read write access The workspace and project files can be modified as can the source files But it is not possible to change user access rights from this access level e Read write file access Only the source files can be modified All project settings can only be viewed not modified e Read only All source files and project files can only be viewed as read only Nothing can be modified When any user opens a network enabled project they must type in their user name and password Until this is done no access can be granted Once entered the user is given one of the levels of access as seen above gt To add a new user to the system 1 Log in with a user who has administrator access rights The process for doing this is described above 2 Select Tools gt Options The HEW tools options dialog is displayed 3 Select the network tab This is displayed in Figure 10 2 4 Click the access rights button The dialog displayed in Figure 10 4 is displayed 5 Click the add button The log in dialog is displayed This allows you as the administration user to add a new log in name and password Normally the password should be set to some default text or left blank Then click OK 6 Once OK is clicked the user is added with read only rights To change the access level select the user you wish to modify and then click the required radio button Then click OK to save the access rights ch
226. e at the time it was saved When the saved state information of the selected workspace includes connection to the emulator the emulator will automatically be connected To connect the emulator when the saved state information does not include connection to the emulator refer to section 4 5 Connecting the Emulator 209 RENESAS 4 3 Setting at Emulator Activation When the emulator is activated the command chain can automatically be executed It is also possible to register multiple load modules to be downloaded The registered load modules are displayed on the workspace window 1 Select Debug Settings from the Options menu to open the Debug Settings dialog box Debug Settings DefaultSession he Target Options re sample Target z Default Debug Format lt none gt ba Download Modules Offset Address Form Add Remove Modify Up i Down Cancel Figure 4 13 Debug Settings Dialog Box Target Page 2 Select the product name to be connected in the Target combo box 3 Select the format of the load module to be downloaded in the Default Debug Format combo box then register the corresponding download module in the Download Modules list box 4 Click the Options tab 210 RENESAS Debug Settings DetautSession x Target Options i sample Command batch file load timing Jat target connection Command Line Batch
227. e differences in the initial values in some of the general registers between the MCU and the emulator as shown in table 7 4 Table 7 4 Initial Value Differences between MCU and Emulator Status Register E6000 Emulator MCU Power on PC Undefined Reset vector value initialized RO to R6 H 00 Undefined R7 SP H 10 Undefined CCR The mask is set to 1 and the The mask is set to 1 and the other bits are undefined other bits are undefined Reset command PC Reset vector value Reset vector value RO to R6 Undefined Undefined R7 SP H 10 Undefined CCR The mask is set to 1 and the The mask is set to 1 and the other bits are undefined other bits are undefined 7 4 1 A D Converter Due to the use of a user system interface cable there is a slight degradation in the A D resolution and above that quoted in the hardware manual for the MCU being emulated 410 RENESAS Section 8 Software Specifications Specific to This Product This section describes the software specifications of the H8 300 and 300L E6000 emulator 8 1 Software Specifications of the H8 300 and 300L E6000 Emulator Information specific to this emulator is given below 8 1 1 Target Hardware This emulator software conforms to the H8 300 and 300L E6000 emulator HS3008EPI60H HS3LO8EPI60H or HS3664EPI60H 8 1 2 Selectable Platforms The debugging platforms selectable in this emulator are listed below Table 8 1 Selectable Target Platforms Debugging
228. e execution of the sort function and confirm that random data is sorted in descending order 353 RENESAS 6 12 Stepping Through a Program The HEW provides a range of step menu commands that allow efficient program debugging Table 6 1 Step Option Menu Command Description Step In Executes each statement including statements within functions Step Over Executes a function call in a single step Step Out Steps out of a function and stops at the statement following the statement in the program that called the function Step Steps the specified times repeatedly at a specified rate 6 12 1 Executing the Step In Command The Step In command steps into the called function and stops at the first statement of the called function e To step through the sort function select Step In from the Debug menu or click the Step In button in the toolbar ie Figure 6 20 Step In Button 354 RENESAS 0x00002000 Ox00002006 Ox0000201c O0x00002026 Ox0000202c 0x00002032 0200002038 0x0000203e Ox00002044 Ox0000204a 0x00002050 0x00002056 0x00002060 0x00002068 0x00002070 0x00002072 0x00002076 0x00002078 0x0000207c 0x00002080 0x00002084 0x000020a4 0x000020a8 0x000020c0 0x000020cc Sample Sample sO0 0 s1 0 s2 0 s3 0 s4 0 s5 0 s6 0 s7 0 s8 0 s9 0 void Sample sort long a long t int i 3 K 9ap gap 5 while gap gt 0 for k 0 k lt gap
229. e line number at which the error is located To quickly locate a specific bug double click on a given error warning to invoke the current editor 2 6 6 Controlling the Content of the Output Window It is often useful to display extra information such as the command line options that are being applied to a file during a build The HEW allows you to specify whether or not you want such options displayed in the Output window during a build build all or build file operation via the Tools Options dialog gt To view or hide extra information during a build 1 Select Tools gt Options The Options dialog will be displayed 2 Select the Build tab figure 2 19 3 Set the three check boxes in the Show group as follows Command line controls whether the command line is shown as each tool is executed Environment controls whether the environment is shown as each tool is executed Initial directory controls whether the current directory is shown as each tool is executed 28 RENESAS Build Editor Workspace Confirmation Network m Errors and warnings J Stop build if the number of errors exceeds 0 J Stop build if the number of warnings exceeds 0 Show i IV Initial directory IV Environment IV Mark out of date files r Makefile build Command excluding parameters S HEWDIF hmake exe gt Browse I Use makefile buil
230. e popup menu The Trace Acquisition dialog box has the following pages Table 5 4 Trace Acquisition Dialog Box Pages Page Item General Sets trace acquisition conditions Stop Sets trace stop conditions without a delay Delayed Stop Sets trace stop conditions with a delay 1 to 4 Sets the range trace only available when the free trace mode is disabled 1 General page Sets trace acquisition conditions Trace Acquisition 2 x General Stop DelayedStop 1 2 3 4 m Suppress Time Stamp F I Free Trace m Clock F DIC Cycles Disabled x I Refresh Cycles Trace Events Event 10 R H 1092 address x Add Edit Sequence Delete Del All Cancel Figure 5 69 Trace Acquisition Dialog Box General Page 295 RENESAS Suppress Time Stamp Free Trace Trace Events Clock Acquires no trace information of the specified types of bus cycle Sets a condition for time stamping Select either from Disabled 125 ns 250 ns 500 ns 1 us 2 us 4 us 8 us 16 us or 100 us as the resolution for time stamping A time stamp has a 32 bit counter At 125 ns the maximum time that can be measured is about 9 minutes and at 100 us the maximum time is about 5 days When the counter overflows its content will be cleared to continue counting No time stamp information will be acquired when Disabled is select
231. e signal condition Probe4 to Probe1 Select probe conditions not available when Don t care has been checked Don t care Detects no selected probe condition High The status of the probe signal is high Low The status of the probe signal is low 310 RENESAS 8 IRQ7 0 page Select the status of IRQ signals The selection is not available when a time stamp is acquired Trace Filter xj General Address Data Rew Area Status Probes IRQ7 0 IRQ Dontcare Ings Dontcare z IRQS Don t care IRQ4 Don t care IRG3 Don t care IRG2 Don t care IRQ1 Don t care IRQO Dont care 7 ddd Figure 5 83 Trace Find Dialog Box IRQ7 0 Page Don t care Detects no IRQ input condition when this box is checked Setting Detects the specified IRQ input condition IRQ7 to IRQ0 Select IRQ input conditions not available when Don t care has been checked Don t care Detects no selected IRQ input condition High The status of the IRQ input is high Low The status of the IRQ input is low 311 RENESAS 9 Timestamp page Specify the time stamp value for bus cycles The specification is not available when a time stamp is acquired CM x General Address Data RAW Timestamp Setting Value Sy h iz min m us ns Cancel Apply Figure 5 84 Trace Find Dialog Box Timestamp Page Don t care Detects no time s
232. e stamp is acquired Status Selects the status of a bus not available when a time stamp is acquired Probes Selects the status of four probe signals not available when a time stamp is acquired Timestamp Specify the time stamp value for bus cycles only available when a time stamp is acquired 8 1 12 Trace Filtering Function While using the emulator the Trace Filter dialog box has the following pages Table 8 13 Trace Filter Dialog Box Pages Page Description General Selects the range for filtering Address Sets address conditions Data Sets data conditions R W Selects the type of access cycles Area Selects the area being accessed not available when a time stamp is not acquired Status Sets the status of a bus not available when a time stamp is not acquired Probes Selects the states of four probe signals not available when a time stamp is not acquired Timestamp Specifies the time stamp value for bus cycles only available when a time stamp is acquired 8 1 13 Performance Analysis Window For the H8 300 and H8 300L there are the performance analysis ranges for the following states which cannot be deleted H8 300 Standby DTU Sleep CPU Other Addresses H8 300L Standby Watch Medium Sub Sleep Sleep Sub Active CPU Other Addresses 423 RENESAS 8 2 Note on Usage of the H8 300 and 300L E6000 Emulator There is the following note o
233. e test program is initiated when the current directory is not lt Drive gt Diag HS3437EVI60H the test program will not operate correctly Notes 1 lt Drive gt is a drive name for the CD ROM drive 2 Do not remove the CD R from the CD ROM drive during test program execution 470 RENESAS The following messages are displayed during the test This example assumes that the HS3437EVI60H is in use Message Searching for interface card Checking emulator is connected E6000 H8 300 EMULATION BOARD Tests Vx x Emulator Board Information Main Board ID H 1 Emulation Board ID H 1 Revision H x Downloading firmware 01 02 03 Testing Register IDR Register wide ee sessed ee eaaaaasae OK BOC control register OK MODER register we eee eee eee eee eee OK Testing Dual Port RAM DECOde TESE ss sccsasasdergasgagamses OK Marching Test 4 224454545555455455 4 OK Testing Firmware RAM Decode Test page H 7xx of range H 700 H 71f Decode Test page range H 700 H 71f Marching Test page H 7xx of range H 700 H 71f Marching Test page range H 700 H 71f RENESAS Description Test program start message x x shows the version number Shows that the PC interface board is correctly installed in the host computer Shows that the E6000 is correctly connected to the host computer n hows the ID number of ct he lower board of the 6000 always 1 Bi
234. e their order in the menu User defined menu options do not appear on the version control toolbar gt To create a new version control menu option 1 pi Select Version Control gt Configure The dialog shown in figure 8 1 will be displayed 2 Click the Add button The dialog shown in figure 8 4 will be displayed 3 4 Commands are added to the menu option via the Add button See the section Defining Version Enter the name of the menu option into the Option field Control Commands later in this chapter for further information Close the Add Menu Option dialog by clicking OK Close the Version Control Setup dialog by clicking OK Add Menu Option Option MyOption Commands Modi K x Bemnove Move up iovagona Move down Figure 8 4 Add Menu Option Dialog 137 RENESAS gt To remove an existing version control menu option 1 Select Version Control gt Configure The dialog shown in figure 8 1 will be displayed 2 Select the menu option to be removed from the User menu options list and then click the Remove button 3 Close the Version Control Setup dialog by clicking OK gt To modify an existing version control menu option 1 Select Version Control gt Configure The dialog shown in figure 8 1 will be displayed 2 Select the menu option to be modified from the User menu options
235. e used as an external address area when the RAME bit of the SYSCR is cleared to 0 On Board or Emulator can be specified for this area with the Configuration settings 2 Ifthe reserved area other than that described in item above is used the operation in the actual MCU cannot be guaranteed If the user program extends to the reserved area during debugging select the MCU having the largest memory capacity for example debug the H8 3434 program in the H8 3437 mode Use of Internal RAM Area as External Memory The internal RAM area cannot be used as an external address area even when the RAME bit of the SYSCR is cleared to 0 e User Program Execution by the Go Reset Command When the user program is executed by the Go Reset command a reset signal is input for about 16 to 17 system clock 0 cycles to the evaluation chip from the emulator For the execution time measurement result the time for reset signal input is added e Boot Mode Emulation for MCUs Including Flash Memory For the MCUs including flash memory H8 3434F H8 3437F H8 3334YF H8 3337YF and H8 3394F the boot programming mode can be emulated in the following procedure 1 Setting Up the System Connect the user system to the emulator because data is transferred between the host computer and the emulation memory through the TXD1 and RXD1 in boot programming mode If boot programming mode emulation is started without the user system the evaluation chip cannot communicate wi
236. ea RAM 09063 09058 0905 Figure 6 57 Statistic Dialog Box Result of Analysis 7 Click the Close button to close the Statistic dialog box 8 Remove the event points that have been set and clear the trace information Clicking the right hand mouse button on the Event window displays a popup menu Select Delete All from this menu to remove all the event points that have been set Clicking the right hand mouse button on the Trace window displays a further popup menu Select Clear from this menu to clear the trace information 378 RENESAS 6 16 4 Function Calls This mechanism is used to only collect trace information on the function calls 1 Make the setting such that a break occurs at the address on the line that has p_sam gt sO a 0 within the tutorial function H 00001082 in this example for details on this refer to section 6 15 1 PC Break Function 2 Select Reset Go from the Debug menu Processing stops when the break condition is satisfied and the Trace window then displays trace information 3 Select Function Call from the popup menu displayed by clicking the right hand mouse button on the Trace window The Function Call Display dialog box will be displayed Function Call Display r Setting Enable to display trace information with function call only Enable Figure 6 58 Function Call Display Dialog Box 4 Click the Enab
237. ecseeeeeeeseeaeeesseeeeeeteees 393 7 3 5 User System Interface Circuits of the H8 3334 Group Evaluation Chip HS3334EVI60H ue eee eens ceeeececeeeeeeceeeesseseeeeeeeee 395 7 3 6 User System Interface Circuits of the H8 3257 H8 325 Group Evaluation Chip HS3257EVIO60H seseseseseseseresessesesosesesesoseroseseseveseveveveserererers 397 7 3 7 User System Interface Circuits of the H8 3437 H8 3337Y H8 3297 Group Evaluation Chip HS3437EVIG60H uu eee eeeeeeeeeeeeeeeeeeeeeesaseesseeeseeteees 399 7 3 8 User System Interface Circuits of the H8 3217 H8 3318 Group Evaluation Chip HS3318EVIGOH cceccecceseeseeseceeceeeeeeeseeseceeeeceeceaeeaseeeeees 401 7 3 9 User System Interface Circuits of the H8 3834 H8 3814 Group Evaluation Chip HS3834EVIGOH cceccecceseeseeseeeeceeeeeeeseeseceeeeceeeeseeseeeeaees 403 7 3 10 User System Interface Circuits of the H8 3637 H8 3877 Group Evaluation Chip HS3876EVI60H uu eee eee eeeeeceeeeceeceeeeteseeaseetseeeeeeteees 405 7 3 11 User System Interface Circuits of the H8 3927 Group Evaluation Chip HS3927EVIG60H eeeseseseresesesesessssoresesesosesesrseseseseseseveverererers 407 xi 7 3 12 User System Interface Circuits of the H8 3644 H8 3657 Group E6000 Emulator HS3644EPI60H ccc eee cess ee eeeeecaetecsesaeeeeseseeeeeaee 409 74 Differences between MCU and Emulator eee cece eeeeseeesseeeeescseseeseeseeeeaees 410 TAMe AMD CONVCMEL veces ssecdsocsesassccunstessouesucteave
238. ect information xj Project information Displaying project information Finish Figure 5 19 Project information Dialog 110 RENESAS These can then be exported from the HEW system and be given to other users you need to use your project gt To export a custom project generator to another user 1 Click on Tools gt Administration 2 Check the Show all components checkbox 3 Expand the Project Generators Custom folder 4 Select the custom project generator you wish to export 5 Click the Export button Tools Administration 2 x Registered components Component F Toolchains Cancel System Tools Utility Phases Register Debugger Components Extension Components Communication Tools System Extension Components Project Generators 3 8 Project Generators Custom i CurrentProjectName E Version Control System Toolchain Support E Definition Parser Unregister Properties Expott Search disk Tool information al gt Uninstaller V Show all components Current HEW tools database location DHe Modify e APEERE k Figure 5 20 Tool Administration Dialog 6 You should enter export directory for custom project generator and click Export button HEW creates some files When another HEW uses its project it needs a
239. ects tab of the workspace window 2 Right click and then select Modify folder name 3 Enter the new name in the dialog 4 Click OK 38 RENESAS 3 Advanced Build Features This chapter explains the advanced build concepts 3 1 The Build Process Revisited Chapter 2 Build Basics began by describing the build process in terms of a compiler an assembler and a linker figure 2 1 This will be the case for most installations of the High performance Embedded Workshop However if you want to begin changing the build process e g adding and removing phases then it is important to understand more about the way in which a build functions 3 1 1 What is a Build Building a project means applying a set of tools upon certain input files in order to produce the desired output Thus we apply a compiler upon C C source files in order to create object files we apply an assembler upon assembler source files in order to create object files and so forth At each step or phase of the build we apply a different tool upon a different set of input files Figure 3 1 presents another view of the build process Eas BEGIN a gt PHASE gt P Phase 1 Input Files Phase 1 Output Files PHASE 2 gt Phase 2 Input Files Phase 2 Output Files N PHASE 3 gt Phase 3 Input Files Phase 3 Output Files q PHASE X gt
240. ecution the display is updated according to the setting value of the auto update interval Note Select Refresh from the popup menu when data is not displayed correctly after changing the address or content of memory 5 9 2 Changing the Monitor Settings Selecting Monitor Setting from the popup menu of the Monitor window displays the Monitor Setting dialog box which allows the settings to be changed Colors the size of accesses and the display format can be easily changed from Color or Access of the popup menu 5 9 3 Temporarily Stopping Update of the Monitor During user program execution the display of the Monitor window is automatically updated according to the auto update interval Select Lock Refresh from the popup menu of the Monitor window to stop the update of display The characters in the address section are displayed in black and the update of display is stopped Selecting Lock Refresh again from the popup menu cancels the stopped state 5 9 4 Deleting the Monitor Settings Selecting Close from the popup menu of the Monitor window to be deleted closes the Monitor window and deletes the monitor settings 5 9 5 Monitoring Variables Using the Watch window refers to the value of any variables When the address of the variable registered in the Watch window exists within the monitoring range that has been set by the Monitor function the value of the variable can be updated and displayed Th
241. ecution of the user program select Restart from the popup menu 313 RENESAS 5 16 12 Extracting Records from the Acquired Information Use the filtering function to extract the records you need from the acquired trace information The filtering function allows the trace information acquired by hardware to be filtered by software Unlike the settings made in the Trace Acquisition dialog box for acquiring trace information by conditions changing the settings for filtering several times to filter the acquired trace information allows easy extraction of necessary information which is useful for analysis of data The content of the trace buffer will not be changed even when the filtering function is used Acquiring useful information as much as possible by the Trace Acquisition settings improves the efficiency in analysis of data because the capacity of the trace buffer is limited Use the filtering function in the Trace Filter dialog box To open the Trace Filter dialog box select Filter from the popup menu The Trace Filter dialog box has the following pages Table 5 6 Trace Filter Dialog Box Pages Page Description General Selects the range for filtering Address Sets address conditions Data Sets data conditions R W Selects the type of access cycles Area Selects the area being accessed not available when a time stamp is acquired Status Sets the status of a bus not available
242. ed Checking this box enables the free trace mode When the free trace mode is enabled Starts acquiring the data immediately after program execution has been started Only the trace halt condition is available The range trace is unavailable and four range trace pages 1 to 4 become disabled When the free trace mode is disabled Sets the start and halt conditions of trace acquisition Event Add Edit Sequence Delete Del All Sets event points to be used as trace acquisition conditions Lists the event points to be used as trace acquisition conditions Adds a new event point Changes the setting for the selected event point Configures an event sequence for the event point being used as a trace acquisition condition To set up the sequence an event must have been set Deletes the selected event point Deletes all event points Notes 1 The bus cycles that can be specified by the Suppress option vary according to the emulator in use For details refer to section 5 15 4 Signals to Indicate Bus States and Areas 296 The trace buffer is used for the time stamp information and some of the trace information Therefore when the time stamp is acquired it is impossible to acquire the trace information other than PTR Address Instruction Data R W Source Label Timestamp and Timestamp Difference If an event that is used for the range trace or trace stop function is deleted that funct
243. een made 47 RENESAS Modify MyPhase PATH c dos c Stools SHOWALL FALSE ENV 1024 Figure 3 8 Modify Phase Dialog Environment Tab 48 RENESAS 3 3 2 Build File Phase Order If you were to select a C source file from the Workspace window and then activate Build gt Build File or press B2 you would expect the file to be compiled Likewise if you were to select an assembly source file from the workspace window and then activate Build gt Build File you would expect the file to be assembled The connection between file group and which phase s to execute is managed by the Build File Order tab of the Build Phases dialog figure 3 9 Build Phases 27 xi Build Order Build File Order File Mappings File group Phase order Compiler V MyPhase C source file Figure 3 9 Build Phases Dialog Build File Order Tab The list displays all of the current phases that will be executed when the build file operation is selected upon the file group shown in the File group list box In figure 3 9 the C source file file group is selected and the Compiler and MyPhase phases are associated with it Entries in the Phase order list of the Build File Order tab are added automatically as new entries are added to the Build Order tab For example if you were to add a phase which takes C source files as input then this phase will be aut
244. eeserstseesisrstssesrsesreteresresesrssrens 219 5 1 1 Opening the Configuration Properties Dialog Box eects 219 5 1 2 Selecting an MCU Not Included in the List eee eee ceeeeeeeeeeeeeee 221 5 1 3 Selecting the Interface to be Connected oo ccc eect eeeeeeee sete eeetaeeeeeeaee 222 5 1 4 Opening the Memory Mapping Dialog Box eee eeeeeeeceeneeeenee 223 5 1 5 Changing the Memory Map Setting ec cece cece eereeteesetaeeeeeeeeeseeanes 224 Downloading a Program 3 ciss cascccssevectavscecsesssweceve vaeu svonson E ea Eea save slasdsey AE NOAN ESPERES 225 ILF Downloading a Protasio onien ona a INE E EE E NOT 225 52 2 Viewing the SOULCE CODE scccsvevisecsiesssacsacsssassestsssenestbaseneesgaeisessiecvsedonssnsndsesseeddes 226 5 2 3 Viewing the Assembly Language Code n s sssssssesesestsesssersssseseresrreresesesesreest 229 5 2 4 Modifying the Assembly Language Code esssssssesssesssesssststssresrrtseresrrssreese 229 5 2 5 Viewing a Specific Address eee eeseeeeseseceeeseseeecsesecsetaseeesesaseeeaeeesenease 230 5 2 6 Viewing the Current Program Counter Address c cece eseeeeeteeeeeeeees 230 Debugging with the Command Line Interface 0 o eee ec eeee eee eeeeseeeeeeeteeeeeeaes 231 5 3 1 Opening the Command Line Window eee eeeeteceeeeeteeeeeeeeeeeeaee 231 5 3 2 Specifying a Command File eee cece ceceeesececeeeseteseeeseeessseeeeesseteeeeeaes 231 5 3 3 Executing a Commmand Fil sci cssccsssssccessescoaeseoset
245. elected then a separate folder contains all dependencies figure 2 21 1 Workspace EER E E Demo E E Demo B amp B amp B Assembly source file B Assembly source file E lowlvl ste E lowlvisre Gg C source file Sa C source file 2 dbsct c E dbset c Demo c Demo c E intprg c 2 intprg c 2 lowsrc c B vecth resetprg c 2 E lowsre c 2 sbrk c E lowsre h E vecttblc E resetprac Dependencies stackscth E lowsre h E X sbrk c E sbik h E sbrk h stackscth E E vecttble vecth B vecth rice niet tn Figure 2 21 Dependencies under Each File 31 RENESAS 2 8 2 Show Standard Library Includes By default any dependent files found in standard include paths will not be shown figure 2 22 1 For example in C code if you write an include statement such as include lt stdio h gt then stdio h will not be listed as a dependent file To view such system include files select the Show standard library includes option figure 2 22 ii Devoe BEER Bevo BRIED 3 6 Assembly source file Assembly source file cO ste 2 cO ste 3 C source file C source file E hwefg c E hweta c 2 intv c inty c main c main c 2 sbrk c 4 sbrk c Dependencies ependencies stddef h stdio h Projects lt I Navigation ZB Projects lt I Navigat
246. election If you press 175 RENESAS return then the currently selected member will be added This pop up is also used when using the method and it is displayed in figure 14 2 If you are trying to use a C function then the dialog in Figure 14 3 is displayed when the first open bracket is entered This dialog allows you to see what functions are available for the current object Selecting the function automatically enters the remaining parameters for you include greatwhite h void main void void main void CGreatWhite cJaws cJaws m_n Hm_nDangerous Bm_nFins m_nJaws m_nlegs m_niveinWater Bm_nlives m_nSea Figure 14 2 Smart edit member selection include greatwhite h void main void void main void CGreatWhite myfish myfish FeedTheShark int FeedTheShark CFish myFishyFood int FeedTheShark CHorse myHorseyFood int FeedTheShark CPerson myPersonFood int FeedTheShark char pszOtherType Figure 14 3 Smart edit function selection 176 RENESAS Note Smart edit auto completion may not pop up for a variety of reasons HEW can only provide help when the file has been scanned by the navigation component For this to work the file must have been saved Another issue is that defines are not considered so this means that redundant areas of code may still be visible Another important consideration is if the syntax of your code is incorrect the smart edi
247. eleted This range varies depending on the emulator in use For details refer to section 8 Software Specifications Specific to This Product or the online help It is possible to hide any column not necessary in the Performance Analysis window Selecting a column you want to hide from the popup menu displayed by clicking the right hand mouse button on the header column hides that column To display the hidden column select the column from the said popup menu again 336 RENESAS 5 20 2 Setting Conditions for Measurement Conditions for measurement can be displayed and changed in the Performance Analysis window Select a point where a condition is to be set and then select Set from the popup menu to display the Add PA Range dialog box The Performance Analysis window has a support function to enter the address range of a function automatically if the name of the function is entered to set an address range Entering a function name in the Input Function Range dialog box displayed by clicking the button on the Add PA Range dialog box automatically enters the address range of the function Input Function Range Function S ample Cancel Figure 5 107 Input Function Range Window Notes 1 Entering the name of an overload function or a class opens the Select Function dialog box Select a function in this dialog box For details on the dialog box refer to section 5 13 3 Supporting Duplicate Labels
248. em Interface Circuit for OSC1 and X1 PB0 ANO to PB7 AN7 and PC0 DAO to PC3 DA3 Evaluation o User system chip 470 interface cable Figure 7 70 User System Interface Circuit for PB0 ANO to PB7 AN7 and PC0 DAO to PC3 DA3 AVcc and AVss Evaluation chip User system 27kQ_ interface cable Figure 7 71 User System Interface Circuit for AVcc and AVss P40 to P47 Evaluation User system chip interface cable Figure 7 72 User System Interface Circuit for P40 to P47 408 RENESAS 7 3 12 User System Interface Circuits of the H8 3644 H8 3657 Group E6000 Emulator HS3644EPI60H All signals are directly connected to the evaluation chip in the emulator with no buffering except for those listed below e RESET e OSCI e XI e TEST The circuits that interface the evaluation chip in the emulator to the user system include pull up resistors that cause signal delays Note that when an input terminal is in the high impedance state the pull up resistor forces the terminal to be at a high level Adjust the user system hardware to compensate for these effects The delay caused by the user system interface cable is about 8 ns The following diagrams show the user interface signal circuits Default o User system 47 Q interface cable Figure 7 73 Default User System Interface Circuit RESET and TEST These signals are input to the evaluation chip via HD151015 Therefore the rising falling must
249. ember with pointer C Specifies reference of a global variable C C Specifies a member function C Specifies cast operation C C 267 RENESAS 5 13 3 Supporting Duplicate Labels In some languages for example C overloaded functions a label may represent more than one address When such a label name is entered in a dialog box the HEW will display the Select Function dialog box to display overloaded functions and member functions Function 2 xi Select Function Name Set Function Name Sanple sot ona shat i mE Counter All Function Select Function Set Function E Functions E Functions fo Functions Cancel Figure 5 47 Select Function Dialog Box Select overloaded functions or member functions in the Select Function dialog box Generally one function can be selected at one time only for setting breakpoints multiple functions can be selected This dialog box has three areas Select Function Name Displays the same name functions or member functions and their detailed information Set Function Name Displays the function to be set and their detailed information Counter All Function Displays the number of same name functions or member functions Select Function Displays the number of functions displayed in the Select Function Name list box Set Function Displays the number of functions displayed in the Set Function Name list box Selecting a Function
250. en set Click the right hand mouse button on the Trace window to display a further popup menu Select Clear from this menu to clear the trace information 371 RENESAS 6 16 2 Displaying a Trace when Time Stamping is Available The following procedure is for obtaining and displaying with time stamps trace information on cycles of writing to memory locations in the specified address range 1 Clicking the right hand mouse button on the Trace window displays a popup menu Select Acquisition from this menu to display the Trace Acquisition dialog box see figure 6 41 Trace Acquisition dialog box 2 Register the address range for trace acquisition as an event condition Click the Add button in the Trace Events group box on the General page to display the Breakpoint Event Properties dialog box see figure 6 42 Breakpoint Event Properties dialog box 3 Click the Range radio button in the Address group box on the General page of the Breakpoint Event Properties dialog box Use the Locals window to refer to the address on the line where variable a which is defined within the tutorial function is allocated H OOFFEF80 in this example and enter this address in the Address Lo edit box Then enter an address which is H 27 added to that entered in the Address Lo edit box H OOF FEFA7 in this example in the Address Hi edit box This procedure sets the memory range for variable a of the tutorial f
251. en you save the file you can specify your own filename Ta 7 Open File Click this button if you want to open a file It invokes a standard file chooser select the file which you want to open and then click Open 70 RENESAS i Save File Saves the active source file a Save All Files Saves all of the files in the editor amp Print File To print the contents of the current window click this button ES Cut Clicking this button will remove the current text selection and place a copy of it onto the Windows clipboard it can be pasted back to a file with a paste operation Copy This button allows you to copy the current text selection into the Windows clipboard Paste The paste button copies the contents of the clipboard into the active window at the position of the insertion cursor Match Braces The match braces button highlights text between braces of type and This is particularly useful when attempting to find out the structure of C C code blocks which are opened with and closed with To use it select the open brace to match from or place the cursor before it and then click this button For further information on brace matching refer to the Brace Matching section later in this chapter TT Insert Template To insert a pre defined template at the current cursor position click this toolbar button The Insert Template dialog box will be invoked Select a template n
252. ent Session Launeh Slave Hew View Workspace Build File Stop Launch Debugger View Output i 2 Haa zil dze ca gt Figure 1 8 Standard Toolbar Template Selection Define Template Insert Template all a T Templated T Figure 1 9 Templates Toolbar Add File s Check Out File s Remove File s Check h File s as File s HEA Status Se F A Figure 1 10 Version Control Toolbar Ignore white space Compare files Find next Find previous Find previous difference Find next difference HMMA A FS Figure 1 11 Difference Toolbar ne E Figure 1 12 Map Toolbar RENESAS When the Standard toolbar or a toolbar is docked it has a control bar as shown in figure 1 13 i If you want to move the docked Standard toolbar click and drag its control bar to the new location Figure 1 13 i shows the Standard toolbar when it is docked and figure 1 13 ii shows the Standard toolbar when it is floating e Debus Debus Ae OA x Standard i 2 Debus z oebus J A ge fra Al Figure 1 13 Standard Toolbar Docked and Floating gt To dock a toolbar 1 Double click on the title bar of a floating toolbar or 2 Drag the title bar of a floating toolbar and draw it toward an edge of a docked window menu bar toolbar or the HEW main frame on whose edge you would like to dock the window until the shape of the floating bar
253. er login Version control PASSWORD User password Version control VCDIR Virtual version control directory COMMENT Comment Version control LINE Line number of an error warning RENESAS 445 For example the placeholders will be expanded as shown in table C 2 Table C 2 Placeholder Expansions Example Placeholder Expanded placeholder example FULLFILE c new workspace project file src FILEDIR c new workspace project FILENAME file src FILELEAF file EXTENSION src WORKSPDIR c new workspace WORKSPNAME workspace PROUJDIR c new workspace project PROJECTNAME project CONFIGDIR c new workspace project debug CONFIGNAME debug HEWDIR c hew TCINSTALL c new toolchains hitachi sh 51 1 TOOLDIR c new toolchains hitachi sh 51 1 TEMPDIR c Temp WINDIR c Windows WINSYSDIR c Windows System EXEDIR v ve win32 USERNAME JHARK PASSWORD 214436 VCDIR c project is mapped to x vc project COMMENT Please Enter Comment dialog is invoked LINE 12 In table C 2 we are assuming that a file path is c hew workspace project file src a workspace named workspace is located at c hew workspace a project named project is located at
254. er options are invalid Event Set conditions in detail with other options on this page or on the Bus Area Signals or Action page Address Sets the address condition Don t care Sets no address condition Address Allows a single address to be selected Range Allows an address range to be selected Adderess Lo Set a single address or the start of an address range available when Address or Range has been selected Adderess Hi Set the end of an address range available when Range has been selected Outside Range Used to negate the range i e the event will occur when the address is outside the range This is available when Address or Range has been selected 284 RENESAS Data Compare Sets the data condition Compare Checking this box compares data Use Mask Sets a mask condition available when Compare has been selected Value Specifies the data bus value as numerics The size of data for access can also be selected available when Compare has been selected Byte Sets access in bytes as the condition available when Compare has been selected Word Sets access in words as the condition available when Compare has been selected Mask Sets a value to be masked This value will be ANDed with the value of the data bus and data condition The result will be used to compare data available when Use Mask has been selected Direction Selects a conditio
255. eral Page Don t care other pages Only selects the cycle number when this box is checked Other options become invalid Enable Filter Enables the filter when this box is checked No Filters information that does not match the conditions set in those pages when this box is checked Trace display range Sets the range for filtering Start PTR Enters a PTR value to start filtering End PTR Enters a PTR value to end filtering Note Along with setting the range for filtering PTR values to start and end filtering can be set in the Start PTR and End PTR options respectively 315 RENESAS 2 Address page Set address conditions Status Probes IRQ 0 General Address l Data RAW Area T Don t care Setting Point Range From F Figure 5 86 Trace Filter Dialog Box Address Page Don t care Detects no address when this box is checked Setting Detects the specified address Point Specifies a single address not available when Don t care has been checked Range Specifies an address range not available when Don t care has been checked From Enter a single address or the start of the address range not available when Don t care has been checked To Enter a single address or the end of the address range only available when Range has been selected Note Along with setting the address range the start and end of the address r
256. ered will be added to the tools menu when a new project is created Sometimes this may not be desirable If so open the Tools Administration dialog select the component from the Registered components list and then click the Unregister button A dialog will be invoked which asks you to confirm this action Click Yes to confirm the action Note Unregistering a component does not remove its installation from hard disk It simply removes the information which the HEW was storing about that component i e it disconnects it from the HEW The action can be easily reversed at anytime by registering the tool see above If you want to remove a component from the hard disk i e uninstall a component then refer to the section Uninstalling Components later in this chapter 98 RENESAS 5 5 Viewing and Editing Component Properties To view information regarding a component select it from the Registered components list and then click the Properties button The properties dialog will be displayed with the General tab selected figure 5 4 This tab displays the name version and location of the selected component None of the information on this tab is editable SuperH RISC engine Standard Toolchain 8 0 1 0 Properties General Information Environment Name SuperH RISC engine Standard Toolchain Version 8 0 1 0 Location D Hew3 Tools Renesas Sh 8_0_1 Cancel Figure 5 4 Propertie
257. erent version is installed the following message box will be displayed High performance Embedded Workshop j o xj Tutorial A Tool Chain Hitachi H85 H8 300 Standard Toolchain version xx xx is missing From the Following project s there is no compatible toolchain available Figure 2 13 Message Box 6 The E6000 Driver Details dialog box is displayed This dialog box is only displayed at the first initiation When only one of interface drivers is selected this dialog box is not displayed E6000 Driver Details Driver Emulator PCI Card Driver 7 m Details Interface PCI be Channel Emulator PCI Card Interface ul Gontieuration Configure Change driver in start up Figure 2 14 E6000 Driver Details Dialog Box e In the Driver combo box select the driver to connect the emulator e Interface displays the name of the interface to be connected e Click the Close button 191 RENESAS 7 Set up the emulator During this process the following dialog box is displayed Attempting to connect the emulator The driver program has been initialized Emulator PCI Card Driver Starting to transfer a firmware file J Change driver in start up Figure 2 15 Connecting Dialog Box 8 When Connected is displayed in the Output window of the HEW the emulator initiation is completed lol x 18 x ste
258. erformance Embedded Workshop editor allows you to include special characters in search strings when performing a find or replace operation These characters are listed in table B 1 and are detailed in the following pages Table B 1 Regular Expression Characters Character Meaning Matches one or more occurrences of the preceding item except in a bracket expression For example a matches a aa aaa and so on Matches zero or more occurrences of the preceding item except in a bracket expression For example a matches the empty string a aa and so on Matches zero or one occurrence s of the preceding item except in a bracket expression For example a matches the empty string and a and Specify a cardinality range formed as follows m n This construct matches between m and n occurrences of the preceding item For example a 2 3 matches aa and aaa This construct can also be formed using m and m The first matches m or more occurrences of the preceding item For example a 2 matches aa aaa aaaa and so on The second matches exactly m occurrences of the preceding item For example a 2 matches aa and Create a bracket expression Bracket expressions create a set of items any of which may be matched For example abc matches a or b or c Within a bracket expression all regular expression special characters are treated as normal non special characters except specifies
259. ersreesssesreest 335 Analyzing Performance cc c rscisssivesssnsvnseestsvesuessavenacstoaevaeteeteoseteeteseetevteseadondensndevserslieventes 336 5 20 1 Opening the Performance Analysis WindowW s ssssssesesessreseseseesrsesesssrsrsrens 336 5 20 2 Setting Conditions for Measurement eee eee ese eeeeeeeeseteeeeseteeeeeaes 337 5 20 3 Starting Performance Data Acquisition cece eee eeeeeeeeseeeeeeteeeeeeees 337 5 20 4 Deleting a Measurement Condition cece eeeeceeeeeeeceeeeeeteeeeeseeeeeeeaees 337 5 20 5 Deleting All Measurement Conditions cece cece ce ceeeeseeeeeeseeeeneteeeeeaes 337 6 3 Downloading the Tutorial Program cece cece ceeeeeecseeesaeteeeetaeeecsesaeeesseeeeseeaees 341 6 3 1 Downloading the Tutorial Program ieee eee eee cece cseceeeeeeseeeetseeeseteeeeeaes 341 6 3 2 Displaying the Source Program ece cece eee cece ceceeeeeseceeeeeeeeeseeeeeeseteeeeeaes 342 X 6 4 Setting a PC Breakpoint ccss sccrissecossowsstesesesscedverseaescszesteosdonsecstveveweondecsntocgsstvescgstodeecsedesevtss 343 E AE VeA REGISSTS A chsskesbonssuestasesdesaansdeeideseosueesens 344 66 Executing the Program cc csss ccesesssrceossesesnevvancecoaresecasnasnssevneatsteonearsieosnatedensinegdebpencsresdsacsces 345 6 7 REVIEWINE Break POS ren niade AE EET e EENE 347 6S Referring TO SVMDOIS oeieo ane a a A beavers EAO tae Aiei 348 69 Viewine MOMOLY seesecscsvesss asvssnsisesensecoieeseccons iiie EEaren NEE E AER 349 6 10 Watching V
260. es m Trace Events Event 9 R H FFEF80 range to H FFEFA write Add Edit Delete Del All Sequence Cancel Figure 6 51 Trace Acquisition Dialog Box Time Stamping is Available 373 RENESAS 7 To enable the event condition that has been set uncheck the Free Trace check box on the General page This will add pages 1 to 4 see figure 6 45 Trace Acquisition dialog box 8 Select page 1 and click the Range radio button in the Conditions group box This will display the Range Event combo box and the Edit button see figure 6 46 Trace Acquisition dialog box 9 Click the Range Event combo box to select the event you have registered The event is now enabled Click the OK button to complete the trace setting General Stop Delayed Stop 1 2 3 4 r Conditions C Disabled Point to Point Range C Event Range Event Figure 6 52 Trace Acquisition Dialog Box Setting Completed 10 Make the setting such that the break occurs after the instruction at the address on the line that has p_sam gt s0 a 0 within the tutorial function H 00001082 in this example for details on this refer to section 6 15 1 PC Break Function 11 Select Reset Go from the Debug menu Processing stops when the break condition is satisfied and the Trace window then displays the following content Fe
261. esdedsseekete 2 WDB Whe TOOMDAIS E E A E 3 1 2 4 The Workspace Window c ccc cess ceceesecsesessceeesecaeseessseesscasseeaseesseeaneee 5 1 2 5 The Editor WindOW c ssesncoossennccosseneceosponcconsentseonesnaseoneavsteonessssentsecscennetesceanenesioe 7 12256 The Output Window enirir oine e E TA OR a 8 ELT aS Status Ban rerai eean EEE EE r Erk 9 1 3 The Help System 1 4 Launching the HEW 13 ExT GS FE W essorer iets siriana ensen a enaena nEaN I ONENE ENEE ENEE EENE ETERS 1 6 Component System OvervieWissisoririrosiessiisiiie tinitir iiniiieerie itis edn EE Kraini a eA 10 2 Utd Basics snnisanaenenpn nanna a 11 DA Whe Build Process x isesseszinsvcocxssises ctessoucatinssnesteecduesteastessteastesidiassenssacsensebsesarechscteseedtosveacdies 11 AP PROJECK I EA A OA TE E 12 2 2 1 Adding Filestoa Projects is ccccsisccccsseiesscsssiesesesedoncstssievctonsesestossssestsnssceseecstbens cess 13 2 2 2 Removing Files from a Project cscescsececeeeeeceeseeeeeeeeeceeeeeeeaeeseeeeeeseeseaeeaeeaeens 15 2 2 3 Excluding a Project File from Build ec ceececesceneeeeeeeeeseeeeeeeanees 16 2 2 4 Including a Project File in Build re 23 File Extensions and File Groupsvisj cccicssvescicovvesesessasceastnsreiccssascscssesseeonscssysossondeeosyeseess 2 4 Specifying How to Build a File ccc eeesccsscesseseesecseeeeceseesecseeeceeceaceeesaeeseseeeeseeseaeeaees 23 Build Configurations ssnaye onen rE ass ris rN i ETE eie da Teaia ranae 2
262. et s imagine that a version control executable has been selected which uses a GET command to obtain a read only copy of a file In order to get all of the files in a project we need to use the following command GET VCDIR FILENAME When the HEW executes the command for a given project file it will replace VCDIR for the equivalent version control directory in the file mapping For example suppose FILE1 C is located at c work application project1l filel c If the get command is applied to FILE1 C then 1 x vc sw app project1 is substituted for VCDIR as this is the version control directory mapping for c work application project1 2 FILE1 C is substituted for FILENAME 143 RENESAS Project File C work application projectl filel c Arguments VCDIR FILENAME 1 2 Command X vc sw app projectl filel c Figure 8 10 Example of Substitution 8 3 2 Specifying Environment Select the Projects tab of the Version Control Setup dialog to view the current settings figure 8 7 To add a new environment variable click the Add button beside the Environment list the dialog shown in Figure will be invoked Enter the variable name into the Variable field the variable s value into the Value field and then click OK to add the new variable to the Environment list Environment Variab
263. et to off then the HEW will store all output which is being displayed by the tool and display it in the output window when the tool has finished its operation This can be a problem when the tool is running an operation that might take many minutes as it is difficult to see the progress of the current execution Note Using Read Output On Fly can cause problems when using certain tools on certain operating systems If you are having problems with tools locking up or freezing in HEW then uncheck the Read Output On Fly option Click the Finish button to create the new phase By default the new phase is added to the bottom of the Build Phase Order list in the Build Order tab of the Build Phases dialog Figure 3 2 44 RENESAS 3 3 Ordering Build Phases In a standard build shown in figure 3 5 you could add a phase at four different positions before the compiler before the assembler before the linker or after the linker You may place your own custom phases or move system phases to any position in the build order It is important to remember that if the output of your custom phase can be input into another phase then the phase order must be correct if the build is to behave as intended COMPILE ASSEMBLE LINK lt 0 Figure 3 5 Typical Build Process The build phase dialog provides facilities for ordering build phases via the Build Phases dialog It has
264. ew components installed since the last time it was invoked However in some circumstances you may need to register components yourself 5 3 1 Searching Drives for Components In some cases it is useful to search a drive for HEW compatible components This is especially useful if the HEW installation was deleted or corrupted as it can recreate your tool information instantly gt To search for components 1 Click the Search Disk button on the Tools Administration dialog figure 5 1 The Search Disk for Components dialog will be displayed figure 5 3 Search Disk for Components Cl Select the directory in which to begin the search Hers D H ew3 Browse IV Include subfolders Located components Register ih BF Component Version HRF Location lt Generic TCL Toolkit View EC 1 0 D Hew3 Syster HewT argetS erver 1 0 D Hew3 Systerr Register All SuperH RISC engine Standard Toolchain 8 0 1 0 D Hew3 Tools I Mapview 1 0 D Hew3 Tools H Series Librarian Interface Tl D Hew3 T ools I H8S H8 300 Standard Toolchain 6 0 1 0 D Hew3 Tools Call Walker D Hew3 T ools w gt Search Status 51 file s found Figure 5 3 Search Disk for Components Dialog 2 Enter the directory in which you would like to search into the top field or browse to it graphically by clicking the Browse button 3 Check the Include subfolders check box if you would
265. ew file 5 Clicking the advanced button displays the dialog in figure 11 3 This allows you to perform the difference comparison without taking white space into account Click OK when you are finished with this options dialog 6 Click Compare 7 The difference view is displayed as shown in figure 11 1 Compare files E x Reference file _ Compare KSH EW20 HEW 3 0 EXE Win Release Browse Cancel C Compare with file on drive aa 7 vanced Target file 7 Browse Figure 11 2 Difference compare files dialog Compare Files Advanced Options xj Advanced Mij S Cancel Figure 11 3 Difference advanced options dialog The difference view functionality can be accessed in two different ways The difference view has its own toolbar this is shown in figure 11 4 This functionality can also be accessed via the difference window right mouse button pop up This is shown in figure 11 5 Ignore white space Compare files Find next Find previous Find previous difference Find next difference m A eA TL Figure 11 4 Difference toolbar 164 RENESAS PE Compare Export results to file a Ignore whitespace h Find fa Find previous amp Find next T Previous difference Next difference Refresh comparison Figure 11 5 Difference popup menu The functionality for each menu item is described below e Comp
266. f a Biles iiisississsccesssisecsvessscesanscscssectoesesaniistseansvcessonactacseasenss 155 92 7 Viewing the History ofa Piles csccc sscasccssssatcesoossaseserssacessed saccovedsatesnennccsonsenacseasatis 155 9 3 Visual SourceSafe Integration Options 0 cece eee cseeseeeceeeeeteeseeaeteceesseseeeeaneetaees 155 10 Network Facilities cove ccciesnccsntestansedvovencveededeeodecetegesvnsteneroaceonsseavineds 157 IOT OVETVIEW s w sccsctesncsacecsnonccerstcnscconestcseonsdeaidensavctensndegserdenestenperesceustsccenssoetearbaiscinadseadcerdtenes 157 10 1 1 Enabling network access 158 10 1 2 Setting the administrator user s password sssesssessssessssssisissstesreeereseeessresrees 158 10 1 3 Adding new users to the system 160 10 1 4 Changing your password cc cess eeescsseecseceseeesecessseaeessseeesesseseeseeasseeages 161 10 1 5 Using the network HEW Service eee ecceeee eens cnecseeseseeeesessceesssseeecseeeeeees 161 11 Difference VIC W sesevecsectccestevsces a oes sca sc en ssiaes E NAA 163 12 Technical Support asierea iniaa anA 167 13 Navig tion facilities sisenceini noieira oisinn 169 13 1 C Navigation component eseseseeeseessseseseseseserrsrerererereueueuestsestsrersrerurereretsrerseeesereseene 171 13 2 C Function and defines navigation components ssesssessssssssssssisisrsrsrsrstsrsrsrsrsesrsssne 174 14 Smart EJOT cnius iiris eenieder aTa a aE 175 Emulator Debugger Part 1 1 1 2
267. folder or combination thereof 2 Select the Tools gt Version Control gt Show History menu option 9 3 Visual SourceSafe Integration Options You can control the way in which the history and status commands are displayed by selecting Tools gt Version Control gt Configure To display the results of a history command in a dialog box then check the Display dialog box for history check box or clear it if you would rather display the output in the Version Control tab of the Output window To display the results of a status command in a dialog box then check the Display dialog box for file status check box or clear it if you would rather display the output in the Version Control tab of the Output window 155 RENESAS 156 RENESAS 10 Network Facilities 10 1 Overview The High performance Embedded Workshop is capable of sharing workspaces and projects across a network This allows users to concurrently work on shared projects and see each other s changes as they happen This system can be used in conjunction with version control The major difference with using this system is that each user can modify and update the workspace and project without making all of the other users reload their project and potentially lose all their changes This system is implemented by making one of the machines attached to the network the server machine All other client machines then use the service this machine is prov
268. following directory HEW installation destination directory Tools Renesas DebugComp Platform E6000 2633 Tutorial Note The file path differs depending on the product Refer to section 8 2 1 Environment for Execution of the Tutorial Program Then select the file indicated below Open Works Look in S Tuoi ss e HK ED Debug_H85_2237_E6000_Emulator_CP Source File name Tutorial hws Files of type Workspaces hws 7 Cancel 4 Figure 6 1 Open Workspace Dialog Box Opening this workspace automatically connects the emulator 340 RENESAS 6 3 Downloading the Tutorial Program 6 3 1 Downloading the Tutorial Program Download the object program to be debugged e Select Download module from the popupmenu opened by clicking the right hand mouse button on Tutorial abs of Download modules Tutorial Tutorial 3 6 C source file 2 dbsct c 2 sbrk c C source file B resetprg cpp E sort cpp E tutorial cpp Download modules _ DEE 3 Dependencies Download module sbrk h Download module debug data only E sort h Unload module stacksct t Configure View iv Allow Docking Hide Figure 6 2 Downloading the Tutorial Program 341 RENESAS 6 3 2 Displaying the Source Program The HEW allows the user to debug a user program at the source level e Double click Tutorial cpp under C
269. g figure 2 7 This is invoked by selecting Project gt File Extensions This dialog displays all of the extensions and file groups which are defined within the current workspace File Extensions Extension Group abs Absolute file 0 E inc Assembly include file Cancel Assembly list file Add Assembly source file C header file R Remove list file x C source file Open with C header file C list file CPU information file Fynandad ascambly couree tile Figure 2 7 File Extensions Dialog The File Extensions list shown in figure 2 7 is divided into two columns On the left are the file extensions themselves whilst on the right are the file groups Many file extensions can belong to the same group For example assembler source files may have several extensions in a single project e g src asm mar etc as shown in figure 2 8 Assembler source files C source files Library files Figure 2 8 File Extensions and Groups When creating a new extension you should consider whether the extension belongs to a group which is already defined or whether you need to create a new file group If you are adding a completely new type of file then you will want to create a new file group This process is described below RENESAS gt To create a new file extension in a new file group 1 Select Project gt File Extensions from the menu bar The File Extensions dial
270. g 10 R 0 H 000041c6 Ox00ffef80 long R 1 H 0000167e Ox0Offef84 long R 2 H 00002781 OxO0ffef88 long R 3 H 0000446b Ox00ffef8c long R 4 H 0000794b OxO0ffefS90 long R 6 H 00001 5tb Ox00ffef94 long R 6 H 000059e2 Ox00ffef99 long R 7 H 00001cfb Ox00ffefSc long R 8 H 00003f54 Ox00ffefad long R 9 H OOOOOE Ox00ffefa4 long i H 000a R4 fint Watch2 A Watch3 A Watch4 Figure 6 18 Watch Window Displaying Array Elements 352 RENESAS 6 11 Displaying Local Variables The user can display local variables in a function using the Locals window For example we will examine the local variables in the tutorial function which declares four local variables a j i and p_sam e Select Locals from the Symbol submenu of the View menu The Locals window is displayed The Locals window shows the local variables in the function currently pointed to by the program counter along with their values Note however that the Locals window is initially empty because local variables are yet to be declared I ox Name E OxO0ffef80 lona 1 O i H 00ffef80 ERS long i H 000a R4 int p_sam Ox00ffbOd8 ERE class Sample Figure 6 19 Locals Window e Click mark at the left side of array a in the Locals window to display the elements e Refer to the elements of array a before and after th
271. gal_code amp lseek amp main Manual_Reset_PC xi Projects Templates lt Navigation Figure 1 15 Workspace Window Navigation Tab To allow the Workspace window or the Output window docking Click the right mouse button anywhere inside the Workspace window or the Output window Then a pop up menu will be displayed If Allow Docking is checked docking is allowed otherwise docking is not allowed Select Allow Docking to check or uncheck it When Allow Docking is checked you can dock a window to the edge of the HEW main window or to the edge of another docked window Also if Allow Docking is checked you can float them above the other HEW windows or outside the HEW main window Figure 1 16 i shows a docked Workspace window and figure 1 16 ii shows a floating Workspace window xx Workspace Of x B ro Demo A Sell source file EY Assembly source file lowlvl ste 2 lowlvisre source file B E C source file dbsct c dbsct c Demo c Demo c J ips c E intprg c lowsre c LE lowsre c p 4 resetprg c 4 sbrk c 2 sbrk c vecttbl c 2 vecttbl c E Dependencies Beets i Figure 1 16 Workspace Window Docked and Floating RENESAS When the Workspace window or the Output window is docked it has a control bar as shown in figure 1 17 If you want to move a docked window cli
272. ght hand side moved lines and Right hand side different lines 4 Click OK to keep the changes 165 RENESAS Coverage 10 Register TCL Toolkit Event Watch LHS Different Lines LHS Moved Lines RHS Different Lines RHS Moved Lines Selected Text PY Text Performance Analysis Profile Courier New 166 11 HEW Sample Text 6 Format views dialog RENESAS 12 Technical Support The High performance Embedded Workshop has a number of integrated technical support features gt To check for HEW product updates or service packs 1 Select Help gt Technical support gt Check website for updates 2 Your default web browser is invoked and defaults to the HEW download page for your region 3 Browse this area for HEW updates to fix bugs or add new features Occasionally you may experience some unforeseen problems with the HEW application If a problem does occur that results in a application crash the HEW bug tracking program will be invoked automatically This allows you to compile a bug report and this can then be sent to your technical support contact in a variety of ways It is also possible to invoke this tracker program manually This is described below gt To create and send a HEW bug report 1 Select Help gt Technical support gt Create Bug Report 2 Detailed information is generated from your HEW system This may take some time The bug report dialog is then displayed
273. h window Opening a Watch Window To open a Watch window choose View gt Symbol gt Watch or click on the Watch toolbar button if it is visible A Watch window opens Initially the contents of the window will be blank Ls ox Name Value Type Ra Ox c000024 intl10 R 0 H00000000 0x7c000024 tint R i H00000000 0x7c000028 int R B H o0000000 Ox c00002c fnt R 3 H 00000000 0x7c000030 fint R 4 H 00000000 0x c000034 fint R 65 H00000000 0x7c000038 fint R 6 H o0000000 0x7c00003c fint R H00000000 0x7c000040 iint R Bl H o0000000 0x7c000044 fint R 0 H00000000 0x7c000048 int R max H00000000 0x c00004c tint Figure 5 53 Watch Window This window allows the user to view and modify C C source level variables The contents of this window are displayed only when the debugging information available in the absolute file abs includes the information on the C C source program The variable information is not displayed if the source program information is excluded from the debugging information during optimization by the compiler In addition the variables that are declared as macro cannot be displayed The following items are displayed Name Name of the variable Value Value and assigned location The assigned location is enclosed by Type Type of the variable 272 RENESAS The R mark shows that the value of the variable ca
274. h down the Push down the a lever close lever close H8 300 HS3008EPI60H H8 300L HS3LO8EPI60H Figure 7 1 Evaluation Chip Installation 4 Push down the IC socket lever 5 Turn the four screws at the side of the emulator and fix the cover 7 3 User System Interface All user system interface signals are directly connected to the MCU in the emulator with no buffering 7 3 1 Signal Protection All user system interface signals are protected from over or under voltage by use of diode arrays except for the AVcc and analog port signals Pull up resistors are connected to the port signals except for the analog port signals The emulator monitors the signals at the head of the user system interface cable to detect whether the user system is connected or not 388 RENESAS 7 3 2 User System Interface Circuits of the H8 300 Group Evaluation Chip HS3308EVI60H All user system interface signals are directly connected to the evaluation chip in the emulator with no buffering except for those listed below which are connected to the evaluation chip through control circuits e RES NMI e MDO e MDI e EXTAL The circuits that interface the evaluation chip in the emulator to the user system include pull up resistors that cause signal delays Note that when an input terminal is in the high impedance state the pull up resistor forces the terminal to be at a high level Adjust the user system hardware to compensate for these effects The
275. h performance Embedded Workshop gt To change a projects relative path flag 1 Select the project in the workspace window 2 Right click and then select properties 3 Click the Project relative file path checkbox to switch on or off the relative file path feature figure 2 26 4 Click OK Location C Hew Demo Demo Demo hwp Last modified 10 19 42 Thursday June 12 2003 ema CPU family SuperH RISC engine Tool chain Hitachi SuperH RISC engine Standard Toolchain Version 7 1 2 0 T Project relative file path Figure 2 26 Properties Dialog 37 RENESAS 2 15 User folders in the workspace In the High performance Embedded Workshop it is possible to add folders to your workspace window This allows you to logically group your files into certain areas within a project The folder can be set to any name and this is entered in a dialog gt To add a user folder 1 Select the project on the Projects tab of the workspace window 2 Right click and then add folder 3 Enter the name and click OK 4 You can now drag and drop files into this folder to group them logically gt To remove a user folder 1 Select the folder on the Projects tab of the workspace window 2 Right click and then select Remove folder Note that the folder must be empty and that the delete key can also be used instead of the pop up gt To modify a user folder name 1 Select the folder on the Proj
276. h to the emulator user system connection 2 3 2 Plugging the User System Interface Cable Body into the Emulator Plug the cable body into the emulator taking care to insert it straight and push it firmly into place Cable body Cable head User system interface cable Figure 2 5 Plugging User System Interface Cable Body to Emulator 2 3 3 Plugging the User System Interface Cable Body into the Cable Head Plug the cable body into the cable head on the user system 185 RENESAS 2 4 Power Supply 2 4 1 AC Adapter The AC adapter supplied with the emulator must be used at all times 2 4 2 Polarity Figure 2 6 shows the polarity of the power supply plug 5 V outside GND inside Figure 2 6 Polarity of Power Supply Plug 2 4 3 Power Supply Monitor Circuit The emulator incorporates a power supply monitor circuit which only lights the red LED when a voltage higher than 4 75 V is supplied If this LED is not illuminated you should check the emulator voltage level An input voltage less than 4 75 V could indicate that enough current cannot be supplied to the emulator Note Use the provided AC adapter for the emulator 2 5 Hardware Interface All signals are directly connected to the MCU in the emulator with no buffering with the exception of those listed in section 7 Hardware Specifications Specific to This Product 2 5 1 Signal Protection on the emulator All signals are over under voltage protected by u
277. haracter strings are compared with those displayed in the Trace window Only those that completely match are counted Note however that this test is not case sensitive The number of blanks will not be cared either 5 16 15 Extracting Function Calls from the Acquired Trace Information To extract function calls from the acquired trace information select Function Call from the popup menu The Function Call Display dialog box will be displayed Function Call Display 2 x I Setting Enable to display trace information with function call only amp Disable OK Cancel Figure 5 96 Function Call Display Dialog Box Setting Selects whether or not to extract function calls Enable Extracts function calls Disable Does not extract function calls When Enable is selected only the cycles that include function calls are extracted for display from the acquired trace information The content of the trace buffer is not changed by extraction of function calls Using this function for the result of the free trace or the trace information that includes function calls allows the user to know the order of function calls 326 RENESAS 5 17 Viewing the Function Call History The Stack Trace window shows the function call history 5 17 1 Opening the Stack Trace Window To open the Stack Trace window choose View gt Code gt Stack Trace or click the Stack Trace toolbar butt
278. he Workspace window and click Open in the popup menu to make the HEW open the source file in the integrated editor It is also possible to display your source files by double clicking on their names in the Workspace window I inx 0x00001038 void tutorial void Ox00001044 long a 10 long j int i class Sample p_sam P_sam nev Sample for i 0 i lt 10 i j rand ifi lt OL s a He alil J 0x00001070 p_sam gt sort a 0x0000107a Pp_sam gt change a 0x00001082 p_sam gt s0 a 0 p_sam gt sl a 1 Figure 5 6 Source Window In this window the following items are shown on the left as information on lines e First column Source address column Displays the address information for the source line e Second column Event column Event information break e Third column EXT 2 Trigger column EXT 2 Trigger information e Fourth column Editor column PC bookmark and breakpoint information The Editor window is displayed in the right part of the Source window 226 RENESAS Source address column When a program is downloaded an address for the current source file is displayed on the Source address column These addresses are helpful when setting the PC value or a breakpoint Event column The Event column displays the following items Address condition break by an event or a range channel amp Starts time measurement by an event channel Ends time measure
279. he address on the line that has a i J j within the tutorial function and enter this address in the Address Lo edit box In this example enter H 0000105c Enter D 5 as the number of times the event condition is to be satisfied in the Required number of event occurrences edit box on the Action page 362 RENESAS Breakpoint Event Properties Figure 6 36 General Page Breakpoint Event Properties Dialog Box General Bus Area Signals Action m Type Address C PCBreak Don tCare Address Range Address Lo Evert JH 00001 05C Address Hi H 00000000 F Outside Range r Data Compare Direction 4 T Compare F Use Mask C Read Value ue C White Bute Word Mask Fo C Either e Click the OK button The Event window is displayed as shown below Enable Empty Empty Empty Enpty Empty Empty Empty Empty Empty Empty Eupty Event Trigger o x type state condition ction Eef Address H 0000105C Tutorial cpp 42 address count D S Break Note Figure 6 37 Event Window Setting Completed The items that can be displayed in this window differ depending on the product For the items that can be displayed refer to section 8 Software Specifications Specific to This Product or the online help Select Reset Go from the Debug menu to stop the tutorial program at breakpoints The program runs then stops at the c
280. he Variables This section describes how you can look at variables in the source program 5 14 1 Tooltip Watch The quickest way to look at a variable in your program is to use the Tooltip Watch feature gt To use Tooltip Watch Open the Source window showing the variable that you want to examine Rest the mouse cursor over the variable name that you want to examine a tooltip will appear near the variable containing basic watch information for that variable p_sam new Sample gt for i 0 i lt 10 i j rand H 0003 if j lt 0 n s Tag afi 3 Figure 5 51 Tooltip Watch 5 14 2 Instant Watch Open the Source window showing the variable that you want to examine Rest the mouse cursor over the variable name that you want to examine and choose Instant Watch from the popup menu the Instant Watch dialog box will appear and display the variable at the cursor location Instant Watch str Ox cO00088 struct strB Figure 5 52 Instant Watch Dialog Box shown to the left of the variable name indicates that the information may be expanded by clicking on the indicates that the information may be collapsed Clicking Add registers the variable in the Watch window Clicking Close closes the window without registering the variable in the Watch window variable name and 271 RENESAS 5 14 3 Watch Window You can view any value in the Watc
281. he column is displayed or not 93 RENESAS Global Editor Column States Coverage Editor Source Address Cancel lt lt Figure 4 17 Global column state Dialog 4 14 Enable tooltip watch Select Tools gt Options and then select the Editor tab figure 4 7 By checking Enable tooltip watch you can use the Tooltip Watch feature the quickest way to look at a variable in the source program gt To view a tooltip watch on the Editor window 1 Display the source file containing the variable that you want to examine on the Editor window figure 4 18 2 Rest the mouse cursor over the variable name that you want to examine a tooltip will appear near the variable showing a value of that variable 0x00002054 0x0000205a 0x00002066 0x0000206e sort aj print t Sorting re for i O i lt 10 i j printf a da 1ld 0x00002090 minean 0x00002092 ma 0x00000000 il ox00002094 min 0 0x00002096 max 0 0x00002098 0x0000209e 0x000020a0 change a min a 9 max a O X gt Figure 4 18 Viewing a tooltip watch 94 RENESAS 5 Tools Administration You control the components which can be used by the High performance Embedded Workshop via the Tools Administration dialog figure 5 1 which is invoked via Tools gt Administration Modification of the To
282. he problem is that the command above is specific to c files filel c What we want to be able to do is to tell the HEW to use the editor specified but to open the file that I have chosen at that time To do this you can replace the specific name of the file for a general placeholder i e c myedit myeditor exe FULLFILE Now whenever the HEW launches the editor with a file it knows that it has to replace FULLFILE with the file you have selected C 2 Inserting a Placeholder Placeholders can only be entered into three specific edit fields within the HEW figures C 1 C 2 and C 3 There are four ways a placeholder can be entered In the first example place the insertion cursor at the point you would like to insert the placeholder and then select the required placeholder from the popup menu to the right of the edit field File fe project myproject ouput file out gt Figure C 1 Placeholder Popup Menu In the second example select the required placeholder other than Custom directory from the combo box and specify a sub directory relative to the directory shown by the placeholder If you select Custom directory specify an absolute directory path in the Sub Directory field Relative to Configuration directory 7 Sub Directory pty ooo Figure C 2 Placeholder Combo Box and Sub Directory Field Note The Sub Directory field may be written as the File path field In the third example place the
283. he version control system In the HEW version 3 0 onwards the Visual SourceSafe component has this facility The difference window can be invoked two ways The first is from the show differences menu item on the tools menu The second is via the workspace window pop up with the same name When using the pop up menu the current file selection is automatically added to the edit box Clicking the show differences menu item displays the dialog shown below in figure 11 1 l5 xi c hew projects myproject myproject dbsct c File in version control u u aj sE as 16 16 n pragma section DSEC n pragma section DSEC 18 static const struct 12 static const struct as char rom_s Start address of tk 1 char rom_s Start address of the 20 char rom_e End address of the char rom_e End address of the in a char ram_s Start address of tk char ram_s Start address of the 22 DTBL b 2 DTBL a __sectop D _ secend D _ sectop 7 __sectop D _ secend D sectop R a jy __sectop ABS8D __ secend SABS8D __sectop ABS8D __ secend SABS8D _ aff __sectop ABS16D _ secend SABS1le __sectop ABS16D _ secend ABS16D x ye 26 he z pragma section BSEC a pragma section BSEC 2 static const struct 2 static const struct 23 char b_s Start address of nce 33 char b 3s Start address of non 30 char bh e End address of non char b e E
284. heap HEAPSIZE Declaration of the area managed by sbrk theap_area static char brk char amp heap_area End address of area assigned LRA IE JE JE JE AAA JE JE JE IE JE AAA JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE AHA JE JE JE JE JE JE JE AANA JE JE JE JE JE JE JE JE JE JE JE JE ASAE AIA sbrk Data write Return value Start address of the assigned area Pass 1 Failure A HEHHEHE JE MEJE E E JE E JE JE JE JE IE IE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE ME JEME char sbrk unsigned long size Assigned area size char p if brk size gt heap_area heap HEAPSIZE Empty area size x fesetprg c sbrk c Figure 1 18 Editor Window The editor window can be customized via the Format Views dialog box which can be invoked via the Tools gt Format Views menu option This dialog allows you to configure fonts colors tabs and so on for the editor window It also allows the user to change the look of other views which have been installed by HEW If you would prefer to use your favorite editor rather than the HEW internal editor then specify your alternative in the Options dialog box which can be invoked via the Tools gt Option menu option For further details on how to use and configure the editor refer to chapter 4 Using the Editor 1 2 6
285. high level Adjust the user system hardware to compensate for these effects The delay caused by the user system interface cable is about 3 ns The following diagrams show the user system interface signal circuits Default o User system 47 Q interface cable Figure 7 37 Default User System Interface Circuit RES NMI and MDO These signals are input to the evaluation chip via HD151015 Therefore the rising falling time must be within 8 ns or less User system 479 interface cable HD151015 Figure 7 38 User System Interface Circuit for RES NMI and MDO 399 RENESAS MD1 and FVpp Includes a 12 V detection circuit for supporting microcomputers including flash memory 12 V detection User system circuit interface cable MD1 and FVpp monitor register Figure 7 39 User System Interface Circuit for MD1 and FVpp EXTAL Clock oscillator circuit is on the user system interface cable User system 47Q interface cable HD151015 Figure 7 40 User System Interface Circuit for EXTAL STBY Hardware standby cannot be used 10 KQ Evaluation chip Figure 7 41 User System Interface Circuit for STBY P70 AN0 to P77 AN7 Evaluation o User system chip 470 interface cable Figure 7 42 User System Interface Circuit for P70 ANO to P77 AN7 400 RENESAS AVcc and AVss Evaluation chip User system 27KQ j interface cable Figure 7 43 User System
286. ially positioned 6 Click OK to define the editor Note When using an external editor be aware of the following issues e Each time you invoke the external editor in whichever way a separate instance of the editor will be launched e You must save your own files before you perform a build file build or build all operation e If debugging the external editor will not be used 6 6 Customizing File Save The High performance Embedded Workshop allows you to customize file save on the Editor tab of the Options dialog figure 6 12 To open the tab select Tools gt Options and click the Editor tab The following sections explain the options related to file save 6 6 1 Save files before executing any tools To force the High performance Embedded Workshop into saving edited files before executing any build phases ie build build all or build file operations or version control commands set the Save files before executing any tools check box 6 6 2 Prompt before saving files In addition to the above check box set this to prompt before saving 124 RENESAS 6 7 Using Custom Placeholders Throughout the High performance Embedded Workshop the user can use a number of pre defined placeholders for directory definitions For example the user can use the PROJDIR variable to signify the current HEW project directory This makes it much easier to relocate projects and keep all of the paths correct
287. icking on the instruction that you want to change The Assembler dialog box will be opened Assembler 2 x Address Code 00001040 79370028 Mnemonic H 0028 A 7 OK Cancel Figure 5 9 Assembler Dialog Box 229 RENESAS The address instruction code and mnemonic are displayed Enter the new instruction or edit the old instruction in the Mnemonics field Pressing the Enter key will replace the memory content with the new instruction and move on to the next instruction Clicking the OK button will replace the memory content with the new instruction and close the dialog box Clicking the Cancel button or pressing the Esc key will close the dialog box without modifying the memory contents Note The assembly language code being displayed is the current memory content If the memory contents are changed the Assembler dialog box and the Disassembly window will show the new assembly language code but the source file displayed in the Editor window will be unchanged This is the same even if the source file contains an assembler 5 2 5 Viewing a Specific Address When you are viewing your program in the Disassembly window you may wish to look at another area of your program s code Rather than scrolling through a lot of code in the program you can go directly to a specific address Select Set Address from the popup menu and the dialog box shown in figure 5 10 is displayed Set Address
288. iding So if one of the client machines adds a new file the server machine is notified The server then notifies all other clients the action has taken place This structure is shown below in figure 10 1 Networked workspace and project S L Networked_Data_Example Networked_Data_Example Debug 4 SimDebua SH 2 Network RAPES e t access Server Network access All files are under the network service s control These include the workspace project session and source files Clients do not access data directly with the workspace and project files on the network The clients cannot f directly communicate with each other either All communication is directed Clients through the server machine Figure 10 1 Network database access structure The network system allows users to be given access rights to files This allows the project administrator to make sure the only people who can modify the project and source files are allowed to do so This might allow the administrator to limit each user to only have write capabilities for their own area of the project other areas would be read only This could limit any potential conflict or damage one user could do to other areas of the project These limitations can be set to a number of different levels This is outlined later in this section Note Certain operations are locked when other clients are carrying them out This means that if one ma
289. iguration directory 7 Insert for placeholder Cancel Figure 3 11 Custom Options Options Tab 3 4 2 Output Files Tab The Output Files tab figure 3 12 is where you can specify the output file or files that will be produced by the phase Before each file is passed into this phase the HEW checks that the output files are of a less recent date than the input file If so the phase will be executed for that file i e input files have been modified since the output file or files were last produced If the files are up to date then the phase will not be executed Note If no output files are specified the phase will execute regardless 51 RENESAS Options Output Files Dependent Files Output files CONFIGDIF utilities lib Modify Remove ih Cancel Figure 3 12 Custom Options Output Files Tab gt To add an output file 1 Click Add The Add Output File dialog will be invoked figure 3 13 2 Enter the file path or browse to it using the Browse button 3 Click OK to add this output file to the list Placeholder popup menu HE Eile OO O O Browse Cancel Figure 3 13 Add Output File Dialog gt To modify an output file 1 Select the output file that you would like to modify 2 Click Modify The Modify Output File dialog which is the same as figure 3 13 except the title will be invoked
290. il the PC reaches the address indicated by the current text cursor position Sets the PC to the address at the row of the text cursor fit me Set PC To Cursor Run Launches the Run Program dialog box allowing the user to enter the PC or PC breakpoint during executing the user program Display PC Shift Ctrl Y Opens the Editor or Disassembly window at the address of the PC Executes a block of user program before breaking Step In F11 Step Over F10 Executes a block of user program before breaking If a subroutine call is reached then the subroutine will not be entered a E Step Out Shift F11 Executes the user program to reach the end of the current function 2 Step Launches the Step Program dialog box allowing the user to modify the settings for stepping Step Auto Steps only one source line when Mode the Source window is active When the Disassembly window is active stepping is executed in a unit of assembly instructions Assembly Executes stepping in a unit of assembly instructions Source Steps only one source line 463 RENESAS Table G 1 GUI Menus cont Toolbar Menu Option Shortcut Button Remarks Debug Halt Program Esc Stops the execution of the user cont program Connect Connects the debugging gt platform Initialize Disconnects the debugging platform and connects it again Disconnect Di
291. ile must be a plain ASCII text file 2 The file must start with the word BEGIN 3 Each symbol must be on a separate line with the value first in hexadecimal terminated by an H followed by a space then the symbol text 4 The file must end with the word END Example BEGIN 11FAH Symbol_name_1 11FCH Symbol_name_2 11FEH Symbol_name_3 1200H Symbol_name_4 END 453 RENESAS 454 RENESAS Appendix F HMAKE User Guide F 1 Command line The following section describes the command line that should be used to execute the hmake program on a file using none or more of the available options F 1 1 Basic structure The command line must be of the following syntax hmake lt make file you wish to execute gt lt parameter list gt If a file is specified without an extension then mak will be appended to it The parameter list may include none or more of the parameters listed in the following section The parameters list may appear before the make file name if you wish Each parameter must be separated by at least one white space character Parameters are not case sensitive If no parameters are given and no file is given then help information will be displayed F 1 2 Exit codes If there are any syntax errors in the make file being executed or if any process executed whilst running the make file returns an invalid error code then hmake will exit with code 1 Otherwise hmake will exit with code 0 See below for file
292. in MEI Address H000001012 x Cancel Figure 5 39 Edit Label Dialog Box Edit the label name and value as required and then press OK to save the modified version in the label list The list display is updated to show the new label details When an overloaded function or a class name is entered in the Address field the Select Function dialog box opens for you to select a function For details refer to section 5 13 3 Supporting Duplicate Labels 257 RENESAS 5 10 4 Deleting a Label To delete a label select the label and choose Delete from the popup menu A confirmation message box appears Confirmation Request Delete Label_BTBL Figure 5 40 Message Box for Confirming Label Deletion If you click OK the label is removed from the list and the window display is updated If the message box is not necessary then check the Don t ask this question again check box 5 10 5 Deleting All Labels To delete all the labels from the list choose Delete All from the popup menu A confirmation message box appears Confirmation Request Delete All Labels I Don t ask this question again Figure 5 41 Message Box for Confirming All Label Deletion If you click OK all the labels are removed from the HEW system s symbol table and the list display will be cleared If the message box is not necessary then check the Don t ask this question again check box 258 RENESAS 5 10 6 Load
293. ind Dialog Box Address Page Don t care Detects no address when this box is checked Setting Detects the specified address Value Enter the address value not available when Don t care has been checked 305 RENESAS 3 Data page Set a data condition Figure 5 78 Trace Find Dialog Box Data Page Don t care Detects no data when this box is checked Setting Detects the specified data Value Enter the data value not available when Don t care has been checked 306 RENESAS 4 R W page Select the type of access cycles mem x Status Probes IRQ 0 General Address Data RAV Area ro Setting Sting JRD Cancel Apply Figure 5 79 Trace Find Dialog Box R W Page Don t care Detects no read write condition when this box is checked Setting Detects the specified read write condition String Select a read write condition not available when Don t care has been checked RD Read cycle WR Write cycle 307 RENESAS 5 Area page Select the area being accessed The selection is not available when a time stamp is acquired mem x Status Probes IRQ 0 General Address Data RAW Area ro Setting String ROM Cancel Apply Figure 5 80 Trace Find Dialog Box Area Page Don t care Detects no area condition when this box is checked Setting Detects the spe
294. ind in Files Version Control 7 Figure 4 20 Selecting the Session File In the list box that is circled in figure 4 20 select the session name including the character string that has been set in the Target name text box in figure 4 10 New Project Step 8 dialog box The setting for using the emulator has been registered in this session file After the session name is selected the emulator will automatically be connected For details on the session file refer to section 4 4 Debug Sessions 216 RENESAS 4 6 Reconnecting the Emulator When the emulator is disconnected use the following way for reconnection Select Build gt Debug gt Connect or click the Connect toolbar button E The emulator is connected Note Before reconnecting the emulator a load module must be registered to the HEW For registration refer to section 4 3 Setting at Emulator Activation 4 7 Ending the Emulator When using the toolchain the emulator can be exited by using the following two methods e Canceling the connection of the emulator being activated e Exiting the HEW 1 Canceling the connection of the emulator being activated Select Disconnect from the Debug menu or click the Disconnect toolbar button 2 Exiting the HEW Select Exit from the File menu A message box is displayed If necessary click the Yes button to save a session After saving a session the HEW exits If not necessary
295. indicate the completion of connection 204 RENESAS 4 2 2 Creating a New Workspace Toolchain Used 1 In the Welcome dialog box that is displayed when the HEW is activated select Create a new project workspace radio button and click the OK button yy Open a recent project works Figure 4 7 Welcome Dialog Box 205 RENESAS 2 Creation of a new workspace is started The following dialog box is displayed New Project Workspace Projects E Assembly Application H Demonstration Q Empty Application kE Import Makefile Library Properties Workspace Name sample Project Name sample Directory D Hew3 sample Browse CPU family H85 H8 300 he Tool chain Hitachi H8S H8 300 Standard ba Figure 4 8 New Project Workspace Dialog Box Workspace Name edit box Enter the new workspace name Here enter test Project Name edit box Enter the project name When the project name is the same as the workspace name it needs not be entered Directory edit box Displays the directory in which a workspace will be created Click the Browse button to select a directory or enter the name of a directory in the Directory edit box CPU family combo box Select the target CPU family Tool chain combo box Select the target toolchain name when using the toolchain Otherwise select None Project type list box
296. indow A variable can be dragged from the Source window and dropped into the Watch window Note Ifthe variable that you have added is a local variable that is not currently in scope the HEW will add it to the Watch window but its value will be Not available now 274 RENESAS Expanding a Watch Item If a watch item is a pointer array or structure then you will see a plus sign expansion indicator to left of its name this means that you can expand the watch item To expand a watch item double click on it The item expands to show the elements in the case of structures and arrays or data value in the case of pointers indented by one tab stop and the plus sign changes to a minus sign If the elements of the watch item also contain pointers structures or arrays then they will also have expansion indicators next to them Expansion Watch loj x indicator EA OxOOffef80 aes wati R 0 H OOOOOHE OxO0ffefS0 long R 0 H 000015fb OxO0ffefd long R 2 H 0000167e 0x00ffef88 long R 3 H 00001 cfb OxO0ffefSe long R 4 H 00002781 0x00ffef30 long R I H OO003654 OxOOffef34 long R 8 H 000041c6 Ox00ffef93 long R 7 H 0000446b Ox00ffefSc long R 8 H 000059e2 0x00ffefa0 long R 9 H 0000794b Ox00ffefad long Collapsed watch R a Ox0Offef80 long 10 Figure 5 55 Expanding a Watch Item To collapse an expanded watch item double click on
297. ing Labels from a File A symbol file can be loaded and merged into the HEW s current symbol table Choose Load from the popup menu to open the Load Symbols dialog box Load Symbols Look in fareut sis al c 3 tutorial sym File name my_code sym Files of type l Symbol Files syrm Cancel Figure 5 42 Load Symbols Dialog Box The dialog box operates like a standard Windows open file dialog box select the file and click Open to start loading The standard file extension for symbol files is sym 5 10 7 Saving Labels into a File Choose Save As from the popup menu to open the Save Symbols dialog box The Save Symbols dialog box operates like a standard Windows Save File As dialog box Enter the name for the file in the File name field and click Save to save the HEW s current label list to a symbol file The standard file extension for symbol files is sym See appendix E Symbol File Format for the symbol file format Once a file is specified by the Save As menu the current symbol table can be saved in the same symbol file just by choosing Save from the popup menu 5 10 8 Searching for a Label Choose Find from the popup menu to open the Find Label dialog box Find Label 27x C m A Cancel Figure 5 43 Find Label Dialog Box Enter all or part of the label name that you wish to find into the edit box and click OK or press the
298. ing Text gt To search for text in the current file 1 2 3 Ensure that the window whose contents you want to search is the active window Position the insertion cursor at the point from which you want to start your search Select Edit gt Find press CTRL F select Find from the editor window s local menu or click the find toolbar button The Find dialog box will be displayed figure 4 2 Find BEG Find what string 7 Find Next I Match whole word only Direction Cancel I Match case C Up Down T Regular expression 9 Figure 4 2 Find Dialog Enter the text that you want to search for into the Find what field or select a previous search string from the drop down list box If you select text before invoking the find operation the selected text will be automatically placed into the Find what field If you would like to search for character string as a whole word then check the Match whole word only check box When this option is not selected the search will be for any string that is matched by the search string If you would like your search to be case sensitive i e to distinguish between upper and lower case letters then check the Match case check box If your search string uses regular expressions then check the Regular expressions check box Refer to Appendix B Regular Expressions for further information The Direction radio b
299. ing the Emulator Refer to section 4 Preparation before Use 2 9 Uninstalling the Emulator s Software For details on uninstallation refer to the Setup Guide for the E6000 Emulator 193 RENESAS 194 RENESAS Section 3 E6000 Emulator Functions 3 1 Debugging Features 3 1 1 Breakpoints The emulator provides a comprehensive range of alternative types of breakpoints to give you the maximum flexibility in debugging applications and user system Hardware Break Conditions Up to 12 break conditions can be defined using the event and range channels in the complex event system CES For more information about the hardware break conditions see section 3 2 Complex Event System CES Program Breakpoints PC Breakpoints Up to 256 program breakpoints can be defined These program breakpoints are set by replacing the user instruction by a BREAK instruction In target ROM only one breakpoint on chip break can be set 3 1 2 Trace The emulator incorporates a powerful realtime trace facility which allows you to examine MCU activity in detail The realtime trace buffer holds up to 32768 bus cycles and it is continuously updated during execution The buffer is configured as a rolling buffer which can be stopped during execution and read back by the host computer without halting emulation The data stored in the trace buffer is displayed in both source program and assembly languages for ease of debugging However if trace filtering
300. ion Figure 2 22 Standard Library Includes 2 8 3 Show File Paths If Show file paths is selected all of the files in the project window are shown with their full path i e from a drive letter figure 2 23 Workspace OO x G Demo E Assembly source file 2 C AHew2 Demo Demoic0 ste C source file E C A Hew2 Demo Demohwetg c E C Hew2 Demo Demo inty c L C Hew2 Demo Demo main c 2 C Hew2 Demo Demo sbrk c amp Dependencies en ar Figure 2 23 File Paths Shown 32 RENESAS 2 8 4 Sort files by time order When this option is selected the workspace window is then sorted into file time stamp order If files are updated after selecting this option manually update the order of these files gt To manually update the file order 1 Select Refresh order in the pop up menu on the Projects tab of the Workspace window 2 9 Setting the Current Project A workspace can contain more than one project but only one of the projects can be active at any time This active project is the one which build actions and debug operations can be performed on It is also possible to change the builder or debugger options for the project This active project is shown as bold characters gt To set a project as the current project 1 Select a non active project from the Projects tab of the Workspace window 2 Click the
301. ion becomes disabled RENESAS 2 Stop page Sets trace stop conditions It is possible to set trace stop conditions with and without delay with both allowed simultaneously Figure 5 70 Trace Acquisition Dialog Box Stop Page Stop Without Delay Defines a trace stop condition Enable Checking this box enables a trace stop Events Lists the event points where trace acquisition conditions have been set If the box that corresponds to an event point is checked trace acquisition will be stopped when that event is satisfied only available when Enable has been selected 297 RENESAS 3 Delayed Stop page Sets trace stop conditions It is possible to set trace stop conditions with and without delay with both allowed simultaneously 2 E gi Ts f iii fz ELE EE Figure 5 71 Trace Acquisition Dialog Box Delayed Stop Page Stop With Delay Defines a trace stop condition Enable Checking this box enables a trace stop Delay Count Sets the delay count in bus cycles range 1 to 65535 This function allows you to acquire a number of trace records after any of the specified events occur Events Lists the event points where trace acquisition conditions have been set If the box that corresponds to an event point is checked trace acquisition will be stopped when that event is satisfied only available when Enable has been selected 298 RENESAS 4 1 to 4
302. ions that you want to examine and would like to return to the calling function without tediously stepping through all the remaining code in the function Or alternatively you may have stepped into a function by accident when you meant to step over it and so want to return to the calling function without stepping all the way through the current function You can do this with the Step Out feature To step out of the current function either click the Step Out toolbar button or choose Debug gt Step Out 263 RENESAS 5 11 6 Multiple Steps You can step several instructions at a time by using the Step Program dialog box The dialog box also provides an automated step with a selectable delay between steps Open it by choosing Debug gt Step The Step Program dialog box is displayed Step Program Steps H o0000001 Delay 25 seconds x Cancel I Step over calls I Source level step Figure 5 45 Step Program Dialog Box Steps Number of steps to be executed Delay seconds Delay between steps when the program is automatically stepped 0 to 3 seconds can be selected in 0 5 second units Step Over Calls Selecting this box steps over function calls Source Level Step Selecting this box steps the program at the source level Clicking the OK button or pressing the Enter key starts step execution 264 RENESAS 5 12 Stopping Your Program This section describes how you can halt executio
303. ip set HS3927EVI60H For the H8 3664 E6000 emulator e E6000 emulator HS3664EPI60H Hardware required for each emulator e Host computer e The E6000 PC interface board select either from the followings according to the PC interface specifications PCI bus interface board HS6000EICO1H or HS6000EICO2H PCMCIA interface card HS6000EIP01H 1 Install the E6000 PC interface board in the host computer and connect the supplied PC interface cable to the board 2 To use the H8 300 series E6000 emulator or the H8 300L series E6000 emulator install an evaluation chip in the emulator Connect the PC interface cable to the emulator Connect the supplied AC adapter to the emulator Initiate the host computer to make it enter DOS prompt command input wait state DN op amp Turn on the emulator power switch 469 RENESAS 1 2 Diagnostic Test Procedure Using Test Program Insert the CD R HS3008EPI60SR supplied with the emulator into the CD ROM drive of the host computer move the current directory to one of those listed below with a command prompt HS3308EVI60H lt Drive gt Diag HS3308EVI60H HS3508EVI60H lt Drive gt Diag HS3508EVI60H HS3398EVI60H lt Drive gt Diag HS3398EVI60H HS3334EVI60H lt Drive gt Diag HS3334EVI60H HS3257EVI60H lt Drive gt Diag HS3257EV1I60H HS3437EVI60H lt Drive gt Diag HS3437EVI60H HS3318EVI60H lt Drive gt Diag HS33 18EVI60H HS3834EVI60H lt Drive gt Diag HS3834EVI60H HS3876EVI6
304. is function allows checking the content of a variable without affecting the realtime operation For the Watch window refer to section 5 14 3 Watch Window 253 RENESAS 5 9 6 Hiding the Monitor Window When using the Monitor function to monitor the value of a variable from the Watch window hide the Monitor window for the effective use of the screen The current monitoring information is listed as the submenu when selecting Display gt CPU gt Monitor The list consists of the Monitor window name and the address to start monitoring When the left of the list is checked the Monitor window is being displayed Selecting items of the Monitor window you want to hide from the monitor setting list displays no Monitor window and removes the check mark at the left of the list To display the Monitor window again select the hidden the Monitor window J Monitor Setting Shift Ctrl E V monitor2 H OOFFB0D8 monitor H OOFFEF80 Windows Select Figure 5 35 Monitor Setting List 5 9 7 Managing the Monitor Window Selecting Display gt CPU gt Monitor gt Windows Select displays the Windows Select dialog box In this window the current monitoring condition is checked and the new monitoring condition is added edited and deleted in succession Selecting multiple monitoring conditions enables a temporary stop of update hiding and deletion Name Address y monitor
305. is is particularly useful of you want to send a project to a user who does not have the HEW or if you want to version control an entire build including the make components This version of HEW also supports the integration of the generated makefile and tools into the HEW framework This allows you to click build menu or toolbar button and then launch the makefile rather than the normal internal HEW build process For further information refer to the Using a makefile inside the HEW system section later in this chapter gt To generate a makefile 1 Ensure that the project which you want to generate a makefile for is the current project 2 Ensure that the build configuration that you want to build the project with is the current configuration 3 Select Build gt Generate Makefile 4 Select the radio button which is relevant for your makefile See figure 3 23 5 Ensure you have selected the correct makefile format HEW is capable of generating GNUMake HMake and NMake compatible files 6 The use static sub command files check box will generate separate command files in the make destination directory This is different to the normal style where the sub command files are generated by the make tool In the case of the GNUMake file format this must be switched on 7 Checking Scan dependencies whilst building makefile will force a dependency scan to ensure the makefile creation is up to date 8 Click OK
306. is used only assembly language can be displayed The buffer can be set up to store all bus cycles or just selected cycles This is called trace acquisition and uses the complex event system CES to select the parts of the program you are interested in It is also possible to store all bus cycles and then just look at selected cycles This is called trace filtering 3 1 3 Execution Time Measurements The emulator allows you to measure the total execution time or to measure the time of execution between specified events in the complex event system You can set the resolution of the timer to any of the following values 20 ns 125 ns 250 ns 500 ns 1 us 2 us 4 us 8 us or 16 us At 20 ns the maximum time that can be measured is about six hours and at 16us the maximum time is about 200 days 3 1 4 Performance Analysis The emulator provides functions for measuring the performance of a program The performance of the specified program range can be displayed either as a histogram or in percentage form A timer resolution of 20 ns 40 ns or 160 ns can be selected In addition the execution count of the specified program range can be measured 1 to 65535 195 RENESAS 3 1 5 Bus Monitoring The emulator incorporates a bus monitoring function that monitors and displays the contents of the accessed area in HEW windows without stopping the program execution Up to eight blocks of 256 bytes can be monitored In addition the emulator can
307. ity to the build that is not toolchain specific Debugger Component a component that supports some specific debugger functionality e g Target platform Object reader etc e Extension Component a component that provides key functionality in a certain area of the HEW system These components cannot be unregistered when installed e g The HEW builder debugger and flash support 95 RENESAS 5 1 Tool Locations The HEW maintains the locations of HEW compatible components automatically as each new tool is installed After installation the HEW stores information about the component including its location this is referred to as registration Although initial registration is automatic during the course of development or if you want to manage the tools being used in your projects more effectively you may need to register components yourself The remainder of this chapter discusses registration and how it affects you 5 2 HEW Registration Files HRF When a HEW compatible component i e toolchain system tool or utility phase is installed part of its installation will include a file with the extension HRF figure 5 2 i This file named a HEW Registration File describes the component to the HEW The process of registration refers to loading a component s HRF file into the tools administration dialog figure 5 2 11 i INSTALL ii REGISTER a C a CA i MyTool m MyTool __ MYTOOL HRF MYTOOL HRF
308. k E Default1 desktop Read write 62 87 4 ins NUM 4 Figure 1 20 Status Bar 1 3 The Help System The help menu is the rightmost menu on the HEW menu bar It contains the menu option Contents which when selected takes you to the main HEW help window To obtain help on specific dialogs click on the context sensitive help button which is located in the top right hand corner of each dialog box as shown in figure 1 21 Context sensitive help e Cancel button Figure 1 21 Help Button When this is clicked the mouse pointer will change to a pointer with a question mark above it Whilst the mouse pointer is in this state click on the part of the dialog box that you require assistance on Alternatively select the control that you require help for and then press the F1 key RENESAS 1 4 Launching the HEW To run the HEW open the Start menu of Windows select Programs select Renesas High performance Embedded Workshop and then select the shortcut of the HEW By default the Welcome dialog box shown in figure 1 22 will be displayed Welcome 21x m Options BS 9 Cancel Open a recent project workspace Administration 4 C Hew demo demo hws Browse to another project workspace Figure 1 22 Welcome Dialog To create a new workspace select Create a new project workspace and click OK To open one of
309. layed which allows the user to browse to an existing project to import a custom phase from 2 Choose the location of the project you wish to import a custom phase from Once selected a dialog is displayed which lists the custom phases in the imported project 3 Once you have decided which phase to import highlight it in the list and then click OK The phase will then be added to the build phases dialog at the bottom of the build order 46 RENESAS gt To modify a custom phase 1 Select the custom phase that you would like to modify 2 Click the Modify button The modify phase dialog will be invoked with the Command tab selected figure 3 7 3 Change the contents of the fields as appropriate 4 Set the Don t check for input file s existence before executing check box if you don t want the HEW to abort the execution of the phase if any of the input files don t exist Set the Read Output On Fly check box if you want to display the command output to stdout during command execution Modify MyPhase C tools mptool exe Figure 3 7 Modify Phase Dialog Command Tab 5 Select the Environment tab figure 3 8 to edit the environment settings for the phase 6 Use the Add Modify and Remove buttons to add modify and remove environment variables The operation is the same as discussed in the previous section 7 Click OK when all modifications have b
310. ld You can choose whether to modify the whole register contents a masked area floating or flag bits by selecting an option from the combo box the contents of this list depend on the CPU model and selected register When you have entered the new number or expression click the OK button or press the Enter key the dialog box closes and the new value is written into the register 5 4 6 Using Register Contents Use the value contained in a CPU register by specifying the register name prefixed by the character e g R1 PC R6L or ER3 when you are entering a value elsewhere in the HEW for example when displaying a specified address in the Disassembly or Memory windows Available register names depend on the target MCU being emulated 5 4 7 Saving the Currently Displayed Contents The contents currently displayed in the window can be saved in a text file Select Save to File from the pop up menu 236 RENESAS 5 5 Operating Memory This section describes how to control memory contents such as viewing a memory area in different formats filling and moving a memory block and loading and verifying a load module file 5 5 1 Viewing a Memory Area To look at a memory area choose View gt CPU gt Memory or click the View Memory toolbar button E to open the Memory window This will open the Format dialog box shown in figure 5 18 End H o00000FF Format Byte x1 ba Display Va
311. ld file where lt file gt is the selected file from the pop up menu figure 2 5 Then a red cross will be put on the file s icon and the file will be excluded from build 2 2 4 Including a Project File in Build An excluded file can be included in the project again To include a file which has been excluded from build 1 Push the right mouse button on a file which has been excluded from build on the Projects tab of the Workspace window 2 Select Include Build file where lt file gt is the selected file from the pop up menu Then a red cross will be removed from the file s icon and the file will be included in build 16 RENESAS 2 3 File Extensions and File Groups The HEW can identify files by their extension The system defines certain extensions depending upon the tools which are being used For example if you are using a compiler then the c extension will be in the C source file group and be used as input to the compiler phase figure 2 1 Typical Build Process Additionally the HEW allows you to define your own extensions For example if the project you are developing uses assembler source files the default extension may be src If you would like to use a different extension instead of src e g asm then you can define a new extension and request that the HEW treats it in the same way as a src file File extensions and file groups can be viewed and modified via the File Extensions dialo
312. le Po Bronce Cancel Figure 3 22b External debugger selected PD debugger RENESAS 61 gt To use the other external debugger except on the HDI or the PD debugger 1 Sets the location of the external debugger executable 2 Sets the command line option This field allows additional options to be specified which can modify the behavior of the external debugger 3 Sets the location of the download module Customize 2 x Toolbars Commands Menu Placeholders Debugger Log Help External debugger selected Other external debugger m Debugger settings External debugger location Command line options gt Download module gt Browse Cancel Figure 3 22c External debugger selected External debugger except on the HDI or the PD debugger Click the Launch External Debugger toolbar button to invoke the external debugger Al After a build if the download module has been updated the HEW will switch back to the debugger to enable immediate debugging Whilst using the debugger double clicking in any source window will switch back to the HEW with the source file open at the line which was double clicked This operation is not possible with the Other external debugger 62 RENESAS 3 10 Generating a Makefile The HEW allows you to generate a makefile which can be used to build parts of your workspace without HEW Th
313. le radio button and then the OK button Only the information on function calls is now displayed in the Trace window the Label column s right side boundary has been moved to the left in the Trace window to show the function calls Generic Trace E ioj x Label PTR Add Instruction Data R W Area Status Clock Probes NMI IRQ7 0 Power0N_Reset 09108 000400 MOV L H OOFFEFCO ER 7a07 RD ROM PROG 1 ql i aqui _main 03582 001034 BSR Gtutorial 8 5502 RD ROM PROG 1 ql i aT tutorial 03578 001038 MOV L ER3 ER 0100 RD ROM PROG 1 ql 1 lau Sample Sample 03558 002000 MOV L ER2 ER 0100 RD ROM PROG i ql i aqui _sbrk 03369 001000 TM L ER2 ER3 3P 0110 RD ROM PROG 1 ql 1 uuu Sample sort long 01667 002068 STM L ER2 ER3 3P 110 RD ROM PROG i ql i aqui Sample change long 00469 0020d6 MOV L ER3 ER7 0100 RD ROM PROG 1 ql 1 qaqa S gt Figure 6 59 Trace Window Function Calls 5 To return the display in the Trace window to its previous state follow the procedure in 3 to display the Function Call Display dialog box Click the Disable button and then the OK button 6 Remove the event points that have been set and clear the trace information Clicking the right hand mouse button on the Breakpoints window displays a popup menu Select Delete All from this menu to remove all the event points that have been set Clicking the right hand mouse button on the T
314. le 21x Variable _______ Cancel Value e Placeholder popup menu Figure 8 11 Environment Variable Dialog To modify an environment variable select the variable that you want to modify from the Environment list and then click the Modify button beside it Make the required changes to the Variable and Value fields and then click OK to add the modified variable back to the list To remove an environment variable select the variable that you want to remove from the Environment list and then click the Remove button beside it 144 RENESAS 8 3 3 Specifying Comments If a command contains the placeholder COMMENT then the HEW will request that you enter the comment when the command is executed via the dialog as shown in figure 8 12 Please Enter Comment 24 xi File c hew demo demo sbrk c Lance Comment T Apply comment to all files Figure 8 12 Please Enter Comment Dialog You may specify a comment for each file or if you would like to specify the same comment for all files check the Apply comment to all files check box before clicking OK 145 RENESAS 8 3 4 Specifying a User Name and Password Most version control tools will require you to pass a user name and password on the command line in order to keep files secure and to keep a record of which files were changed by which users The custom version control support provide
315. lected No change No color change Change Color is changed according to the Foreground and Background options Gray Those data with values that have not been changed are displayed in gray Appear A value is only displayed after changed Foreground Sets the color used for display available when Change has been selected Background Sets the background color available when Change has been selected Mayfly A check in this box selects restoration of the color of those data which have not been updated in a specified interval to the color selected in the Background option The specified interval is the interval for monitor acquisition available when Change Gray or Appear has been selected Detail Sets the items specific to the emulator Not used with this emulator History Displays the previous settings Notes 1 In this emulator odd addressees cannot be specified as the start addresses for monitoring 2 Selection of the foreground or background color may not be available depending on the operating system in use After setting clicking the OK button displays the Monitor window 252 RENESAS monitor monitor H OOFFEFAO Address OxOOFFEFAO 00 OO 10 23 00 OO O8 93 OxOOFFEFAS 00 02 12 24 OO OO OO OO OxOOFFEFBO 57 70 00 OO OO 0l 80 74 Wp t OxOOFFEFBS 00 OO 10 36 OO OO 04 IE 6 Figure 5 34 Monitor Window During user program ex
316. les Exclude Build dbsct c Version Control r Configure View Show Differences v Allow Docking Hide Properties Figure 2 5 Projects Tab Pop up Menu Remove Project Files Project files Cancel demo c c hew initset c c hew demo demo intprg stc c Shew demodemo Remove fesetprg stc c hew demo demo sbrk c c S hew demo demo stacksct src c hew demo demo Remove alll vecttbl src c hew demo demo Mai Figure 2 6 Remove Project Files Dialog 15 RENESAS 2 Select the file or files which you want to remove from the Project files list 3 Click the Remove button to remove the selected files or click Remove All to remove all project files 4 Click OK to remove the files from the project gt To remove selected files from a project 1 Select the files which you want to remove in the Projects tab of the Workspace window Multiple files can be selected by holding down the SHIFT or CTRL key 2 Press the DEL key The files will be removed 2 2 3 Excluding a Project File from Build A file in a project can be individually excluded from build on a configuration by configuration basis gt To exclude a file in a project from build 1 Push the right mouse button on a file which you want to be excluded from build in the Projects tab of the Workspace window 2 Select Exclude Bui
317. les of a certain type produced by one phase referred to as the source phase to another phase referred to as the destination phase Such intermediate files are passed in addition to the project files gt To add a file mapping 1 2 Click Add The Define File Mapping dialog will be invoked figure 3 17 Select the file group which you want to pass between the phases from the File group drop down list box Select the source phase i e which phase generates the files from the Source phase drop down list box Select the destination phase i e which phase takes these files from the Destination phase drop down list box Click OK to create the new mapping Define File Mapping Fie soup Object file ta Cancel Source phase SH Assembler ba Destination phase ie Figure 3 17 Define File Mapping Dialog gt To modify a file mapping 1 56 Select the mapping to be modified 2 Click Modify button The Define File Mapping dialog will be invoked figure 3 17 3 4 Click OK to commit the changes Modify the options as necessary RENESAS 3 6 Controlling the Build By default the High performance Embedded Workshop will execute all of the phases in a build and only stop if a fatal error is encountered You can change this behavior by setting the controls on the Build tab of the Options dialog figure 3 18
318. lication wide tools which will be available to all of your workspaces Or whether you wish to add a workspace wide tool Workspace wide tool which is only valid for the current workspace Once you have made the choice choose the relevant section of the dialog Customize Toolbars Commands Menu Placeholders Debugger Log Help Application wide tools CE add il Modify Remove Workspace wide tools Hitachi Mapview Add Hw 1 0 Hitachi H Series Librarian Interface Id Modify 11 Hitachi Call walker Remove Bi Ge Re bo 116 Figure 6 4 Customize Dialog Menu Tab Click the Add button the dialog shown in figure 6 5 will be invoked If you would like to add an existing system tool to the menu then select the Select from existing system tools radio button choose the tool from the drop down list and then click OK Enter the name of the tool into the Name field Enter the command excluding arguments into the Command field Enter any arguments that you would like to pass to the command into the Arguments field Enter an initial directory in which you would like the tool to run into the Initial directory field Click OK to add the menu option to the Tools menu RENESAS Add Tool 24 xi Define new user tool OK Tool details Eancel Name E xplorer Command StWINDIF exp
319. list and then click the Modify button beside the list The dialog shown in figure 8 4 will be displayed The title of the dialog is Modify Menu Option 3 Modify the commands as necessary and then click OK 4 Close the Version Control Setup dialog by clicking OK gt To change the ordering of version control menu options 1 Select Version Control gt Configure The dialog shown in figure 8 1 will be displayed 2 Select the menu option to be moved and then click the Move up and Move down buttons as necessary 3 Close the Version Control Setup dialog by clicking OK 138 RENESAS 8 2 Defining Version Control Commands Commands are defined when the Add or Modify buttons are clicked on the dialogs shown in figure 8 3 and figure 8 4 In either case the dialog shown in figure 8 5 is invoked Add Command 2 xi r Command Version control executable Jv WSSMWIN32 Ss exe Browse Arguments History CDIRJ FILENAME Y USERNAME PASS gt Initial directory SiFILEDIR D Browse Executable return code di Retum code of executable is not meaningful Command has failed if the return code is N ot Equal To v fo Figure 8 5 Add Modify Command Dialog To define a command 1 Enter the full path of the command into the Version control executable field or browse to it graphically
320. ll files under your specified directory Directory to export to must be empty or not exist Export D Hew3 Export 7 i ancel Figure 5 21 Export Custom Project Generator Dialog 111 RENESAS This will export the required files along with a Setup exe file which can be then be executed on another HEW This will ask the location of the new users HEW and when Install is clicked the project generator will be added to their HEW system 2 Install custom generator What is the location of the HEW executable CAHewS H EW exe Browse Cancel Figure 5 22 Install custom generator Dialog Once completed the project type will appear in the new workspace dialog Note A custom project generator can only be used in a HEW which is the same or greater version If you attempt to use the project generator in an old HEW an error message will be reported If your project generator contains a different toolchain to the destination HEW then this will be upgraded when the project is first created 112 RENESAS 6 Customizing the Environment 6 1 Customizing the Toolbar The High performance Embedded Workshop provides 2 standard toolbars as detailed in chapter 1 Overview In addition to these you may also construct your own toolbars via the Customize dialog figure 6 1 Toolbars Commands Menu Placeholders Debugger Log Help Toolbars V Show Tooltips New
321. log is dismissed and the chosen template is added to the current editor window Note It is also possible to use the defined keyboard shortcut or drag the template from the templates view 91 RENESAS 4 12 4 Brace Matching Complicated source code can often become unwieldy especially when blocks of C code are deeply nested within each other or when complex logic statements are expressed within an if clause To help in such situations the High performance Embedded Workshop editor provides a match brace feature which highlights text between braces of type and gt To find a matching brace 1 Either highlight the open brace to match from or place the cursor before it 2 Click the match braces toolbar button press SHIFT CTRL M select Edit gt Match Braces or select Match Braces from the local menu To check the structure of an entire file place the cursor at its start and then repeatedly invoke the match brace operation The editor will successively highlight each pair of braces in turn until there are no more to match 92 RENESAS 4 13 Editor Column management The editor in HEW has the ability to manage columns apart from the main editor column These can be added and used by debugger feature You can choose the column to display undisplay tutorial c E include lt no_float h gt include lt stdio h gt include lt math h gt include lt stdlib h gt void main void void so
322. lorer exe gt Browse Arguments 2 Initial directory s TEMPDIR LP Browse Select from existing system tools Figure 6 5 Add Tool Dialog New menu options are added to the bottom of the list i e bottom of the tools menu The order of menu options in the Tools menu can also be modified gt To modify a menu option 1 Select Tools gt Customize The dialog shown in figure 6 1 will be displayed Select the Menu tab see figure 6 4 2 Select the menu option that you would like to modify and then click the Modify button 3 Make the desired changes on the Modify Tool dialog figure 6 6 and then click OK ModifyT ool 2 x Cancel Command EINDIR explorer exe gt Browse Arguments gt Initial directory S TEMPOIR D Browse Figure 6 6 Modify Tool Dialog gt To remove a menu option 1 Select Tools gt Customize The dialog shown in figure 6 1 will be displayed Select the Menu tab see figure 6 4 2 Select the menu option that you would like to remove and then click the Remove button 117 RENESAS 6 3 Configuring the Help System The High performance Embedded Workshop provides context sensitive help within the editor window In other words if you select some text in the editor window and then press F1 the High performance Embedded Workshop will attempt to locate help on that selected item The help
323. ls or Action page Address Set address conditions Adderess Lo Select a single address where a PC breakpoint will be set 282 RENESAS 5 15 7 Setting Event Points On the Event sheet the settings for event points are displayed modified and added Address H O0000106A Tutorial cpp 37 address bus prefetch Trace Enable Address H OO00107E Tutorial cpp 45 address bus prefetch Trace Enable Address H 000010A40 Tutorial cpp 49 address area ROM Trace Enable Address H 00001140 address area ROM Trace Eupty Enpty Enpty Enpty Enpty Empty Figure 5 60 Event Window Event Sheet Select Add or the event point displayed in this window and then select Edit from the popup menu to display the Breakpoint Event Properties dialog box The conditions for the event point are set on the General Bus Area Signals and Action pages The search condition for the event point is set by multiple conditions set on these pages Notes 1 Channel 8 has the trigger output function When the condition on channel 8 is satisfied the low level signal will be output from the external probe 1 EXT1 for a bus cycle 2 When the event point is used as the condition for acquiring the trace information select Trace Acquisition from the popup menu For the trace function refer to section 5 16 Viewing Trace Information 3 If a condition that is unavailable for a range channel is set in editing of the range chan
324. lt Clicking OK opens the Memory window 277 RENESAS 5 14 4 Locals Window The local variables and their values can be displayed in the Locals window Opening the Locals Window To open the Locals window choose View gt Symbol gt Locals or click the Locals toolbar button f 00 lona 1 0 i H OOffef80 ER5 long i H 000a R4 int p_sam Ox00ffbOd8 ERE class Sample Figure 5 57 Locals Window If a local variable is not initialized when defined then the value of the local variable will be incorrect until another value is assigned to the local variable The local variable values and the radix for local variable display can be modified in the same manner as in the Watch window 278 RENESAS 5 15 Using the Event Points The emulator has the event point function that performs breaking tracing and execution time measurement by specifying higher level conditions along with the PC breakpoints standard for the HEW 5 15 1 PC Breakpoints When the instruction of the specified address is fetched the user program is stopped Up to 256 points can be set Note that however only one PC breakpoint can be set in the ROM area of the user system This particular breakpoint is called the on chip breakpoint which stops the user program after executing the instruction of the specified address When it is necessary to set two or more PC breakpoints to the external ROM area of
325. luation o User system chip 470 interface cable Figure 7 55 User System Interface Circuit for P70 ANO to P77 AN7 AVcc and AVss Evaluation chip User system interface cable 27 KQ Figure 7 56 User System Interface Circuit for AVcc and AVss 404 RENESAS P20 to P27 Evaluation User system chip interface cable Figure 7 57 User System Interface Circuit for P20 to P27 V1 V2 and V3 Evaluation User system chip interface cable Figure 7 58 User System Interface Circuit for V1 V2 and V3 7 3 10 User System Interface Circuits of the H8 3637 H8 3877 Group Evaluation Chip HS3876EVI60H All user system interface signals are directly connected to the evaluation chip in the emulator with no buffering except for those listed below which are connected to the evaluation chip through control circuits e RES e NMI H8 3877 group only e OSCI e XI e TEST The circuits that interface the evaluation chip in the emulator to the user system include pull up resistors that cause signal delays Note that when an input terminal is in the high impedance state the pull up resistor forces the terminal to be at a high level Adjust the user system hardware to compensate for these effects The delay caused by the user system interface cable is about 3 ns The following diagrams show the user system interface signal circuits Default Evaluation chip o User system 479 interface cable Figure 7 59 Def
326. lue As ansi character T Bytes Count For One Line 16 Byte Figure 5 18 Format Dialog Box Enter the range you want to display as an address value or an equivalent symbol in the Begin and End fields Select the data size and format for the display from the Display Value As and Format drop down lists respectively Select the number of bytes displayed in one line from the Bytes Count For One Line drop down list Click the OK button or press the Enter key and the dialog box closes and the Memory window opens The display can be scrolled within the range of the entered display start and end addresses 237 RENESAS Figure 5 19 Memory Window Note Each item in the n column is called as the memory unit There are three display columns Address First address of the memory data displayed on this row n Memory data read from Address and n means the offset value from the first address of the row Data is read from the debugging platform s physical memory in the access width and then converted to the display width Value Data displayed in an alternative format 5 5 2 Displaying Data in Different Formats If you want to change the display format of the Memory window select Format from the popup menu The dialog box shown in figure 5 20 is displayed H 000000FF Format Byte x1 m Display Value As fansi character Bytes Count For One Line 16 Byte
327. lug the cable body into the emulator e Plug the cable body into the cable head For details of these steps refer to the User System Interface Cable User s Manual Figure 2 2 gives details of the connectors provided on the emulator PC interface cable connector User system interface cable connector Power connector External probe lt _ _ _ Power switch connector Figure 2 2 E6000 Emulator Connectors 2 3 1 Example of Connecting the User System Interface Cable Head to the User System Screw x 4 User system interface cable head Figure 2 3 Example of Connecting User System Interface Cable Head to User System e Ensure that all power is off to the emulator and the user system e Insert the cable head into the socket on the user system Note Depending upon the package it may be possible to orientate this cable head in any position on the socket so care should be taken to correctly identify pin 1 on the emulator and socket when installing 184 RENESAS e Screw the cable head to the socket with the screws provided Progressively tighten the screws in the sequence shown in figure 2 4 until all are finger tight Figure 2 4 Sequence of Screw Tightening Note Be careful not to over tighten the screws as this may result in contact failure on the user system or damage the cable head Where provided use the solder lugs on the QFP socket to provide extra strengt
328. map can be used as an external address area when the RAME bit of the SYSCR is cleared to 0 On Board or Emulator can be specified for this area with the Configuration settings 2 Ifthe reserved area other than that described in item above is used the operation in the actual MCU cannot be guaranteed If the user program extends to the reserved area during debugging select the MCU having the largest memory capacity for example debug the H8 3332 program in the H8 3334 mode e Use of Internal RAM Area as External Memory The internal RAM area cannot be used as an external address area even when the RAME bit of the SYSCR is cleared to 0 e User Program Execution by the Go Reset Command When the user program is executed by the Go Reset command a reset signal is input for about 16 to 17 system clock cycles to the evaluation chip from the emulator For the execution time measurement result the time for reset signal input is added 426 RENESAS 8 2 6 Notes on Use of the H8 3257 H8 325 Group Evaluation Chip Set HS3257EVI60H e I O Register Differences Between Actual MCU and Emulator In the E6000H emulator one evaluation chip emulates several types of MCU Therefore there are some differences in I O registers between an actual MCU and the emulator as shown in table 8 17 Note these differences when accessing the I O registers T O port is in the input state at default The I O register contents indicate the emulator port status When
329. mbo box and enter the data value in the Data field On clicking the OK button or pressing the Enter key the dialog box closes and the new value is written into the memory range 5 5 9 Copying a Memory Area You can copy a memory area using the memory copy function Select Copy from the popup menu of the Memory window or from the Memory drop down menu The Copy Memory dialog box is opened figure 5 24 Destination Format Byte amp 1 z P Verify Figure 5 24 Copy Memory Dialog Box 241 RENESAS The source start address and end address selected in the Memory window will be displayed in the Begin and End fields Checking the Verify check box enables copying while comparing the copy source and copy destination The copy unit can be selected in the Format combo box Enter the destination start address in the Destination field and click the OK button or press the Enter key This will close the dialog box and copy the memory block to the new address 5 5 10 Saving and Verifying a Memory Area A memory area in the address space can be saved into a disk file using the memory save function Open the Save Memory As dialog box by choosing File gt Save memory Binary id Cancel File name Start address H ooo00000 End Address HIDOOFFFFF Access size M Figure 5 25 Save Memory As Dialog Box Enter the start and end addresses of the memory block
330. ment by an event channel Starts a point to point range trace Ends a point to point range trace B Halts trace These are also set by using the popup menu EXT 2 Trigger column The EXT 2 Trigger column displays the following items ha EXT 2 1 trigger condition tm EXT 2 2 trigger condition ha EXT 2 3 trigger condition hs EXT 2 4 trigger condition H Two or more EXT 2 trigger conditions It is also possible to set them by using the popup menu Editor column Editor column displays the following items BG A bookmark is set A PC Break is set 5 gt PC location 227 RENESAS gt To switch off a column in all source files Right click on the Editor window or select the Edit menu Click the Define Column Format menu item The Global Editor Column States dialog box is displayed A check box indicates whether the column is enabled or not If it is checked the column is enabled If the check box is gray the column is enabled in some files and disabled in others Deselect the check box of a column you want to switch off Pe ee 5 Click the OK button for the new column settings to take effect Global Editor Column States IEXT 2 Trigger VJE vent Editor Cancel VlSource Address Figure 5 7 Global Editor Column States Dialog Box gt To switch off a column in one source file 1 Click the right hand mouse button on the Editor window which contains the column you wan
331. most Windows applications and they can be found under the Window menu e Window gt Cascade Arrange all open windows so that they overlap with the top left of each window visible e Window gt Tile Horizontally Arrange all open windows in sequence horizontally so that they occupy the entire editor window with no overlapping edges e Window gt Tile Vertically Arrange all open windows in sequence vertically so that they occupy the entire editor window with no overlapping edges e Window gt Arrange Icons Line up all minimized windows at the bottom of the editor window e Window gt Close All Close all open editor windows The files within the editor can be displayed in a notebook style This means that each file has a separate tab associated with it to aid in navigating between files gt To show files in notebook 1 Select Tools gt Options The Tools Options dialog box will be displayed Select the Editor tab 2 Set the Show files in notebook check box as appropriate 3 Click OK for the new settings to take effect 4 2 1 The Editor Toolbars The editor has four related toolbars Editor Search Bookmarks and Templates They provide a shortcut to the functions of the editor which you will use most often The following sections describe each buttons function 4 2 2 Editor Toolbar Buttons O New File The new file button creates a new source file window with a default name Wh
332. mponents The HEW version 3 0 onwards has the concept of on demand components These components are not automatically loaded by the application or the debugger component These components can be loaded by the user or as part of the project generation process gt To load or unload an on demand component manually 1 Click the Project gt Components menu item 2 The component gallery dialog is displayed This is displayed in figure 5 14 3 Select the component you wish to load Click the load button The components image should change to the loaded state 4 If you wish to unload a component Select the component Click the unload button The components image should change to the unloaded state 5 Click OK to verify the changes Component Gallery x Project 44 Application Extensions ITRON component eres ma Loaded component DSEK component Cancel Custom memory view component Pin view component Unloaded component Intermediate state component Load il Unload Figure 5 14 Component Gallery Note Each project in your workspace can have different components loaded and unloaded If you have multiple projects you can use the Multiple projects and All projects items to change a components load status over more than one project If you select a combination which means the component is loaded in one project and not anther then the intermediate state icon is di
333. n R mark is displayed in bold face the value of the corresponding variable will be updated in realtime during user program execution A popup menu containing the following options is available in the Watch window e Auto Update Marks the selected variable with a bold R and updates the variable in real time e Auto Update All Marks all variables with bold Rs and updates all variables in real time e Delete Auto Update Marks the selected variable with an outlined R and cancels realtime update e Delete Auto Update All Marks all variables with outlined Rs and cancels realtime update Modifying the Radix The radix for the selected variable display can be modified by choosing Radix from the popup menu Saving the Watch Window Contents in a File To save the contents of the Watch window choose Save As from the popup menu the Save As dialog box opens It allows the user to specify the name of a file and to save the contents of the Watch window in the file If the Append check box is selected the window contents are appended to the existing file and if it is not selected the existing file is overwritten Opening a Memory Window The contents of the memory area to which the selected variable is assigned can be displayed in the Memory window Choose Go To Memory from the popup menu the Set Address dialog box opens showing the information start address end address and size of the selected variable as defau
334. n be updated during user program execution For updating of the content of the variable that has been registered in the Watch window there are the following three methods 1 Use the Monitor function without halting the user program The read write signal of the MCU is set as a trigger and holds the address bus and data bus values to update the value of the variable Note Although the realtime operation is retained the size and number points to be monitored are limited For the Monitor function refer to section 5 9 Displaying Memory Contents in Realtime 2 Read the memory content directly from the HEW to update the values without halting the user program since the bus mastership is owned by the emulator Note While the emulator reserves the bus mastership the realtime operation is disabled because the CPU stops operation This method is only available for accessing the internal ROM internal RAM and emulation memory The area used here or this method may not be available depending on the emulator in use For details refer to section 8 Software Specifications Specific to This Product or Enable read and write on the fly on the General page of the Configuration Properties dialog box in the online help 3 Temporarily stops the user program and reads the memory contents Note The realtime operation is disabled because the user program is stopped temporarily This method is only available for accessing the areas internal I O DTC
335. n of your application s code This section describes how to do this directly by using the Stop button and by setting breakpoints at specific locations in your code 5 12 1 Stopping the Program by the Stop Toolbar Button When your program is running the Stop toolbar button is enabled a red STOP sign and when the program has stopped it is disabled the STOP sign is grayed out Click on the Stop toolbar button or choose Debug gt Halt Program When the program has been stopped by Stop User Break is displayed in the Debug sheet of the Output window 5 12 2 Standard Breakpoints PC Breakpoints When you are trying to debug your program you will want to be able to stop the program running when it reaches a specific point or points in your code You can do this by setting a PC breakpoint on the line or instruction at which to want the execution to stop The following instructions will show you how to quickly set and clear simple PC breakpoints If more complex breakpoint operation is required use the Event window which can be opened by clicking the B button or choosing View gt Code gt Eventpoints For details refer to section 5 15 Using the Event Points e To set a PC breakpoint in the Source window 1 Make sure that the Disassemble or a Source window is open at the place you want to set a PC breakpoint 2 Choose Toggle Breakpoint from the popup menu or press F9 at the line showing the address
336. n on the Trace window displays a popup menu Select Acquisition from this menu to display the Trace Acquisition dialog box Trace Acquisition Figure 6 41 Trace Acquisition Dialog Box 366 RENESAS 2 Register an address as an event condition for trace acquisition Click the Add button in the Trace Events group box on the General page to display the Breakpoint Event Properties dialog box Breakpoint Event Properties General Bus Area Signals Action Type Address 21xi C PCBre Address Hi ak Don tCare Address Range AddressLo 0000000 r Data Compare Direction I Compare J Use Mask C Read Value j ahi C White o Byte oe Word tsk DT Ether Figure 6 42 Breakpoint Event Properties Dialog Box 3 Use the Source window to refer to the address on the line that has a i j within the tutorial function and enter this address in the Address Lo edit box of the Address group box on the General page of the Breakpoint Event Properties dialog box In this example enter H 0000105c This address has thus been set Click the OK button to close the Breakpoint Event Properties dialog box Breakpoint Event Properties General Bus Area Signals Action Type Address C PCBreak Dont Care Address Range Address Lo Dai H 0000105C Address Hi F o0000000 F Outsi
337. n usage of the emulator 8 2 1 Environment for Execution of the Tutorial Program To execute the tutorial program specify Tutorial hws stored in the following directory HEW installation destination directory Tools Renesas DebugComp Platform E6000 300 Tutorial 8 2 2 Notes on Use of the H8 300 Group Evaluation Chip Set HS3308EVI60H e T O Register Differences Between Actual MCU and Emulator In the E6000H emulator one evaluation chip emulates several types of MCU Therefore there are some differences in I O registers between an actual MCU and the emulator as shown in table 8 14 Note these differences when accessing the I O registers The I O port is in the input state at default The I O register contents indicate the emulator port status When the user system interface cable is not connected the read value is 1 due to pull up resistors When 0 is written to the T O register with no user system interface cable connected the voltage level of the I O port reaches 2 0 V in approximately 10 us and the read value becomes 1 Table 8 14 Differences in I O Registers V O Address H8 330 Group Note FFDF X FFE9 X Accessing these registers will change the contents of the A D FFEB X converter control register Do not access these registers Note X indicates that a register that does not exist in the actual MCU can be accessed in the emulator Access to the Reserved Area When accessing the reserved area note the following
338. n with read or write cycles Read Sets read cycles as the condition Write Sets write cycles as the condition Either Sets either read or write cycles as the condition 285 RENESAS 2 Bus Area page Use this page to set the bus status and the memory area being accessed Breakpoint Event Properties 2 x General Bus Area Signals Action Bus State Area F CPU Prefetch M On chip ROM M CPU Data F On chip RAM M On chip 1 0 16 bit F DMAC F On chip l 0 8 I DIC P External 16 b F Other I External I DTC RAW Don t Care Figure 5 62 Breakpoint Event Properties Dialog Box Bus Area Page Bus State Sets the bus status as the condition When the Don t care check box is checked the event will be satisfied with any bus status Area Specifies the area for searching When the Don t care check box is checked the event will be satisfied in any area Note Items set for the bus state and memory access area vary according to the emulator in use For details refer to section 5 15 4 Signals to Indicate Bus States and Areas 286 RENESAS 3 Signals page Use this page to set external signals Breakpoint Event Properties q 2 x General Bus Area Signals Action Probe 4 m Probe 3 High High C Low C Low 2 Don t Care m Probe 2 Probe 1 High C High C Low C Low Don t Care Don t Care Figure 5 63
339. nal debugger Once this has been selected the external debugger must be configured gt To use the HDI 1 Sets the location of the HDI executable This must be version HDI 4 0 or greater otherwise its behavior is not guaranteed 2 Sets the location of the session file This tells the HDI which session to load when it is launched 3 Sets the location of the download module Customize Toolbars Commands Menu Placeholders Debugger Log Help External debugger selected Hitachi Debugger Interface version 4 x or greater a m Debugger settings HDI location gt Browse Session file Cn Download module gt Browse Cancel Figure 3 22a External debugger selected HDI 60 RENESAS gt To use the PD debugger 1 Sets the location of the PD debugger executable 2 Sets the location of the PD profile file This tells the PD debugger which session to load when it is launched 3 Sets the command line option This field allows additional options to be specified which can modify the behavior of the external debugger 4 Sets the location of the download module Customize Toolbars Commands Menu Placeholders Debugger Log Help External debugger selected Mitsubishi PD debugger r Debugger settings PD debugger location Po Brows PD profile file location DO Browse Command line options gt Download modu
340. nce Embedded Workshop provides specific support for the Visual SourceSafe version control system At the time of writing the HEW can only attach to versions 5 0 and 6 0 of Visual SourceSafe The Visual SourceSafe version control system associates a project in your workspace with a project inside a Visual SourceSafe database It allows you to quickly invoke the standard commands either by selecting an option from the Tools gt Version Control sub menu or by clicking a version control toolbar button 9 1 Attaching Visual SourceSafe to a Workspace The following sections describe how you can associate Visual SourceSafe with your current workspace 9 1 1 Selecting Visual SourceSafe First you need to select Visual SourceSafe as the version control system gt To use Visual SourceSafe 5 0 or 6 0 1 Select Tools gt Version Control gt Select The Select Version Control System dialog will be displayed figure 7 3 which lists all of the supported version control systems 2 Select the Visual SourceSafe 5 0 6 0 entry from the Version Control Systems list and click the Select button 3 Click OK to confirm the selection The SourceSafe Login dialog is displayed figure 9 1 4 Enter your Visual SourceSafe login into Username and password into Password 5 Enter into Database path the full path to the Visual SourceSafe database i e SRCSAFE INI into which you would like to add this project 6 Click O
341. nd mode and run status e Events sheet Contains information about the current event breakpoint status including resource information Note The items that can be set in this dialog box vary according to the emulator in use For details refer to section 8 Software Specifications Specific to This Product or the online help 248 RENESAS 5 8 Reading and Displaying the Emulator Information Regularly Use the Extended Monitor window to know the changing information on the emulator no matter the user program is running or halted Note The Extended Monitor function does not affect the execution of the user program since it monitors the user system or the signal output from the MCU in the emulator by using the emulator s hardware circuit 5 8 1 Opening the Extended Monitor Window Selecting View gt CPU gt Extended Monitor or clicking the Extended Monitor toolbar button E displays this window The interval of updating the display is approximately 100 ms during user program execution or 1 000 ms while breaking respectively xtended Monitor Item Value User Standby Inactive User NMI Inactive User Reset Inactive User Wait Inactive User System Voltage OK User System Voltage Dow User Cable Not Connected Running status Break Ready ROM Write No Target Mode Target Clock No Clock Target Sub Clock No Clock Figure 5 31 Extended Monitor Window 249 RENESAS 5 8 2 Selecting Items to
342. nd address of non in 2 BTBL n BTBL n pr p n all osackan ti Ren secend RM le ajai nel Figure 11 1 Difference view gt To perform a difference comparison with two files on your local drive Select Tools gt Show Differences The difference compare files dialog is displayed This is shown in figure 11 2 Ensure the compare with file on drive radio button is enabled 3 Enter the first and second file to compare You can either select a previous difference comparison or browse to a new file 4 Clicking the advanced button displays the dialog in figure 11 3 This allows you to perform the difference comparison without taking white space into account Click OK when you are finished with this options dialog 5 Click compare 6 The difference view is displayed The two files being compared are loaded into each side of the split view Their names are at the top of each window gt To perform a difference comparison with a local file and a file in SourceSafe 1 Ensure the SourceSafe component is enabled Also note that the file must be have been added into the version control system 2 Select Tools gt Show Differences The difference compare files dialog is displayed This is shown in figure 11 2 3 Ensure the compare with version control radio button is enabled 163 RENESAS 4 Enter the first file to compare You can either select a previous difference comparison or browse to a n
343. ne number of template insertion Time TIME Current time Date text DATE_TEXT Current date in text form Date day month year DATE_DMY Current date in dd mm yy form Date month day year DATE_MDY Current date in mm dd yy form Date year month day DATE_YMD Current date in yy mm dd form User name USER Current windows user Cursor position CURSOR Insertion cursor Positions the cursor in this position after template has been inserted 7 Enter the CURSOR character to specify where the insertion cursor is to be placed after the template has been inserted If this is not specified then the insertion cursor will be placed after the last character in the template as in a normal paste operation User Input When defining a template it is possible to define a user input field Using the following placeholder specifies this USERINPUT lt n 1 10 gt lt some text gt The n is a number which identifies the user input identifier These placeholders can be added manually but the user input button on the define templates dialog adds these placeholders in an automated manner When the template is inserted into a file a dialog is displayed which allows you to enter some custom text for each of these fields This text is then inserted instead of the placeholder You can define ten of these user input fields Figure 4 15 shows a list of templates which is located on the Templates tab of the Workspace window 90
344. nels Ch9 to Ch12 the selected channel is automatically replaced by an unused event channel Ch1 to Ch8 Table 5 3 Conditions Unavailable for a Range Channel Condition Related Options Selecting outside the Outside Range on the General page specified address range Selecting the start or Start Timer and Stop Timer on the Action page end of the execution time measurement Specifying the count Required number of event occurrences on the Action page when an event occurs twice or more Specifying sequencing Enable Sequencing on the Action page 283 RENESAS 1 General page The address and data conditions are set Breakpoint Event Properties 2 x General Bus Area Signals Action Type Address C PCBreak Don tCare Address C Range AddressLo o0000000 Address Hi J Outside Range m Data Compare Direction I Compare J Use Mask C Read Value fr 9 z C write Bute Word Mask fo Either Figure 5 61 Breakpoint Event Properties Dialog Box General Page Type Select the type of a breakpoint Note that the Breakpoint Event Properties dialog box is used for setting PC breakpoints and event points Selecting a particular type of breakpoint enables or disables other pages and parts of the dialog according to the options available to that type of breakpoint PC Break Only a single address with a program fetch can be selected Oth
345. nfiguration file name is the end of the emulator settings Complete the creation of a new workspace according to the instructions on the screen This activates the HEW 5 After the HEW has been activated connect the emulator However it is not necessary to connect the emulator immediately after the HEW has been activated Select either of the following two ways to connect the emulator connecting the emulator after the setting at emulator activation or without the setting at emulator activation For details on the connection of the emulator refer to section 4 5 Connecting the Emulator 208 RENESAS 4 2 3 Selecting an Existing Workspace 1 In the Welcome dialog box that is displayed when the HEW is activated select Browse to another project workspace radio button and click the OK button Welcome m Options OK Create a new project workspace Cancel lkt 2 Open a recent project workspace Administration zi Figure 4 11 Welcome Dialog Box 2 The Open Workspace dialog box is displayed Select a directory in which you have created a workspace After that select the workspace file hws and press the Open button Open Wo Look in 9 sample c em sample File name sample hws Files of type Workspaces hws ba Cancel 2 Figure 4 12 Open Workspace Dialog Box 3 This activates the HEW and recovers the state of the selected workspac
346. nformation as a total system before making a final decision on the applicability of the information and products Renesas Technology Corp assumes no responsibility for any damage liability or other loss resulting from the information contained herein Renesas Technology Corp semiconductors are not designed or manufactured for use in a device or system that is used under circumstances in which human life is potentially at stake Please contact Renesas Technology Corp or an authorized Renesas Technology Corp product distributor when considering the use of a product contained herein for any specific purposes such as apparatus or systems for transportation vehicular medical aerospace nuclear or undersea repeater use The prior written approval of Renesas Technology Corp is necessary to reprint or reproduce in whole or in part these materials If these products or technologies are subject to the Japanese export control restrictions they must be exported under a license from the Japanese government and cannot be imported into a country other than the approved destination Any diversion or reexport contrary to the export control laws and regulations of Japan and or the country of destination is prohibited Please contact Renesas Technology Corp for further details on these materials or the products contained therein IMPORTANT INFORMATION READ FIRST e READ this user s manual before using this emulator product KEEP the user s ma
347. ng microcomputers e H8 330 group e H8 350 group e H8 338 and H8 329 groups e H8 3334 group e H8 3257 and H8 325 groups e H8 3437 H8 3337Y H8 3297 H8 3522 and H8 3534 groups e H8 3217 H8 3318 and H8 3502 groups e H8 3834 and H8 3814 groups e H8 3637 and H8 3877 groups e H8 3927 group e H8 3857 group e H8 3854 group e H8 3657 and H8 3644 groups 7 1 1 Supported Items Table 7 1 lists device groups supported by different combinations of the E6000 emulator evaluation chip and expansion I O board Table 7 1 Hardware Combinations E6000 Emulator Evaluation Chip Expansion I O Board Supported Device Group HS3008EPI60H HS3308EVI60H H8 330 group HS3508EVI60H H8 350 group HS3398EVI60H H8 338 and H8 329 groups HS3334EVI60H H8 3334 group HS3257EVI60H H8 3257 and H8 325 groups HS3437EVI60H H8 3437 H8 3337Y H8 3297 H8 3522 and H8 3534 groups HS3318EVI60H H8 3217 H8 3318 and H8 3502 groups HS3LO8EPI60H HS3834EVI60H H8 3834 and H8 3814 groups HS3834EVI60H HS3857EIO60H H8 3857 group HS3834EVI60H HS3854EIO60H H8 3854 group HS3876EVI60H H8 3637 and H8 3877 groups HS3927EVI60H z H8 3927 group HS3644EPI60H H8 3657 and H8 3644 groups For notes on the user system interface cables and the expansion I O board refer to the user s manual provided for each of them See the development support tool catalog for the MCU type names and packages supported by the E60
348. nitor Window ccc ceee cece cesses cseceeeetseeesseeessesaeees 251 3592 Changing the Monitor Settings c cccccssscrecsoasaecssoseveconecssassaetsvasssbeanseeavesnessantoucses 253 5 9 3 Temporarily Stopping Update of the Monitor eeeeeeeeeeeeeeeees 253 5 9 4 Deleting the Monitor Settings 0 cece cece cces cee ceeeeceseeseeseeeesesseeeeaeeas 253 59 5 SMOnilOrin Variables siccsesscecsteedvsicdssssescsessvvacsvocesssseocossesoeserseayseotensusecneus event cute 253 5 9 6 Hiding the Monitor Window cccessecesceseeseeseeseeaeeeeeeseeseeaeeaeceeeeaeeaeeaeeaeeats 254 5 9 7 Managing the Monitor Window eee eee ee caeeeceeeeeesseesesetaeeeeeeeas 254 Viswins the Labels erriren rea a EATEN ETE 256 Dsl Ode Listing Labels avc csacccesscactonssuaccasssnesdeastvossscsvesnseastvstcvccusnsssespnassapus EEIEIIE 256 3 10 2 Adding a Label sieele cirerer ien aN ses Nean ENES EKOE ovis 257 DOG Editing a Label sic viscccssssnccrscounsnezscsnonescoumsuestavcsueseodevseanedevasasoestasienenteass vestesseseatends 257 5 104 Deleng a Label iscscccsssanvcsausesscssunenccdesvesqcdevacnsseoveat sooknasdansdastcaossassgeossasedsongensces 258 5 103 Deleting All Lapel Sstssisscuniiinisnenn ius ieee EKEN a 258 5 10 6 Loading Labels from a File ccscsscscssosssecsssessscsstecseesesecsesesesssseeseseenenaonenss 259 SIGT Saving Labels Into a Filesre eronneita a 259 5 10 8 Searching fora Lapel s ycccesivesisssensnescoswsessavessestonslecsessessoaeseetacisseo
349. nkage symbol file E Assembly include file C Preprocessed C source file Assembly list file as HEW Sample Text Cancel 2 2 Figure 4 10 Format Views Dialog Font Tab 86 RENESAS 4 11 Syntax Coloring To enhance code readability the HEW editor can display specific strings i e keywords in different colors For instance C source code comments could be shown in green and C types e g int could be shown in blue The coloring method used can be specified on a file group by file group basis For example you can define different color schemes for a C source files text files map files or even your own files gt To change existing colors 1 Select Tools gt Format Views The Format Views dialog will be displayed 2 Select the item underneath the icon in the tree you wish to modify the colour for This should be the file type e g C source file and correct keyword group e g identifier or pre processor 3 Select the Colour tab 4 Modify the Foreground and Background color lists as desired The color SYSTEM refers to the current window foreground and background settings in control panel 5 Click OK for the new colors to take effect gt To create new keyword groups 1 Select Tools gt Format Views The Format Views dialog will be displayed 2 Select the file type in the tree to which y
350. nnected the read value is 1 due to pull up resistors Table 8 19 Differences in I O Registers MCU Group H8 3202 1 0 Address H8 3318 H8 3217 H8 3212 H8 3502 Note FF8F X O O O FF91 A a a a FF9A to FF9E O O O x The TMRX cannot be used in the H8 3202 and H8 3502 FFOF oO O Oo X The timer connection cannot be used in the H8 3202 and H8 3502 FFA1 a O O O FFA4 to FFA7 O O O X The IIC1 cannot be used in the H8 3202 and H8 3502 FFA8 oO oO O X The timer connection cannot be used in the H8 3202 and H8 3502 FFCD to FFCF O O Oo X The PWM cannot be used in the H8 3202 and H8 3502 FFD5 Oo Oo O X The PWM cannot be used in the H8 3202 and H8 3502 FFDF X X X X FFEO to FFE5 O O X O The SCIl1 cannot be used in the H8 3212 FFE7 O X X X FFFO to FFFF O oO X O The HIF cannot be used in the H8 3212 The PWM cannot be used in the H8 3202 and H8 3502 Note O indicates the same specifications as the actual MCU X indicates that a register that does not exist in the actual MCU can be accessed in the emulator A indicates that the initial value of the register differs between the actual MCU and the emulator Access to the Reserved Area When accessing the reserved area note the following 1 Part of the reserved area specified in each MCU s memory map can be used as an external address area when the RAME bit of the SYSCR is cleared to 0 On Board or Emulator can be specified for this
351. nsions list oK Itt ba Cancel m File group Extension belongs to an existing group Absolute file Extension belongs to a new group Text Associated application Open Text with Windows default Fi EMGve Figure 2 9 Add File Extension Dialog New Group 18 RENESAS If you want to create a new extension because your project uses a different extension from those accepted by the HEW For example a phase might by default use the extension asm but the HEW only recognizes src Then you need to create a new extension and add it to an existing file group This process is described below To create a new file extension in an existing file group 1 Select Project gt File Extensions from the menu bar The File Extensions dialog will be displayed figure 2 7 2 Click the Add button The Add File Extension dialog will be displayed figure 2 10 3 Enter the extension which you want to define into the File extension field It is not necessary to type the period character The drop list contains all extensions that are undefined in the current project Selecting one of these extensions will add the text to the file extension field automatically 4 Select the Extension belongs to an existing group option and select which group you would like to add this new extension 5 Click OK to add the extension to the File Ex
352. nsures that only one user can have a writable copy of a controlled file at any one time However it is possible for any user to obtain a read only copy of any file gt To get a read only copy of a file or files from Visual SourceSafe 1 Select the file s which you would like to get from Visual SourceSafe You may also select a file folder project folder a workspace folder or combination thereof 2 Click the Get Files toolbar button amp or select the Tools gt Version Control gt Get Files menu option 153 RENESAS 9 2 3 Checking Out a Writable Copy of a File from Version Control Visual SourceSafe protects your source files and ensures that only one user can have a writable copy of a controlled file at any one time The check out operation takes a writable copy of the file from Visual SourceSafe and places it on your local drive This can only be done if another user does not already check out the file or files in question To check out a writable copy of a file or files from Visual SourceSafe 1 Select the file s which you would like to check out from Visual SourceSafe You may also select a file folder project folder a workspace folder or combination thereof 2 Click the Check Out Files toolbar button S or select the Tools gt Version Control gt Check Out Files menu option 3 When the operation is finished the file has a red tick next to its name This means you as the current user of HEW has checked it out
353. nt to copy a configuration out of the drop down list of the Based on configuration field Click OK on both dialogs to create the new configuration gt To remove a configuration 1 Select Options gt Build Configurations to display the Build Configurations dialog figure 2 16 2 Select the configuration that you want to remove and then click the Remove button 3 Click OK to close the Build Configurations dialog 25 RENESAS 2 6 Building a Project The outline of the build process is shown in figure 2 1 2 6 1 Building a Project The build option only compiles or assembles those files that have changed since the last build Additionally it will rebuild source files if they depend upon a file that has changed since the last build For instance if the file test c include s the file header h and the latter has changed since the last build the file test c will be recompiled gt To perform a build Select Build gt Build or click the build toolbar button or press F7 or click the right mouse button on a project icon in the Projects tab of the Workspace window and select Build from the pop up menu The build all option compiles and assembles all source files irrespective of whether they have been modified or not and links all of the new object files produced gt To perform a build all Select Build gt Build All or click the build all
354. nted hereby under any patents copyrights or other intellectual property rights of Renesas Electronics or others You should not alter modify copy or otherwise misappropriate any Renesas Electronics product whether in whole or in part Descriptions of circuits software and other related information in this document are provided only to illustrate the operation of semiconductor products and application examples You are fully responsible for the incorporation of these circuits software and information in the design of your equipment Renesas Electronics assumes no responsibility for any losses incurred by you or third parties arising from the use of these circuits software or information When exporting the products or technology described in this document you should comply with the applicable export control laws and regulations and follow the procedures required by such laws and regulations You should not use Renesas Electronics products or the technology described in this document for any purpose relating to military applications or use by the military including but not limited to the development of weapons of mass destruction Renesas Electronics products and technology may not be used for or incorporated into any products or systems whose manufacture use or sale is prohibited under any applicable domestic or foreign laws or regulations Renesas Electronics has used reasonable care in preparing the information included in this document
355. ntellectual property rights or any other rights belonging to Renesas Technology Corp or a third party Renesas Technology Corp assumes no responsibility for any damage or infringement of any third party s rights originating in the use of any product data diagrams charts programs algorithms or circuit application examples contained in these materials All information contained in these materials including product data diagrams charts programs and algorithms represents information on products at the time of publication of these materials and are subject to change by Renesas Technology Corp without notice due to product improvements or other reasons It is therefore recommended that customers contact Renesas Technology Corp or an authorized Renesas Technology Corp product distributor for the latest product information before purchasing a product listed herein The information described here may contain technical inaccuracies or typographical errors Renesas Technology Corp assumes no responsibility for any damage liability or other loss rising from these inaccuracies or errors Please also pay attention to information published by Renesas Technology Corp by various means including the Renesas Technology Corp Semiconductor home page http www renesas com When using any or all of the information contained in these materials including product data diagrams charts programs and algorithms please be sure to evaluate all i
356. ntents Selecting Refresh Now from the popup menu immediately updates the window contents 5 18 4 Displaying the Pixel Information Double clicking within the window displays information on the pixel on which the mouse pointer is located in the Pixel Information dialog box Pixel Information Color mode Index Color Pixel Index No 195 Position TERE Buffer Size Width CT Height aa 10 hef Image Size Width Height Figure 5 101 Pixel Information Dialog Box This dialog box displays pixel information on the cursor location Color Mode Displays the format of the image Pixel Displays color information on the pixel under the cursor in decimal notation Position Displays the cursor location as X and Y coordinates in decimal notation X X coordinate of the cursor Y Y coordinate of the cursor Buffer Size Displays the buffer size in decimal notation Width Width of the buffer Height Height of the buffer Image Size Displays the width and height of the display in decimal notation Width Width of the display Height Height of the display 332 RENESAS 5 19 Displaying Memory Contents as Waveforms Memory contents can be displayed as waveforms in the Waveform View window 5 19 1 Opening the Waveform View Window Choose View gt Graphic gt Waveform or click the Waveform toolbar button IEN to open the Waveform Properties dialog box shown
357. ntly hazardous situation which if not avoided will result in death or serious injury A WARNING WARNING indicates a potentially hazardous situation which if not avoided could result in death or serious injury A CAUTION CAUTION indicates a potentially hazardous situation which if not avoided may result in minor or moderate injury CAUTION CAUTION used without the safety alert symbol indicates a potentially hazardous situation which if not avoided may result in property damage NOTE emphasizes essential information lt tENESAS AWARNING Observe the precautions listed below Failure to do so will result in a FIRE HAZARD and will damage the user system and the emulator product or will result in PERSONAL INJURY The USER PROGRAM will be LOST 1 Do not repair or remodel the emulator product by yourself for electric shock prevention and quality assurance 2 Always switch OFF the E6000 emulator and user system before connecting or disconnecting any CABLES or PARTS 3 Always before connecting any CABLES make sure that pin 1 on both sides are correctly aligned 4 Supply power according to the power specifications and do not apply an incorrect power voltage Use only the provided power cable RENESAS CAUTION This equipment has been tested and found to comply with the limits for a Class A digital device pursuant to part 15 of the FCC Rules These limits are designed to provide re
358. nual handy for future reference Do not attempt to use the emulator product until you fully understand its mechanism Emulator Product Throughout this document the term emulator product shall be defined as the following products produced only by Renesas Technology Corp excluding all subsidiary products e Emulator station e User system interface cables e PC interface board e Optional SIMM memory module e Optional board The user system or a host computer is not included in this definition Purpose of the Emulator Product This emulator product is a software and hardware development tool for systems employing the Renesas microcomputer hereinafter referred to as the MCU This emulator product must only be used for the above purpose Limited Applications This emulator product is not authorized for use in MEDICAL atomic energy aeronautical or space technology applications without consent of the appropriate officer of a Renesas sales company Such use includes but is not limited to use in life support systems Buyers of this emulator product must notify the relevant Renesas sales offices before planning to use the product in such applications Improvement Policy Renesas Technology Corp including its subsidiaries hereafter collectively referred to as Renesas pursues a policy of continuing improvement in design performance and safety of the emulator product Renesas reserves the right to change wholly or partially
359. o User system 47 Q interface cable Note 470 kQ pull up resistors are connected to the COM1 to COM4 and SE1 to SEG40 signals When evaluating these signals remove the corresponding pull up resistor network MRGC09X 470kj manufactured by Tama Electric Co Ltd listed in table 7 3 from the socket Only the corresponding resistors must be removed Do not remove any other resistors When installing the removed resistor again into the socket be sure to align pin locations of the resistor and the socket Pin 1 on the a Pin 1 indication on the board MS LU Figure 7 52 Default User System Interface Circuit 403 RENESAS Table 7 3 Resistor Network Numbers 470 kQ Resistor Network Number Number Printed on the Upper Board Signal Name N18 COM1 to COM4 N21 SEG1 to SEG8 N23 SEG9 to SEG16 N15 SEG17 to SEG24 N14 SEG25 to SEG32 N17 SEG33 to SEG40 RES NMI and MD0 These signals are input to the evaluation chip via HD151015 Therefore the rising falling time must be within 8 ns or less User system 472 interface cable HD151015 Figure 7 53 User System Interface Circuit for RES NMI and MDO OSC1 and X1 These signals are input to the evaluation chip via HD151015 Therefore the rising falling time must be within 8 ns or less Vcc 4 7 KQ User system 47Q interface cable HD151015 Figure 7 54 User System Interface Circuit for OSC1 and X1 P70 ANO to P77 AN7 Eva
360. o develop a project by controlling revisions to its source files Figure 7 1 illustrates a typical project where a version control system is in use This shows three users who all use the same shared network drive to exchange source code The version control system provides access and updates to the source files NETWORK Figure 7 1 Version Control 129 RENESAS 7 1 Selecting a Version Control System Initially the version control sub menu will appear as shown in figure 7 2 At this time only the Version Control gt Select option is available because a version control system is not yet active for the current workspace Tools Window Help Administration 14 Change Toolchain version ersion Control Select u Configure Customize Options Fie Add File s tae REMOVE File s Format Views em eames s ee Sy Pai Launch External Debugger oy Gheck Out File s X Launch Slave HEW amp check In File s tatus jle Show Differences Status of Fiels Hitachi Mapview Hitachi H Series Librarian Interface Hitachi Call Walker Figure 7 2 Version Control Sub Menu gt To select a version control system 1 Select Version Control gt Select The dialog shown in figure 7 3 will be displayed This dialog lists all of the sup
361. o measure the rate of execution time The performance analysis function allows the amount of time spent in user selected areas of memory during the last program run to be shown as percentages and as a histogram The E6000 Emulator does not count every access to the specified the performance analysis range it is samples at a rate that is dependent on the host PCs speed 5 20 1 Opening the Performance Analysis Window Choose View gt Performance gt Performance Analysis or click the PA toolbar button to open the Select Performance Analysis Type dialog box Performance Analysis E6000 Performance Analysis Figure 5 105 Select Performance Analysis Type Window Select E6000 Performance Analysis and then click the OK button to open the Performance Analysis window Performance An a Index Name Range Time Count Standby mode Watch mode Medium mode Sub Sleep mode Sleep mode Sub Active mode CPU mode Other Addresses datal H 0000082E H 0000093E Histogram fams K O ae N OOS PRRRRRRRRRRERRRRRRRR 6 D ERRRRRERRRRRRRRRRRR e a a E E a e nynoooooo b olaaa aaa pra Figure 5 106 Performance Analysis Window This window displays the rate of execution time in the area selected by the user during the last program run in percentages histogram or numerical values Note The Performance Analysis window has ranges for performance analysis that cannot be d
362. ode Clock source Main 10MHz Sub 32ZkHz Run status Break Cause of last break PC Break Event Time Count 00h OOmin 00s O00ms OOOus 000ns Run Time Count 00h OOmin 00s O00ms 929us 6Z5ns Figure 6 9 Status Window Note The items that can be displayed in this window differ depending on the product For the items that can be displayed refer to section 8 Software Specifications Specific to This Product or the online help 346 RENESAS 6 7 Reviewing Breakpoints The user can see all the breakpoints set in the program in the Event window e Select Eventpoints from the Code submenu of the View menu The Event window is displayed Select the Breakpoint sheet i Program Enable PC H 00001070 Tutorial cpp 44 Break A gt f Breakpoint A Event A Trigger Figure 6 10 Event Window The popup menu opened by clicking the Event window with the right hand mouse button allows the user to set or change breakpoints define new breakpoints and delete enable or disable breakpoints 347 RENESAS 6 8 Referring to Symbols The Label window can be used to display the information on symbols in modules Select Label from the Symbol submenu of the View menu The Label window is displayed so that the user can refer to the addresses of symbols in modules Ee HL XI BP Address Name H 00000400 PowerON_Reset H 00001000 _sbrk H 00001034 _main H 00001038 tutoriali H 00001104 _
363. office equipment communications equipment test and measurement equipment audio and visual equipment home electronic appliances machine tools personal electronic equipment and industrial robots High Quality Transportation equipment automobiles trains ships etc traffic control systems anti disaster systems anti crime systems safety equipment and medical equipment not specifically designed for life support Specific Aircraft aerospace equipment submersible repeaters nuclear reactor control systems medical equipment or systems for life support e g artificial life support devices or systems surgical implantations or healthcare intervention e g excision etc and any other applications or purposes that pose a direct threat to human life You should use the Renesas Electronics products described in this document within the range specified by Renesas Electronics especially with respect to the maximum rating operating supply voltage range movement power voltage range heat radiation characteristics installation and other product characteristics Renesas Electronics shall have no liability for malfunctions or damages arising out of the use of Renesas Electronics products beyond such specified ranges Although Renesas Electronics endeavors to improve the quality and reliability of its products semiconductor products have specific characteristics such as the occurrence of failure at a certain rate and malfunctions un
364. og will be displayed figure 2 7 2 Click the Add button The Add File Extension dialog will be displayed figure 2 9 3 Enter the extension which you want to define into the File extension field It is not necessary to type the dot character The drop list contains all extensions that are undefined in the current project Selecting one of these extensions will add the text to the file extension field automatically 4 Select the Extension belongs to a new group option and enter a description which defines this new file group 5 At this stage it is possible to change the associated application There are four available choices in the Open with drop list These are listed below e Editor e None e Other e Windows default Tf the editor is selected the open file function in the workspace window causes the file to be opened in the HEW editor If none is selected then the open operation is disabled when the open file function is attempted Selecting Other allows you to configure an another tool for the open file operation See To associate an application with a file group for more details If the Windows default option is selected then the open file function in the workspace window passes the open file to the Windows operating system This then selects the default behavior for this file extension as defined in Windows Explorer 6 Click OK to add the extension to the File Exte
365. ol of state its one character symbol rather than its state indicate each bit Double click on the register s name to display the Register dialog box and switch each bit on or off Checking the box for any bit specifies it as holding a 1 while removing the check specifies it as a 0 Register CCR Imask JUser lmask jHalf carry User Figure 5 15 Expanding a Bit Register 234 RENESAS 5 4 3 Choosing a Register to be Displayed To choose a register to be displayed in the Register window choose Settings from the pop up menu This dialog box is shown in figure 5 16 Settings 21x Registers v VJERI VIER Cancel VIER3 v v v v v v Figure 5 16 Settings Dialog Box 5 4 4 Splitting Up the Window Display To vertically divide the Register window display into two select Split from the pop up menu and move the split up bar 235 RENESAS 5 4 5 Modifying Register Contents To change a register s content open the Register dialog box in one of the following methods e Double click the register you want to change e Select the register you want to change and choose Edit from the popup menu Value H o0000000 Set As Cancel Whole Register Figure 5 17 Register Dialog Box You can enter a number or C C expression in the Value fie
366. ollowing actions e The main function repeatedly calls the tutorial function to repeat sorting e The tutorial function generates random data to be sorted and calls the sort and tutorial functions in order e The sort function enters the array where the random data generated by the tutorial function are stored and sorts them in ascending order e The change function then sorts the array which was sorted in ascending order by the sort function in descending order The file tutorial cpp contains source code for the tutorial program The file Tutorial abs isa compiled load module in the Dwarf2 format Notes 1 After recompilation the addresses may differ from those given in this section 2 This section describes general usage examples for the emulator For the specifications of particular products refer to section 8 Software Specifications Specific to This Product or the online help The operation address of Tutorial abs attached to each product differs according to products Replace the address used in this section with the relevant address in each product after checking that it is placed on the corresponding line of the source program In this tutorial the H8S 2633 E6000 emulator is taken as an example File paths or the appearance of figures differs according to products 339 RENESAS 6 2 Running the HEW Open a workspace by following the procedure listed in section 4 2 3 Selecting an Existing Workspace Select the
367. ols gt Options The Options dialog will be displayed Select the Editor tab figure 6 12 Build Editor Workspace Confirmation Network r Spacing E Tab size 4 V Enable auto indentation r General IV Save files before executing any tools IV Show files in notebook J Prompt before saving files IV Enable syntax coloring V Enable Smart edit for C files JV Enable tooltip watch m External editor J Use extemal editor Modify Figure 6 12 Options Dialog Editor Tab 123 RENESAS 2 Check the Use external editor check box The External Editor dialog will be displayed figure 6 13 External Editor 2 xi Command e WINDOWS Notepad exe Browse OK Arguments to open file Cancel S FULLFILE gt Arguments to open file at line S FULLFILE gt Figure 6 13 External Editor Dialog 3 Enter the path of the executable without any arguments into the Command field 4 Enter the arguments required to open a file into the Arguments to open file field Use the FULLFILE placeholder to represent the path of the file to be opened 5 Enter the arguments required to open a file at a specific line into the Arguments to open file at line field Use the FULLFILE placeholder to represent the path of the file to be opened and the LINE placeholder to represent the line number at which the cursor should be init
368. ols Administration dialog box is only possible when no workspace is open while only reference is possible when a workspace is open Tools Administration 2 xi Registered components E Cancel oolchains 3 System Tools Call Walker 11 Register H Series Librarian Interface 11 i Mapview 1 0 Uriesicter Utility Phases Debugger Components Bropetiies Binary File Object Reader 1 0 Ene ElfOwarf2 object reader 2 0 Generic Cache View ECX 1 0 Search disk Generic Coverage View ECX 1 0 Generic Event View ECX 1 0 Thea eee Generic Image View ECX 1 0 T Canain ious i a ed URE T Show all components Current HEW tools database location E Hew Modify e UELLE Figure 5 1 Tools Administration Dialog There are five standard types of component e Toolchains a set of build phases e g compiler assembler and linker These components provide the build capability e System Tool an application EXE which can be launched from the Tools menu They are often provided as extra applications which support the toolchain e g an external debugger like the Hitachi Debugging Interface HDI or an interactive graphical librarian e Utility Phase a ready made build phase which supports some specific build functionality e g analyze complexity of source code count lines of source code etc These components provide added functional
369. ols Menu ccc ceescseceeescseeeeesesesesssescsessececseseseesseeessseessesaeegs 116 Configuring the Help Systems scicccscicessessocdssacsaasosesssusssessiseosestescotesbesssessyenssastacsvvestecss 118 Specifying Workspace Options 119 6 4 1 Open last workspace at start up oo ee eee cess cecescsetececsesesseseeeeaneesseeaeees 120 6 4 2 Restore the files on opening Workspace 0 c cece eeesceeeeseeeeeeteeeeeseeeeeeeaeees 120 6 4 3 Display workspace information dialog on opening workspace ieee 120 6 4 4 Save workspace before executing any tools 0 0 cece cece eeeeeeeeeeeeeetaeees 121 6 4 5 Prompt before saving workspace 0 cece eeee cess teeeeeeeteceecseeeeseeseeeeseeeseeeaeees 121 6 4 6 Prompt before saving SCSSION cscsecceeeseeseeseeseeseeseeeeceeeeseeaeesecececeeseaeeaeeneees 121 GAT Save autO secovery inl sic ssisies ccesceisversuncsacecccsavarovsiesscecesssseaiedaaceannssererateensisenterss 122 6 4 8 Default directory for new Workspaces cccceceeseeeeeceseeecaeeeeeceeeeeseeeeseesseeeaeees 122 Using an External Bdntors iosaccssscesesedeesssvess cases edasncsrs sisecsnosssaconenssaccaesssaccon sdenssonenanedsbentonss Customizing FIle Save seoir ero E KEANE N E Tite 6 6 1 Save files before executing any tools z 6 6 2 Pr mpt before saving PIES 5 6 6 3 s scaseedesuwoncses coseessoncsssseedessoscescesecentenaese seseeedeiesn ends Using Custom Placeholder cc cicsscsssevacsessevestossoveeceseosestesse
370. om the emulator For the execution time measurement result the time for reset signal input is added E Clock Synchronous Instructions To execute E clock synchronous instructions MOVFPE and MOVTPE note the following 1 E clock synchronous instructions can be executed only when User is specified as the external address area If On chip or Emulator is specified these instructions will not be correctly executed 2 When an E clock synchronous instruction MOVFPE or MOVTPE is executed trace information on instruction execution cycles being displayed will be incorrect 427 RENESAS 8 2 7 Notes on Use of the H8 3437 H8 3437Y H8 3297 Group Evaluation Chip Set HS3437EVI60H T O Register Differences Between Actual MCU and Emulator In the E6000H emulator one evaluation chip emulates several types of MCU Therefore there are some differences in I O registers between an actual MCU and the emulator as shown in table 8 18 Note these differences when accessing the I O registers T O port is in the input state at default The I O register contents indicate the emulator port status When the user system interface cable is not connected the read value is 1 due to pull up resistors Table 8 18 Differences in I O Registers MCU Group vo H8 3434F H8 3334YF 8 3397 8 3297 Address _H8 3437 _H8 3437F_ _H8 3337Y_ _H8 3337YF_ _H8 3534_ H8 3522 Note FF80 X a X a X O The
371. omatically added to the list of phases to execute when a build file operation is applied to a C source file If you don t want a certain phase to execute when Build gt Build File is selected then clear the check box to the left of the phase name in the Phase order list 49 RENESAS 3 4 Setting Custom Build Phase Options Once you have defined a custom phase you will want to specify the command line options that should be used when it is executed Each defined phase has a menu option on the Options menu To specify options for that phase select it The dialog that will be invoked depends upon whether the custom phase selected was a multiple or single phase according to the selection of phase type in figure 3 3b LA rx Debug x Options Output Files Dependent Files hewtest al Command i ga C source file P _hew files Dostiwindows executables CMDLINE EXE E hewtest c initsct c Options io FULLFILE vecttbl c _ Default Options El m hewtest1 m hewtest2 hewtest3 aa ae We Placeholder hewtest3 c initsct c pa Fie path name x Insert B intprg c sbrk c iat Em Figure 3 10 Custom Options Dialog The dialog in figure 3 10 is a custom phase options dialog The implementation of which is slightly different depending on whether you are using a multiple or single shot phase On the left hand side is the project and file list It is possible to select mul
372. on i E Stack Trace Value F func3 short Ox00000094 P param 3 Ox00003ffa Ox00003fd8 short L local _ 3 D 3 Ox00003fd4 unsigned long F fune2 short Ox00000072 P param 2 0x00003ffa Ox00003fe4 short L local 2 D 2 Ox00003fe0 unsigned long F funci short 0x0000003e P param 1 Ox00003ffa Ox00003ff0 short L local 1 D i Ox00003fec unsigned long F main Ox00000012 L start D 103 Ox00003ffa short Figure 5 97 Stack Trace Window The following items are displayed Kind Indicates the type of the symbol F Function P Function parameter L Local variable Name Indicates the symbol name Value Indicates the value address and type of the symbol 5 17 2 Viewing the Source Program Select a function and choose Go to Source from the popup menu to display in the Source window the source program corresponding to the selected function 327 RENESAS 5 17 3 Specifying the View Choose View Setting from the popup menu to open the Stack Trace Setting dialog box which allows the user to specify the Stack Trace window settings Figure 5 98 Stack Trace Setting Dialog Box Nest level Specifies the level of function call nesting to be displayed in the Stack Trace window Display symbol Specifies the symbol types to be displayed in addition to functions Display Radix Specifies the radix for displays in the Stack Trace wind
373. ondition specified under Ch1 RENESAS 363 000001038 0x00001044 0x00001046 0Ox0000104e 0x00001050 0x00001058 0x0000105a 0x0000105c Ox00001070 Ox0000107a 0x00001082 0x0000108a 0x00001096 0x000010a2 0x000010ae 0x000010ba 0x000010c6 0x000010d2 0x000010de 0x000010ea 0x000010f6 0x000010fc void tutorial void long a 10 long j int i class Sample p_sam p_sam new Sample for i 0 i lt 10 i j rand aft Oye n cates P ali j p_sam gt sort a P_sam gt change a p_sam gt sO0 a 0 p_sam gt sl a 1 p_sam gt s2 a 2 p_sam gt s3 a 3 p_sam gt s4 a 4 p_sam gt sS a 5 Pp_sam gt s6 a 6 p_sam gt s7 a 7 p_sam gt s8 a 8 p_sam gt s9 a 9 delete p_sam Figure 6 38 Source Window at Execution Stop The Status window displays the following contents H8 2237 E6000 Emulator CPU 2000 Emulator PCI Card Driver H8S 2237 Clock source Break Run status Cause of last break Complex Event System Event Time Count Run Time Count Main 1OMHz Sub 32kHz 00h OOmin 00s O00ms OOOus O00ns 00h OOmin 00s O000ms 738us 750ns Figure 6 39 Displayed Contents of the Status Window Refer to the Watch window for the value of variable i The value is 4 indicating that the break occurred after the condition had been satisfied five times Note The items that can be displayed in this window diffe
374. onfiguration Properties General Device Glock 1MHz v SubClock 32 768kHz z Timer Resolution 125ns x JV Enable read and write on the fly JV Break on access error J Enable internal ROM area write JV Transit to active mode at break User VCO Threshold 270 4 User Signals JV User Reset enable Jv User NMI enable J User Standby enable M User Bus Request enable E j I Change driver in start up Driver Emulator PCI Card Driver Figure 8 1 Configuration Properties Dialog Box General Page 412 RENESAS General page Device Selects the MCU to be emulated See the hardware manual for details Mode The CPU operating mode which can be selected from the three modes With the H8 300 series selectable modes depend on the MCU With the H8 300L series only mode 3 is available Clock Selects the speed of the MCU s clock SubClock Selects the speed of the MCU s sub clock Selection of the sub clock is only available with the H8 300L series Timer Resolution Selects the resolution of the timer for use in execution time measurement The value 20 ns 125 ns 250 ns 500 ns 1 us 2 us 4 us 8 us or 16 us can be selected The timer for execution time measurement has a 40 bit counter At 20 ns the maximum time that can be measured is about six hours and at 16 us the maximum time is about 200 days When the counter overflows the maximum
375. ons and select the Workspace tab Build Editor Workspace Confirmation Network IV Restore files on opening workspace I Display workspace information dialog on opening workspace I Save workspace before executing any tools J Prompt before saving workspace IV Prompt before saving session IV Save Auto Recovery info every fio minutes Default directory for new workspaces D Hews Browse Figure 6 9 Options Dialog Workspace Tab The following sections explain the options available on this tab 119 RENESAS 6 4 1 Open last workspace at start up Set this check box if you would like the High performance Embedded Workshop to automatically open the last workspace you opened when it is launched 6 4 2 Restore the files on opening workspace When you close a workspace the HEW stores which files were open When you open a workspace the HEW can restore i e open the same files so that you can continue your session in exactly the same state as when you left it If you would like the files associated with a workspace to be opened when you open a workspace then set this check box 6 4 3 Display workspace information dialog on opening workspace When many workspaces are being used it is sometimes difficult to remember exactly what was contained within each workspace To help resolve this the High performance Embedded Workshop allows you to enter a textual description of each workspace gt
376. oolbar 2 The configuration is selected l Release be Release Figure 2 15 Toolbar Selection or 1 Select Options gt Build Configurations This will invoke the Build Configurations Dialog figure 2 16 Build Configurations 2 xi Build configurations Cancel Current configuration Debug 7 Figure 2 16 Build Configurations Dialog 2 Select the configuration that you want to use from the Current configuration drop down list 3 Click OK to set the configuration 24 RENESAS 2 5 2 Adding and Deleting Configurations You can add a new configuration by copying settings from another configuration or delete a configuration These three tasks are described below gt To add a new configuration 1 Select Options gt Build Configurations to display the Build Configurations dialog figure 2 16 2 Click the Add button The Add Configuration dialog will be invoked figure 2 17 Add Configuration x Configuration name MyConfig f Cancel Based on configuration Debug 7 Configuration directory c hew demo demo MyConfig Figure 2 17 Add Configuration Dialog 3 Enter the new configuration name into the Configuration name field As you enter the new configuration name the directory underneath changes to reflect the configuration directory that will be used Select one of existing configurations from which you wa
377. or example set a watch on the long type array a declared at the beginning of the program by using the following procedure e Click the left of displayed array a in the Source window to position the cursor e Select Instant Watch with the right hand mouse button The following dialog box will be displayed Instant Watch 2 xi Add a 0x00ffef80 long 10 Figure 6 14 Instant Watch Dialog Box e Click the Add button to add a variable to the Watch window OxO0ffef80 long 10 Watch3 A Watch4 Figure 6 15 Watch Window Displaying the Array 350 RENESAS The user can also add a variable to the Watch window by specifying its name e Click the Watch window with the right hand mouse button and select Add Watch from the popup menu The following dialog box will be displayed Add Watch Variable or expression Figure 6 16 Add Watch Dialog Box e Input variable i to Variable or expression edit box and click the OK button The Watch window will now also show the int type variable i Ox00ffef80 lona 1O i H 000a R4 fint Watch2 A Watch3 A Watch4 Figure 6 17 Watch Window Displaying the Variable 351 RENESAS The user can click mark at the left side of array a in the Watch window to watch all the elements w Watch a OxO0ffef80 lon
378. orm in hard copy or machine readable form by any means available without Renesas prior written consent Other Important Things to Keep in Mind 1 Circuitry and other examples described herein are meant merely to indicate the characteristics and performance of Renesas semiconductor products Renesas assumes no responsibility for any intellectual property claims or other problems that may result from applications based on the examples described herein 2 No license is granted by implication or otherwise under any patents or other rights of any third party or Renesas Figures Some figures in this user s manual may show items different from your actual system Limited Anticipation of Danger Renesas cannot anticipate every possible circumstance that might involve a potential hazard The warnings in this user s manual and on the emulator product are therefore not all inclusive Therefore you must use the emulator product safely at your own risk Ill RENESAS SAFETY PAGE READ FIRST e READ this user s manual before using this emulator product KEEP the user s manual handy for future reference Do not attempt to use the emulator product until you fully understand its mechanism DEFINITION OF SIGNAL WORDS A This is the safety alert symbol It is used to alert you to potential personal injury hazards Obey all safety messages that follow this symbol to avoid possible injury or death A DANGER DANGER indicates an immine
379. orm will run your code from the current PC value until it reaches the address indicated by the cursor s position Notes 1 If your program never executes the code at this address the program will not stop If this happens code execution can be stopped by pressing the Esc key choosing Debug gt Halt or clicking on the Stop toolbar button 2 The Go To Cursor feature requires a PC breakpoint if you have already used all those available then the feature will not work 261 RENESAS 5 11 4 Running from a Specified Address The Run Program dialog box allows the user to run the program from any address Choose Debug gt Run to open the Run Program dialog box 21x Run Program Program Counter JHooooo000 Temporary PC Breakpoints Reset Go ik Cancel Figure 5 44 Run Program Dialog Box The following execution conditions can be specified in this dialog box Program Counter Instruction address to start execution The initial value is the current PC value Temporary PC Breakpoints A temporary PC breakpoint When execution started by this dialog box stops this breakpoint is cleared Note The Temporary PC Breakpoints feature requires a PC breakpoint if you have already used all those available then the feature will not work Clicking the Go button starts execution according to the settings Clicking the Reset Go button starts execution from the reset vector Clicking
380. orner of the window Or push the right mouse button anywhere inside a floating window and select Hide on the pop up menu To display the Workspace window or the Output window Select View gt Workspace or View gt Output respectively 1 2 5 The Editor Window The editor window is where you will work with the files of your project The HEW allows you to have many files open at one time to switch between them to arrange them and to edit them in whichever order you want to By default the editor window is displayed in a notebook style where each text file has a separate tab as shown in figure 1 18 The editor contains a gutter on the left hand side of the window The standard column allows the user to configure the position of bookmarks and software breakpoints quickly and easily If you are unsure what purpose a column has or what the information it is displaying is if you place the cursor over the column a tool tip is displayed showing its identity RENESAS L HHH JE JE JE JE JEJE JE JE JE JE JE JE JE E JE JE JE JE JE JE JE JE JE JE JE BA JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JE JEJEJEJE JEFE include lt stddef h gt include lt stdio h gt include sbrk h const size_t _sbrk_size Specifies the minimum unit of the defined heap area extern char _slptr static union long dummy Dunmy for 4 byte boundary char
381. ou wish to add the new keyword group 3 Click Add underneath the tree The Add Category dialog box will be displayed figure 4 11 Enter the name of the keyword group in the Category Title field then click OK to create the new keyword group Add Category Category Title pae 1x cmn Figure 4 11 Add Category Dialog gt To create new keywords 1 Select Tools gt Format Views The Format Views dialog will be displayed 2 Select the item underneath the source view icon in the tree you wish to modify the syntax highlighting for This should be the file type e g C source file and correct keyword group e g identifier or pre processor 3 Select the Keywords tab figure 4 12 87 RENESAS Format Views eix A Colour Font Keywords Comments D Selected Text D Text Source D Selected Text D Text C list file C source file C header file C source file D Comments D Control D Declaration D Operator D PreProcessor C header file C list file Preprocessed C source file HEW Sample Text Expanded assembly source file Add Modify Remove OK Cancel Remove Figure 4 12 Format Views Dialog Keywords Tab 4 Click the Add button to add a keyword Then the Add Keyword dialog figure 4 13 will be
382. ouse button Table 4 1 outlines the basic operations that are provided by the editor Table 4 1 Basic Editing Operations Operation Effect Action Cut Removes highlighted text and places it on the Click the cut toolbar button Windows clipboard Select Edit gt Cut Select Cut local menu Press CTRL X Copy Places a copy of the highlighted text into the Click the copy toolbar button Windows clipboard Select Edit gt Copy Select Copy local menu Press CTRL C Paste Copies the contents of the Windows Click the paste toolbar button clipboard into the active window at the Select Edit gt Paste position of the insertion cursor Select Paste local menu Press CTRL V Delete Removes highlighted text it is not copied to Select Edit gt Clear the Windows clipboard Select Clear local menu Press Delete Select All Selects i e highlights the entire contents of Select Edit gt Select All the active window Select Select All local menu Undo Reverses the last editing operation Select Edit gt Undo Select Undo local menu Press CTRL Z Redo Repeats the last undone editing operation Select Edit gt Redo Se lect Redo local menu Press CTRL Y RENESAS 75 4 5 Searching and Navigating through Files The High performance Embedded Workshop editor provides find replace and file navigation functionality The following three sections detail how to use these features 4 5 1 Find
383. ow 328 RENESAS 5 18 Displaying Memory Contents as an Image The memory contents can be displayed as an image in the Image View window 5 18 1 Opening the Image View Window Choose View gt Graphic gt Image or click the Image toolbar button to open the Image Properties dialog box shown in figure 5 99 Image Properties r Color Information Mode Bit Pivel 8bit Index Color Sampling 44 4 z C BGR C YCbCr Format l chunky z m Buffer Infomation Data Address JH 00000000 Palette Address Width Height Size Pixel Width z Height ft Buffer Size H 00000000 Byte m View Information View Mode 5_ Position Full Size Pasition 0 Part Size Y Position 0 r Start Position Top Width m Width Heiaht Size Pre 4 0 C Bottom aie 0 Figure 5 99 Image Properties Dialog Box The Image Properties dialog box is used to specify the display method of the Image View window 329 RENESAS The following items are to be specified Color Information Mode Bit Pixel Sampling Format Buffer Information Data Address Palette Address View Information View Mode Start Position Position 330 Specifies the color information of the image to be displayed Specifies the format MONOCHROME Black and white RGB
384. ow possible to leave the Tools gt Options dialog OOS OY Oye ee When the dialog is closed you are asked if you want to save the workspace and then re open it This is because the workspace must be re opened in the shared access mode If the changes are not saved then they will be lost 9 When the workspace is re opened a dialog is displayed which asks you to log back into the system Once you have logged in a dialog is displayed which shows your current access rights For example if you are the admin user the level will be administrator When this dialog is closed the HEW server window is opened and the network facilities are enabled 158 RENESAS Options x Build Editor Workspace Confirmation Network Tl Enable network data access Network database access Login User Password Password Select server Figure 10 2 Initial setup of Network tab Change password xi Admin Cancel Password me Confirm password by retyping below Figure 10 3 Change password dialog 159 RENESAS 10 1 3 Adding new users to the system The initial setting of the network database adds an administrator user and a guest user to the system The following levels of access are possible in the HEW system e Administrator Full access to every aspect of HEW The user can add and remove users from the projects and change access rights The administration user can change the workspac
385. p HS3508EVI60H All user system interface signals are directly connected to the evaluation chip in the emulator with no buffering except for those listed below which are connected to the evaluation chip through control circuits e RES NMI e MDO e MDI e EXTAL The circuits that interface the evaluation chip in the emulator to the user system include pull up resistors that cause signal delays Note that when an input terminal is in the high impedance state the pull up resistor forces the terminal to be at a high level Adjust the user system hardware to compensate for these effects The delay caused by the user system interface cable is about 3 ns The following diagrams show the user system interface signal circuits Default o User system interface cable Figure 7 9 Default User System Interface Circuit RES NMI and MDO These signals are input to the evaluation chip via HD151015 Therefore the rising falling time must be within 8 ns or less User system 479 interface cable HD151015 Figure 7 10 User System Interface Circuit for RES NMI and MDO MD1 Includes a 12 V detection circuit for supporting microcomputers including flash memory 12 V detection User system circuit interface cable monitor register 27 kQ Figure 7 11 User System Interface Circuit for MD1 391 RENESAS EXTAL Clock oscillator circuit is on the user system interface cable User system 472 interface cable HD1
386. p menu to execute the command file The Play menu is displayed in gray while the file is running and can be used when the command file execution stops and control returns to the user 5 3 4 Stopping Command Execution Choose Stop from the popup menu to stop command execution The Stop menu becomes valid during command execution 5 3 5 Specifying a Log File Choose Set Log File from the popup menu to open the Open Log File dialog box in which a log file to store the command execution results can be specified Open Log File BEI Log File o H Browse Figure 5 13 Open Log File Dialog Box Enter the name of a log file log The logging option is automatically set and the name of the file is shown on the window title bar Opening a previous log file will ask the user if they wish to append or overwrite the current log 5 3 6 Starting or Stopping Logging Choose Logging from the popup menu to toggle logging to file on and off When logging is active the button becomes effective Note that the contents of the log file cannot be viewed until logging is completed or temporarily disabled by clearing the check box Re enabling logging will append to the log file 5 3 7 Entering a Full Path to the File It is recommended that the full path to a file is specified as a file name in the Command line window because the current directory can be moved However care must be taken to enter the correct full pa
387. ported version control systems 2 Select the desired version control system from the Version control systems list and click the Select button The Current version control system is changed to reflect the new selection 3 Click the OK button to confirm the selection 130 RENESAS Select ersion Control System 2 x Version control systems K Microsoft Visual SourceSafe 5 0 6 0 Cancel None Select EE Current version control system None Figure 7 3 Select Version Control System Dialog Note Only those version control systems which have been installed with the HEW will appear in the Select Version Control System dialog figure 7 3 Once a version control tool is selected you will notice that the Version Control gt Configure option has now become available The next chapter discusses the usage of the custom version control system 131 RENESAS 132 RENESAS 8 Using the Custom Version Control System The custom version control system is a configurable addition to the High performance Embedded Workshop which allows you to connect to a version control system already installed on your machine To clarify further the High performance Embedded Workshop does not provide a version control tool itself only a means by which you can integrate the version control system which you use into your workspaces and projects 8 1 Defining Version Control Menu Options The
388. r By default when the HEW substitutes the placeholder VCDIR it uses the backward slash character to divide directories However if the version control system you are using uses a forward slash character e g Visual SourceSafe to divide directories then set the Use forward slash as version control directory delimiter 148 RENESAS 8 5 Importing and exporting a Set up Each workspace can have a different version control set up The HEW allows you to store the version control settings independently so that you can import them into other workspaces This greatly reduces the amount of time it takes to configure the same version control settings across several workspaces gt To export a version control set up 1 Select Version Control gt Configure The dialog shown in figure 8 1 will be displayed 2 Click the Export button A standard file save dialog will be displayed Browse to the directory in which you would like to save the configuration 3 Enter the name of the file and then click OK gt To import a version control set up 1 Select Version Control gt Configure The dialog shown in figure 8 1 will be displayed 2 Click the Import button A standard file open dialog will be displayed Browse to the HVC file which you would like to import 3 Select the file and then click OK 149 RENESAS 150 RENESAS 9 Using Visual SourceSafe The High performa
389. r depending on the product For the items that can be displayed refer to section 8 Software Specifications Specific to This Product or the online help Remove the event point Clicking the right hand mouse button on the Event window displays a popup menu Select Remove All from this menu to remove all event points 364 RENESAS 6 16 Trace Functions The trace functions of the emulator use the realtime trace buffer which is able to store the information on up to 32 768 bus cycles The content of this buffer which is constantly updated during execution is displayed in the Trace window Select Trace from the Code submenu of the View menu to display the Trace window Generic Trace PTR Address Instruction Data R U Area Status Clock Probes NMI IRQ 0 Timestamp Source Label Timestamp Difference ji Figure 6 40 Trace Window When trace information is displayed in the Trace window clicking the right hand mouse button on the Trace window displays a popup menu Select Clear from this menu to clear the trace information The following sections give an overview of the trace functions and methods for setting them 365 RENESAS 6 16 1 Displaying a Trace when Time Stamping is not Available The method used to specify an address as an event condition for the tracing of read write cycles and display the trace is described below 1 Clicking the right hand mouse butto
390. race window displays a further popup menu Select Clear from this menu to clear the trace information 379 RENESAS 6 17 Stack Trace Function The emulator uses the information on the stack to display the function call history Notes 1 This function can be used only when the load module that has the Dwarf2 type debugging information is loaded Such load module is supported in H8S H8 300 C C compiler V4 0 or later 2 For details on the stack trace function refer to the online help Double click the Editor column in the sort function and set a PC breakpoint 0x00002068 void Sample sort long a 0x00002070 long t int 2 j k gap 0x00002072 gap 5 0x00002076 while gap gt 0 jf 0x00002078 fort k 0 k lt gap k 0x0000207c for i k gap i lt 10 i i gap Ox00002080 for j i gap j gt k j j gap Ox00002084 if a j gt al j gap to a i 0x000020a4 a j alitgap 0x000020a8 a j gap t else break 0x000020c0 gap gap 2 0x000020cc Figure 6 60 Source Window PC Breakpoint Setting Select Reset Go from the Debug menu e After the break in program execution select Stack Trace from the Code submenu of the View menu to open the Stack Trace window StackTrace Kind Name Value Sample sort long tutorial main PowerON_Reset trj P x Hy 0200002084 Ox0000107a 000001036 Ox0000041e See ee Figure 6 61 Stack Tra
391. rcuit i cfssiecccsseseercssetesceecodoneessadecsns cnsesesesnssdesnonds doseeessdens cess 188 20 System Checken EENE EE TERESIE NO NONE ETIEN NENES EEEE TES 189 2T Communication Problems eee eee csecsceseeeeeeesesessceecseesseesseeessesseseseceesseteeeeeaeeess 193 2 8 Other Methods for Activating the Emulator eee cece eeeeceeeseeeseteeneseeeeeeeae 193 2 9 Uninstalling the Emulator s Software s sssssssssssssessssssessssesessstsssrsrsrnrnrnrnrsrnrnesesesnenee 193 Section 3 E6000 Emulator Functions sseseessseseeeeeessisrisrerisrsrrereresrsreerseesreses 195 31 Deb gtine Fettes cccsccss ws td ced scectslaccevesudeesccocelsdvecededadesesstens caseansereatsuss vesnonseesseaneh ches 195 3AL Break points oj secccerssoncerssesccnrosesceesncnsseenrentscrsesnseeonesnsseonens sine iira nen EEEn eisista Ein 195 HEZ PACS assess sits ss E E E EE 195 3 1 3 Execution Time Measurements e sesssesisisrsseretssereressrsessssrrtserenrnrnrnenenessnesent 195 S14 Performance Analysis ssccccescssccciscsncsssacstesssecstssseasonsisiestesrdsasventdessvexeusosvencetssessescos 195 31 5 Bus MOntOrng i560 ssseoss vasccedssess contensssosenesesvns vesesersduovewsondecsweocesaiveeszeosnectgsesveneas 196 3 2 Complex Event System CES sccscscscccssessssonccessscessassserssassserdessnonesuessonedboteouesenseserteesevaets 196 S21 Event Channels x ssccccesvscsccernneseceosnesseacstesssarsnessseosacdddssnisddavsanncsensaniissessanesconpensices 196 322 Rans
392. recent project workspaces select Open a recent project workspace select a workspace from the drop down list and click OK The recent project workspace list displays the same information as that seen in the workspace most recently used file list This list appears on the file menu To open a workspace by specifying a workspace file HWS file select Browse to another project workspace and click OK To register a tool to or unregister a tool from the HEW click the Administration button see chapter 5 Tool Administration for details Click the Cancel button to use the HEW without opening a workspace 1 5 Exiting the HEW The HEW can be exited by selecting File gt Exit pressing ALT F4 or by selecting the close option from the system menu To open the system menu click the icon at the upper left corner of the HEW title bar If a workspace is open then the same workspace closedown procedure is followed as described in the previous section 1 6 Component System Overview The HEW allows the user to extend the HEW functionality by adding additional components to the system This is achieved by registering the component in the Tools Administration dialog box These components can add windows menus and toolbars to the HEW system Examples of the components are the debugger and builder components of HEW The debugger component adds all of the menus and toolbars associated with the debugger and the builder
393. required set the inch or mm radio buttons to set the measurements 3 Click OK for the new settings to take effect Margins Let E Bight jo Top fo Bottom fo Inch mm Header Footer gt JV Wrap Text Cancel Figure 4 6 Page Setup Dialog 81 RENESAS gt To set up the page header and footers 1 Select File gt Page Setup The Page Setup dialog will be invoked figure 4 6 2 Enter into the header and footer edit fields the text required to be displayed All normal placeholders are available along with page numbering text justification and date fields These are all expanded before the page is to be printed 3 Click OK for the new settings to take effect gt To set up print wrapping 1 Select File gt Page Setup The Page Setup dialog will be invoked figure 4 6 2 Click the wrap text check box This switches on the wrap text facility when printing so no text is truncated and everything is visible 3 Click OK for the new settings to take effect 82 RENESAS 4 8 2 Changing Tabs gt To change tab size 1 Select Tools gt Options The Options dialog will be displayed Select the Editor tab figure 4 7 2 Enter into the Tab size field the number of desired tabs 3 Click OK for the tab setting specified to take effect Ortons lx Build Editor Workspace Confirmation Network Tab si
394. rformance function refer to section 5 20 Analyzing Performance The following tables show examples of signals to indicate the bus states and areas that can be acquired by the emulator Table 5 1 Bus State Signals Acquired by the Emulator Bus State Trace Display Status Description CPU Prefetch PROG CPU prefetch cycles CPU Data DATA CPU data access cycles Refresh REFRESH Refresh cycles DMAC DMAC DMAC cycles DTC DTC DTC cycles Other OTHER Others 280 RENESAS Table 5 2 Area Signals Acquired by the Emulator Area Trace Display Status Description On chip ROM ROM ROM On chip RAM RAM RAM On chip I O 16bit V O 16 16 bit 1 0 On chip I O 8bit 1 0 8 8 bit I O External I O 16bit EXT 16 16 bit EXT external External I O 8bit EXT 8 8 bit EXT external DTC RAM RAM DTC DTCRAM Note The signals to indicate the bus states and areas vary according to the emulator in use For details refer to section 8 Software Specifications Specific to This Product or the online help 5 15 5 Opening the Event Window Select View gt Code gt Eventpoints or click the Eventpoints toolbar button m to open the Event window The Event window has the following three sheets Breakpoint sheet Displays the settings made for PC breakpoints It is also possible to set modify and cancel PC breakpoints Event sheet Displays or sets event points Trigger sheet Displays or sets trigger points
395. right mouse button to display the pop up menu and select the Set as Current Project option or 1 Select the project which you want to make active from the Project gt Set Current Project sub menu 33 RENESAS 2 10 Inserting a Project into a Workspace When a workspace is created it contains only one project but after it is created you can insert new or existing projects into a workspace gt To insert a new project into a workspace 1 Select Project gt Insert Project The Insert Project dialog will be displayed figure 2 24 2 Set the New Project option 3 Click OK The Insert New Project dialog will be invoked 4 Enter the name of the new workspace into the Name field This can be up to 32 characters in length and contain letters numbers and the underscore character As you enter the project name the HEW will add a subdirectory for you automatically This can be deleted if desired 5 Click the Browse button to graphically select the directory in which you would like to create the project Alternatively you can type the directory into the Directory field manually 6 The Project type list displays all of the available project types e g application library etc Select the type of project that you want to create from this list 7 Click OK to create the project and insert it into the workspace Insert Project 21x Cancel Existing project
396. rite Cannot be changed On chip Read only Cannot be changed On chip Guarded Cannot be changed User Read write Cannot be selected when the single chip mode is selected User Read only Cannot be selected when the single chip mode is selected User Guarded Emulator Read write Emulator Read only Emulator Guarded RENESAS 5 2 Downloading a Program This section describes how to download a program and view it as source code or assembly language mnemonics Note After a break occurs the HEW displays the location of the program counter PC on the editor In most cases for example if an Elf Dwarf2 based project is moved from its original path at the build the source file may not be automatically found In this case the HEW will open a source file browser dialog box to allow you to manually locate the file This path will then be used to update any other source files in this debug project 5 2 1 Downloading a Program A load module to be debugged must be downloaded To download a program select the load module from Debug gt Download or select Download from the popup menu opened by clicking the right hand mouse button on the load module in Download modules of the Workspace window Note Before downloading a program it must be registered to the HEW as a load module For registration refer to section 4 3 Setting at Emulator Activation 225 RENESAS 5 2 2 Viewing the Source Code Select a source file name in t
397. rom the Toolchain build phases list on the Change Toolchain Version dialog and click the Information button Then a tool information dialog figure 3 21 will show you the information of the tool Click the Close button to close the dialog SH C C Compiler Information 2 x Information High performance Embedded Workshop SuperH RISC engine C C Compiler Ver 8 0 01 c 1992 2002 Renesas Technology Corp c 1992 2002 Hitachi Software Engineering Co Ltd Figure 3 21 Toolchain Information Dialog 59 RENESAS 3 9 Using an External Debugger The High performance Embedded Workshop can launch an external debugger tool If you want to use another debugger then you must add it to the Tools menu The Debugger tab of the Customize dialog figure 3 22a figure 3 22b figure 3 22c is where the external debugger related information is configured You may wish to use an older version of the debugger if certain targets are not currently supported in the new environment Invoke it by selecting Tools gt Customize and then selecting the Debugger tab The first choice to make is which debug tool you would like to use from the External debugger selected drop down list Hitachi Debugger Interface version 4 x or greater Use the HDI Mitsubishi PD debugger Use the PD debugger Other external debugger Use the other debugger Non selected Not use the exter
398. rt long a void change long a extern void srand unsigned int 0x00000a0c void main void 0x00000a16 lt long a 16 min max long j int i 0x00000a18 srand 1 0x00000a20 gt I printf i Data Input n 0x00000a2c for i 8 i lt 10 i Ox00000a2e j rand 0x00000a36 if j lt 8X 0x00000a38 j i 0x00000a3a afi j Ox00000a44 printf a d ld n i a i gt 0x00000a62 sort a 0x00000a66 printf x Sorting results n 0x00000a72 for i 8 i lt 16 i Ox00000a74 printf a d 1d n i a i ee 7 S Figure 4 16 Editor columns gt To switch off a column in all source files 1 Right click on the editor window Click the Define Column Format menu item The Global Editor Column States dialog is displayed figure 4 17 The Check status shows whether the column is enabled or not If it is checked it is enabled if the check box is gray this means that in some files the column is enabled and in other files it is not PN 5 Click OK for the new column settings to take effect gt To switch off a column in one source files 1 Right click on the editor window which you wish to remove a column from and the editor pop up is displayed 2 Click the Columns menu item and a cascaded menu item appears Each column is displayed in this pop up menu If the column is enabled it has a tick next to its name Clicking the entry will toggle whether t
399. s Dialog General Tab Select the Information tab to view any information about the component figure 5 5 This may include copyright information enhancements bug fixes user notes and so on SuperH RISC engine Standard Toolchain 8 0 1 0 Properties 2 xi General Information Environment Information High performance Embedded Workshop SuperH RISC engine Standard Toolchain Ver 8 0 1 0 SuperH RISC engine C C Library Generator Ver 3 0 01 SuperH RISC engine C C Compiler Yer 8 0 02 Figure 5 5 Properties Dialog Information Tab Note that if the tool has a compatibility issue the problem may be reported in this information edit field 99 RENESAS Select the Environment tab if it exists to view and edit a component s environment settings figure 5 6 This dialog is most commonly used to modify the environment of a toolchain General Information Environment Environment variables PATH D Hew3 T ools Renesas Sh 8_0_1 bin SHC_INC D Hew3 T ools Renesas Sh48_0_1 include SHC_LIB D Hew3 Tools Renesas Sh 8_0_1 bin Modify SHC_TMP C DOCUME 1 ADMINI 1 LOCALS 14Temp _ gt Remove Cancel Figure 5 6 Properties Dialog Environment Tab To add a new environment variable click the Add button the dialog shown in figure 5 7 will be invoked Enter the variable name into the Variable field the variable s value into the Value field and
400. s Register Communication Tools F 5 System Extension Components Unrenister C Project Generators C Project Generators Custom E Version Control System F Properties k Export e Custom VCS 20 se gt Microsoft Visual SourceS afe 5 0 6 0 3 0 Search disk 3 6 Toolchain Support _ 1 H8S H8 300 Toolchain Supporter 25 Tool information es r Uninstaller IV Show all components Current HEW tools database location E Hew Modify ETE Figure 5 11 All Components Shown When seeking technical support you may be asked to give details about some or all of these components To do so open the respective folder select a component and click the Properties button The properties dialog that will be invoked behaves in the same way as discussed previously in this chapter with the exception that there is no Environment tab The HEW also has a feature which outputs tool information regarding the registered components to a file This allows you to retrieve information on the entire HEW system This information can then be sent to your technical support contact if you are experiencing problems with the HEW gt To output tool information 1 Click the Tools gt Administration menu item 2 Click the Tool information button A standard windows file save dialog is displayed 3 Choose the file location and click OK 4 A file i
401. s created in the chosen location with the current registered tool setup of the HEW 103 RENESAS If any of the components have problems these can be seen in the tools administration dialog If the icon has an additional icon this explains the problem There are two additional icons that can be displayed If a component is found but cannot be used due to it being an old version or another dependent component is not available then the icon in figure 5 12 is used to show this If the component is not located where the registration file says it is then the icon in figure 5 13 is used to show this Registered components Component a Toole haing TA Re IAR TINY SERIES H8 300HN vee W SuperH RISC engine Standard Tox asaca 3 Qi marh Bicr eanane Chandar T Hon Figure 5 12 Incompatible component found icon H85 H8 300 Series Simulator Target Platform 3 0 vee i HMon Embedded Monitor Platform 1 0 ren Intel Hex Record Obiect Reader 1 0 Figure 5 13 Component not found icon Note Tf the tool has one of these errors then it is possible to get more information by the following method gt To get tool error feedback 1 Click the Tools gt Administration menu item 2 Select the tool in the list that has an issue 3 Click Properties 4 Select the information tab and scroll the edit field to the bottom 5 The reason for the problem will be displayed in this area 104 RENESAS 5 8 On Demand co
402. s ranges used in the overlay mode Click to select one of the address ranges in the Address list box Address OOFFBS00 OOFFBS Section Name DB Cancel Figure 5 49 Overlay Dialog Box Address Range Selected The Section Name list box displays the section groups assigned to the selected address range gt Setting section group When using the overlay function the highest priority section group must be selected in the Overlay dialog box otherwise the HEW will operate incorrectly First click one of the address ranges displayed in the Address list box The section groups assigned to the selected address range will then be displayed in the Section Name list box Click to select the section group with the highest priority among the displayed section groups 2 x Address Section Name OOFFB800 OOFFBSDB Cancel Figure 5 50 Overlay Dialog Box Highest Priority Section Group Selected After selecting a section group clicking the OK button stores the priority setting and closes the dialog box Clicking the Cancel button closes the dialog box without storing the priority setting Note Within the address range used by the overlay function the debugging information for the section specified in the Overlay dialog box is referred to Therefore the same section of the currently loaded program must be selected in the Overlay dialog box 270 RENESAS 5 14 Viewing t
403. s set armed by the non occurrence of the input events Figure 5 65 is an example that Ch1 is the arm event for Ch2 Ch3 and Ch4 Ch3 is the arm event for Ch4 Ch2 and Ch 4 are the reset events for Chl and Ch2 respectively To satisfy the condition of the event point having an arm event the arm event must be in the state where the condition is satisfied or not when No occurrence of is selected When multiple arm events exist on one event point one of the arm events must be in the state where the condition is satisfied or not when No occurrence of selected to satisfy the condition of the event point As the condition of the arm event on one event point either of the states where the condition is satisfied or not should be set To reset an event point with a reset event the condition of the reset event must be satisfied While the condition of the reset point is satisfied no event point is reset even if the condition of the reset event is satisfied again When multiple reset events exist on one event point the event point is reset when the condition of one of reset events is satisfied 290 RENESAS 5 15 8 Setting Trigger Points The trigger point is an event to output a trigger when the specified address has been accessed Up to four trigger points can be set by using the trigger outputs four channels on the bus monitoring circuit of the emulator The settings of the trigger point are displayed and modified on the Trigger
404. s two placeholders User login name USERNAMEB and User login password PASSWORD When the command is executed these placeholders will be replaced with the current settings in the General tab of the Version Control Setup dialog figure 8 13 ersion Control Setup 2 x Commands Projects General Execution IV Prompt before executing command I Run in DOS Window JV Close DOS window on exit T Use forward slash as version control directory delimiter User details User JHARK Password Siaa Configuration file Current version control configuration file C Hew Project Project hye OK Cancel Esport Import Figure 8 13 Version Control Setup Dialog General Tab 146 RENESAS In order to give the USERNAME and PASSWORD fields a value you will first need to login If you have not logged in before a command is executed which uses either of these placeholders then you will be prompted to do so before the command can be executed gt To login i e specify a user name and password 1 Click the Log in button The dialog shown in figure 8 14 will be displayed 2 Enter your user name into the User name field 3 Enter your password into the Password field 4 5 Click OK to set the new user name and password If there is any inconsistency between the two Re type your password again into the
405. scacensvaesedesnasiesasnenssswocennowestss 232 5 3 4 Stopping Command Execution 0 cece ce eseeceeceeeseeeseeesaeeeesesaeeeeseeeeseeeee 232 53 5 Specifying a Log Pile asavssscasiscns nce ieee a erercisereisiean ss antoasvecs aaa eiates 232 5 3 6 Starting or Stopping Logging eee eee cece eeececeeeeceeseeseeesseeeseesseneeeeeaes 232 5 3 7 Entering a Full Path to the File cc cesccsssesssssseadssocnnssduesdensdsossesaccasvensceossecsvensvendes 232 33 8 Pasting a Placeholder uioun onene ne E EEE ES 233 Viewing the REBIStEIS sc iesccctiess sccedisssestssesvesscntosestones cosnscetstcetssdedenscpeadesdvecndonedts Tiie 234 5 4 1 Opening the Register Window oie eee eee ceeceeeteeeeteeteesesaeeeeseeeeeeane 234 SA2 Expanding a Bit Resistet sissie tena nare E cates EEE N E Ss 234 5 4 3 Choosing a Register to be Displayed ssssssssssssrsssssrssssssssssessrertninrersreesenenreest 235 5 4 4 Splitting Up the Window Display 235 5 4 5 Modifying Register Contents 236 5 4 6 Using Register Contents 0 0 236 5 4 7 Saving the Currently Displayed Contents 236 Operating MeMOTy cece eee isiin 237 5 5 1 Viewing a Memory Area 237 5 5 2 Displaying Data in Different Formats 5 5 3 Splitting Up the Window Display 5 5 4 Viewing a Different Memory Area 5 5 5 Modifying the Memory Contents 239 5 5 6 Selecting a Memory Range 239 5 5 7 Finding a Value in Memory 240 5
406. sconnects the debugging platform Download Modules Downloads the object program Unload Modules Unloads the object program Memory Search Searches for the specified value from the specified memory area Copy Copies the specified memory fe area to the specified address Compare Compares the specified two memory areas Fill A Fills the specified value in the specified memory area Test Tests the specified memory A area Refresh Forces a manual update of the contents of all the Memory windows open Configure Overlay Selects the target section group when the overlay function is used 464 RENESAS Appendix H Command Lines Table H 1 lists the HEW commands Table H 1 HEW Commands No Command Name Abbreviation Function 1 Comment 2 ADD FILE AF Adds a file to the current project 3 ANALYSIS AN Enables or disables performance analysis 4 ANALYSIS_RANGE AR Sets or displays a performance analysis range 5 ANALYSIS_RANGE_ AD Deletes a performance analysis range DELETE 6 AUTO_COMPLETE AC Enables or disables command complement function 7 ASSEMBLE AS Assembles instructions into memory 8 ASSERT Checks if an expression is true or false 9 BREAKPOINT BP Sets a breakpoint at an instruction address 10 BREAKPOINT_CLEAR BC Deletes breakpoints 11 BREAKPOINT_ BD Displays a list of breakpoints DIS
407. scription block has the following syntax lt targetl gt lt target2 gt lt dependant1l gt lt dependant2 gt gt lt command1 gt gt lt command2 gt 5 gt lt commandn gt Any number of white space characters are allowed between the last target and the character and the first dependant and the character No white space is allowed before the first target Each target and each dependant must be separated by at least one white space character A tab character must be present at the start of a line containing a command Variables may be used in a description block using the syntax specified above under variable declarations There follows some examples of valid description blocks one of which uses the variable specified above under variable declarations e dirl filel obj c dirl filel c c dirl filel h gee o dirl filel a OUTPUT INPUT DEPEND S EXECUTABLE INPUT F 3 2 Special commands There are two special commands which can be used in a description block The cd command changes the current directory and the set command sets an environment variable which will then be in use for the duration of the make file execution Both are used in the same way as the DOS equivalents There follows some examples of valid description blocks which use these commands CHANGEDIR gt od o dirl dir2 SETENV set VAR1 valuel gt set VAR2 value2 set VAR3 value3 It does
408. se of diode arrays The only exceptions being the AV and analog port All ports have pull up resistors except for analog port All V pins on the cable head assembly are connected together with the exception of the AV lt pin and are then monitored by the emulator to detect powered user system presence 2 5 2 User System Interface Circuits The interface circuit between the MCU in the emulator and the user system has a signal delay of about 8 ns due to the user system interface cable and it includes pull up resistors Therefore high impedance signals will be pulled up to the high level When connecting the emulator to a user system adjust the user system to compensate for propagation delays The following diagrams show the equivalent circuit examples of the interface signals The interface circuits depend on the MCU type For details refer to section 7 Hardware Specifications Specific to This Product 186 RENESAS 2 5 3 Clock Oscillator The oscillator circuit has been implemented on the user system interface cable head For details on the oscillator circuit refer to the user s manual for each user system interface cable 2 5 4 External Probe Trigger Output An 8 pin connector marked EXT on the right under the user system interface cable connector on the emulator case accommodates four external probe inputs and two trigger outputs The pin assignment of this connector is shown in figure 2 7 OOOQO00000 x
409. se or derived classes 1 Select the class that interests you in the Navigation view 2 Right click and view the pop up menu 3 To see the derived classes for the selection click the Show Derived Classes menu item To see the base classes for the selection click the Show Base Classes menu item 4 Depending on the selection a dialog is displayed which shows the class structure selected in an expanded tree format 5 Click Close to close this dialog once you have the information you require 173 RENESAS 13 2 C Function and defines navigation components These components simply add the function and define definitions to the Navigation view It is then possible to jump to these definitions by double clicking on the label you wish to view C define navigation 7 E cone category title aw define FLMAX FLMIN HEAPSIZE INT_OFFSET 4 OSTREAM amp LF 4 O_RDONLY S O_RDWR S O_WRONLY SR hit STDERR 6 STDIN 6 STDOUT far 09 Functions C function navigation g Temo category title amp sbrk ANSI C function CLOSEALL 4 INIT IOLIB hd Mi GE Projects GE Templates lt Navigation Figure 13 8 C Function and defines navigation information 174 RENESAS 14 Smart Editor Another feature of the High performance Embedded Workshop is its smart edit facility This is enabled by default for all C source files This feature allows the
410. se registers can only be FF82 X A X A X O used in the microcomputers FF83 X A X a X O including flash memory They cannot be accessed in the H8 3297 group FF8F X X X X X O FF91 a a a a a 4a FFAA O O X X X O Ports A and B can only be used FFBC O O X X X O in the H8 3437 and H8 3434F group These registers cannot be accessed in the H8 3297 group FFC3 O O O O O a FFD8 O O O O X O The IICbus cannot be used in FFD9 O O O O X O the actual H8 3397 group FFDE O O O O X ie FFDF a A A A X a FFFO O O O O X O The HIF cannot be used in the FFF4 O O O O X O actual H8 3397 group These FFF5 O O O O X O registers cannot be accessed in FFF6 O O O O X O the H8 3297 group FFF8 O O O O X O The D A converter cannot be FFF9 O O O O X O used in the actual H8 3397 FFFA O O O O X O group These registers cannot be accessed in the H8 3297 group FFFC O O O O X O The HIF cannot be used in the FFFD O O O O X O actual H8 3397 group These FFFE O O O O X O registers cannot be accessed in the H8 3297 group Note O indicates the same specifications as the actual MCU X indicates that a register that does not exist in the actual MCU can be accessed in the emulator A indicates that the initial value of the register differs between the actual MCU and the emulator 428 RENESAS Access to the Reserved Area When accessing the reserved area note the following 1 Part of the reserved area specified in each MCU s memory map can b
411. seestoxevansendeveeteetevesdideseesustesneusedestassezesied 410 Section 8 Software Specifications Specific to This Product 411 8 1 Software Specifications of the H8 300 and 300L E6000 Emulator ee 411 SLi Target Hard Wate cs ciisssucssteconassssssteatensccsusiseseskcusvsaraas ev tnageeie acdc ieseeousenstebvesiee 411 S 1 2 Selectable PlathOnrs uccssecsessessevesensenieodydonsucerdovedt EEEE EEEIEE e ES 411 8 1 3 Configuration Properties Dialog Box General Page eseeceeeeseeseeneeeees 412 8 1 4 Memory Mapping Function 00 cece cee eceecseesceeceeseeesseeseeesseeesetaeteseeeeeees 418 SLY Satus WHIO Ean AE OAA IESE EREDA 418 8 1 6 Extended Monitor Function sssssssessssscsssevescsesssssrsssssssseeser sresivrissvavsssrasevosorosir s 420 8 1 7 Signals to Indicate Bus States and Areas eet eee cess teeeeeeeeeeeeeeeeeeeees 421 8 1 8 Monit rin Function ieissar sints 422 SLO Taper POMS ooieoe strooi n eanas aue eane erT aE EEE EE EEE TEE EE 422 8 1 10 Trace Informations ssrin siei AR AEE 422 S111 Searching for Trace Record ccsscccesssceisiceacsvsavsacaveatassveestaceva aeecsvestseseseetsaevecases 423 S12 Trace Filtering Function sis sccsssecivcsssaccsssseedepneeaveascvtacsveeseoasusesecesponecessaeavsensaseind 423 8 1 13 Performance Analysis Window cccccceceeceeseeseeeeeerceeeeeeeseeseeaeeeeeenseaeeaeeneeaees 423 8 2 Note on Usage of the H8 300 and 300L E6000 Emulator eee ceeeeeeeeneeee 424 8 2 1
412. so important when using custom version control support to specify the arguments in a flexible way as a single version control command can be applied to more than one file To facilitate this the Arguments field has a placeholder button refer to appendix C Placeholders for an in depth discussion of placeholders which when clicked on invokes a pop up menu of available placeholders figure 8 6 An explanation of each placeholder and how their values are derived can be found in table 8 2 Arguments Field Placeholders User login name User login password Version control directory Comment File path name Filename File leaf File extension File directory Configuration directory Project directory Workspace directory Temp directory Command directory Windows directory Windows system directory Workspace name Project name Configuration name Figure 8 6 Arguments Field Placeholder Pop up Menu 140 RENESAS Table 8 2 Arguments Field Placeholders Placeholder Value and How its Determined User login name Current user login General tab User login password Current user password General tab Version control directory Virtual version control mapping Projects tab Comment Comment specified before command execution File path name Full path and name of file involved in operation Filename Filename including extension of file
413. source file x Ca Tutorial S Tutorial C source file 2 dbsct c 8 sbrk c E C source file Bj resetprg cpp sort cpp E oraico E Download modules H Tutorial abs B Dependencies E sbrk h sort h B stacksct h o D 0x00001036 0x00001034 0x00001038 0x00001044 0x00001046 0x0000104e 0x00001050 0x00001058 0x0000105a 0x0000105c 0x00001070 0x0000107a 0x00001082 0x0000108a 0x00001096 0x000010a2 0x000010ae 0x000010ba 0x000010c6 0x000010d2 0x000010de 0x000010ea Ox000010f6 0x000010fc void main void while 1 tutorial void tutorial void long a 10 long j int i class Sample p_sam p_sam new Sample for i 0 i lt 10 i j rand SEE OE P ai aie r s ali j p_san gt sort a p_sam gt change a p_sam gt s0 a 0 p_sam gt s7 a p_sam gt s8 a Pp_sam gt s9 a delete p_sam dd M pi z l v io a u w WO IT oe wr Py aaa Figure 6 3 Source Window Displaying the Source Program e Select a font and size that are legible if necessary For details refer to section 4 Using the Editor in the HEW part Initially the Source window shows the start of the user program but the user can use the scroll bar to scroll through the user program and look at the other statements 342 RENESAS 6 4 Setting a PC Breakpoint A PC breakpoint is a simple de
414. specify the functions required for this MCU See the hardware manual for details Mode Selects the MCU s operating mode Clock Selects the speed of the MCU s clock and sub clock Timer Resolution Selects the resolution of the timer for use in execution time measurement The value 20 ns 125 ns 250 ns 500 ns 1 us 2 us 4 us 8 us or 16 us can be selected The timer for execution time measurement has a 40 bit counter At 20 ns the maximum time that can be measured is about six hours and at 16 us the maximum time is about 200 days When the counter overflows the maximum time possible for measurement will be displayed with prompt gt that indicates that the counter has overflowed Enable read and write on the fly When this box is checked it is possible to access the target system memory while the user program is running Do not check this check box if you require realtime emulation Break on access error When this box is checked a break the user program stops occurs if your program accesses a guarded memory area or writes to a write protected area Enable internal ROM area write When this box is checked writing to the internal ROM area is enabled For the result of writing see the Extended Monitor window User VCC Threshold Sets the voltage level for the user system User Signals When this box is checked the reset NMI standby and bus request signals from the user sy
415. splay PC Go To Disassembly Figure 2 4 Editor Window Pop up Menu e In the HEW it is also possible to Drag and Drop files from Windows Explorer onto the workspace window These files will be automatically added to the project and are displayed in the folder in which they were dragged to Note If you add a file to a project when it is an unrecognized file type then it will still be added to the project Certain functions will be disabled with reference to this file When this file is double clicked in the workspace window instead of opening the file in the editor the open operation is passed to Windows operating system The default open operation is then carried out as if the file was opened in Windows Explorer To view the current defined extensions use the File Extensions dialog see the section on file extensions later in this chapter 14 RENESAS 2 2 2 Removing Files from a Project Files can be individually removed from a project selections of files can be removed or all files can be removed gt To remove files from a project 1 Select Project gt Remove Files or click the right mouse button on a project icon in the Projects tab of the Workspace window and select Remove Files from the pop up menu see figure 2 5 The Remove Project Files dialog will be displayed figure 2 6 Open dbsct c Build dbsct c Build Options Add Files INS Remove Fi
416. splayed 105 RENESAS 5 9 Custom Project Types The Project gt Create Project Type menu item in HEW allows you to create a template for your project This menu item takes the settings of the current project and then creates a project type for you The user can specify the name of the new type and style of the project generation wizard Once created these project types appear in the Tools Administration dialog and are initially hidden in the system components part of the tools administration tree To export one of the custom project generators select the Export button on the Tools Administration dialog The execution environments of the custom project generators are packaged on the execution file that can be installed When this file is executed on the target user s machine the custom project generator is installed Once created custom project type will then appear in the New workspace dialog and can be used to create identical copies of your project gt To create custom project generator 1 Open the workspace that contains the project you wish to convert into a custom project generator 2 Set the project you wish to convert as the current project 3 Click the Project gt Create project type menu item 4 The following dialog is displayed What title would you like to be used for the new project type CuntentProjectName Projects generated using the new type will include all of the files in the projec
417. ssing return when the auto indentation feature is disabled the insertion cursor returns to the left hand side of the window on the next line When the line int z 20 is typed it is not aligned with the previous two lines The second example ii shows the effect of pressing return when auto indentation is enabled the insertion cursor drops underneath the Erste i of the previous line Now when the line int z 20 is typed it is automatically aligned i e automatically indented void myfunction void int x 5 int y 10 sale int z 20 void myfunction void int x 5 int y 10 eel int z 20 i Auto Indentation Disabled ii Auto Indentation Enabled Figure 4 8 Effect of Auto Indentation To enable disable Auto Indentation 1 Select Tools gt Options The Options dialog will be displayed Select the Editor tab figure 4 7 2 Set the Enable auto indentation check box accordingly 3 Click OK for the setting of the auto indentation check box to take effect 84 RENESAS 4 9 Splitting a Window The High performance Embedded Workshop editor allows you to split a text window into two Figure 4 9 shows the split bar button which is located just underneath the maximize button at the top right hand corner of any text window Figure 4 9 Split Bar Button gt To split a window Double click on the split bar button to split the windo
418. sssasecscsascesessassnssweassheessqasvecvaysekestones ncavaasshdenadovaccobibeudevnsstadaneegiotse 379 OF Stack Trace Funcoms serris e eE EV O EER EEEE 380 618 Monitor Functions norisi orrien Raa S EE EEE EA EE EEEE 381 6 19 What NEK ccs cs scecs taste ts ccseseshi asso st ouscd daldcctestonoeretentessveenionscesdiscewtondecastodesadweecdvaswealdveantense 383 Section 7 Hardware Specifications Specific to This Product 385 7 1 H8 300 and 300L E6000 Emulator Specifications sssssssssessssssssssrsssrsrsrsrsrsrsreesrsrsssesne 385 Ti Supported Nensi reiner an T E A E E t 385 7 1 2 Operating Voltage and Frequency Specifications s sseeseererererererererersrsrenene 386 7 2 Installing the Evaluation Chip cccccc csccssscsscessessssewsscsossnsveanecrsntoveseoedecsstoedeasseenseastonedvestonese 388 TS User System Mitett ace jesse isacecssssseaezvouessiuectestexeaseselientuesedoncesssdevewtonseestessteetesssvedeeast beaaies 388 Tal Signal PrOvecthON 5 cs cccsersonescetasecnceraveevcedosecncorpuccscnsyacssevenesgeenvaressavieenceanaesncses 388 7 3 2 User System Interface Circuits of the H8 300 Group Evaluation Chip HS3308EVI60H uu eee eeeeececeecseceeeececaeeetseseeeeeeeee 389 7 3 3 User System Interface Circuits of the H8 350 Group Evaluation Chip HS3508EVI60H uu eee cece eens ceeececeeeeeecaeeesseeeeeeeaeee 391 7 3 4 User System Interface Circuits of the H8 338 H8 329 Group Evaluation Chip HS3398EVI60H uo eee eeeeeeeeeece
419. stem are enabled Driver Displays the E6000 driver that is currently installed Change driver in start up When this box is checked selection of a driver will be available next time the emulator is connected Note The items that can be set in this dialog box vary according to the emulator in use For details refer to section 8 Software Specifications Specific to This Product or the online help 220 RENESAS 5 1 2 Selecting an MCU Not Included in the List Selecting Custom in Device of the Configuration Properties dialog box adds the Custom Device page to the dialog box nfiguration Properties 2 x I General Custom Device ROM Bees x F Enable Flash memory RAM 16kB he Pin 120 128PinB Modules V Enable DTC M Enable DA A D Converter M Enable D A Converter Enable ICO a i IV Enable Refresh Controller MV Enable 1101 a M Enable DMAC M Enable WDT1 SCI Select M Enable TPU3 5 Enable TMR2 3 C sco nt scio 2 IV Enable PwM14 C scio3 M Enable MultiProcesserComunication SCI1 4 SCI0 4 Figure 5 2 Configuration Properties Dialog Box Custom Device Page Use this page to specify functions for an MCU not included in the list of MCUs The items are adopted by the device last selected Custom Device page ROM Specify the internal ROM area size RAM Specify the internal RAM area size Pin Specify the product package Modules Check this box
420. syntax and how to specify exit code conditions F 1 3 Parameters The following table shows the available parameters and their function Table F 1 hmake s parameters and functions Parameter Function A Execute all commands regardless of input output file status Equivalent to a Build All N Use status of input output files to calculate what commands need to be executed as normal and then display the commands but do not execute them 1 Display help info 455 RENESAS F 2 File syntax There are four basic types of statement used in a hmake file the variable declaration the description block the comment and the message command These can be combined in any order to produce a hmake file but a variable must be declared in a variable declaration before it is used in a description block or other variable declaration The first all statement used in nmake files is not required in a hmake file Commands are executed in order as they appear in the make file Note the character is used to show were a tab character must be used in order to keep the make file syntactically correct F 2 1 Variable declarations A variable declaration declares a variable which can then be used in any statement throughout the rest of the hmake file A declaration has the following syntax lt variable name gt lt value gt Any number of white space characters are allowed between the variable name and the sign and the
421. systems can be specified via the Projects tab of the Version Control Setup dialog figure 8 7 141 RENESAS ersion Control Setup 2 xi Commands Projects General Show details for project Project Ne r Details Version control directory mappings Source Director c work application project x we swapp project1 c Wwork application src x ve swiapp sre Modify c work shared x we swishared Remove gt I Environment Add Modify Remove Figure 8 7 Version Control Setup Dialog Projects Tab To define a new mapping 1 Select Version Control gt Configure The dialog shown in figure 8 1 will be displayed Select the Projects tab and the dialog shown in figure 8 7 will be displayed 2 Click the Add button that is next to the Version control directory mappings list The dialog shown in figure 8 8 will be displayed 3 Enter the source i e working directory into the Source directory field or browse to it graphically by clicking the Browse button 4 Enter the version control directory i e controlled directory into the Version control directory Version Control Directory Mapping 24 x Source directory ox le work shared gt Browse Cancel Version control directory x we swishared Figure 8 8 Version Control Directory Mapping Dialog 142 RENESAS
422. t 2 H8 3813 H8 3812 H8 3857 HS3857EIO60H H8 3857F H8 3856 H8 3855 H8 3854 HS3854EIO60H H8 3854F H8 3853 H8 3852 HS3876EVI60H H8 3877 None H8 3876 H8 3875 H8 3637 H8 3636 H8 3635 H8 3627 H8 3626 H8 3625 H8 3824 H8 3623 H8 3622 HS3927EVI60H H8 3927 H8 3926 H8 3925 H8 3924 HS3644EPI60H None H8 3657 H8 3656 H8 3655 H8 3654 H8 3653 H8 3652 H8 3644 H8 3643 H8 3642 H8 3641 H8 3640 H8 3644F 2 5MHz H8 3643F 4MHz H8 3642F 5MHz 8MHz 10MHz 16MHz Target Target 2 Note Target 2 in Clock and Target in SubClock are only available when the target system is connected 417 RENESAS 8 1 4 Memory Mapping Function This function allows the external memory area H8 300 mode 1 and mode 2 only or the reserved access prohibited areas to be mapped in one byte units Each memory block can be set in memory on the user system and the access can be specified as read write read only or access prohibited in each case It is not possible to change the attributes of memory incorporated in the MCU internal ROM internal RAM or internal I O 8 1 5 Status Window Selecting View gt CPU gt Status or clicking the Status Display toolbar button displays the Status window The Status window has three sheets This emulator displays the following items 1 Memory Sheet Selecting the Memory tab on the Status window displays this sheet Table 8 4 Memory Sheet Items Item
423. t File s Remove File s Status of File s Modify Remove Move up Move down Figure 8 1 Version Control Setup Dialog Commands Tab RENESAS The Commands tab contains two lists of menu options The first list System menu options and toolbar buttons represents those menu options which always appear on the version control sub menu These menu options also have an associated toolbar button on the version control toolbar The second list User menu options represents those additional user defined options which are added to the bottom of the version control sub menu Figure 8 2 shows the structure of the version control sub menu Options Select Configure its Add File s is Remove File s System amp Get File s Defined amp Check Out File s Option B Check In File s Status of File s A User History of Files Defined Undo Check out of File s Option Figure 8 2 Version Control Sub Menu 8 1 1 System menu options and toolbar buttons In order to invoke commands from the toolbar or the system defined options of the Tools gt Version Control sub menu you must first define the associated commands that should be executed when they are activated The names of the options and their intended action are listed in table 8 1 Table 8 1 System Menu Option Option Description Add File s Add selected file s to version control system Remove
424. t Recent Files menu option and from this sub menu select the desired file You can also open a file via the Projects tab of the Workspace window Either double click the file you want to open or select it click the right mouse button to invoke a pop up menu and then choose the Open lt file gt menu option where lt file gt is the name of the file selected 4 3 5 Closing Files gt To close individual files select one of the following methods 1 Double click on the editor window s system menu located at the top left of each window when not maximized 2 Click on the editor window s system menu located at the top left of each window when not maximized and select the Close menu option 3 Ensure that the window that you want to close is the active window and then press CTRL F4 4 Ensure that the window that you want to close is the active window and then select File gt Close 5 Click on the close button located at the top right of each window when not maximized gt To close all windows at once Select Window gt Close All 74 RENESAS 4 4 Editing a File The High performance Embedded Workshop editor supports standard editing functionality This is available through the usual methods i e the menu toolbar and keyboard shortcuts and is additionally supported via a pop up menu or local menu that is local to each editor window To invoke it place the pointer in an open window and click the right m
425. t directory and below Would you like to include the contents of the configuration directories Yes please No thanks View directories to be included Approx size of generator Next gt Einish Cancel Figure 5 15 New project type wizard Step 1 Dialog 5 The edit field is set to the current projects name This will become the name of the new project generator project type that will appear in the new workspace dialog Change the contents of the fields as appropriate 6 At this stage you can choose to include the configuration directories or not In this case it is normal to not include the contents of these directories because normally these are only intermediate files 7 Then click next The following dialog is displayed 106 RENESAS What type of generator would you like No dialog Information dialog with default bitmap Information dialog with bitmap Browse What Icon would you like to be used The default icon An icon contained in the file M ose Image ja Approx size of generator lt Back Newt gt Einish Figure 5 16 New project type wizard Step 2 Dialog 8 At this stage you can change the wizard graphic and the project icon By default no dialog is displayed for this wizard When you wish to display Project information dialog box you should either information dialog with default bitmap or information dialog with bitmap
426. t the user system interface cable to the connector of the emulator if you use the user system interface cable This is not necessary when you do not use the user system interface cable 3 Turn on the emulator Be sure to turn on the user system before supplying power to the emulator if you use the user system 4 Activate the HEW from Programs in the Start menu 5 The Welcome dialog box is displayed m Options OK BSc Cancel lkt g gt Open a recent project workspace Administration m amp t Browse to another project workspace Figure 4 2 Welcome Dialog Box Create a new project workspace radio button Creates a new workspace Open a recent project workspace radio button Uses an existing workspace and displays the history of the opened workspace Browse to another project workspace radio button Uses an existing workspace this radio button is used when the history of the opened workspace does not remain In this section we describe the following three ways to start up the HEW e Create a new project workspace a toolchain is not in use e Create a new project workspace a toolchain is in use e Browse to another project workspace The method to create a new workspace depends on whether a toolchain is or is not in use Note that this emulator product does not include a toolchain Use of a toolchain is available in an environment where the H8S H8 300 series
427. t to remove to display the popup menu 2 Click the Columns menu item to display a cascaded menu item The columns are displayed in this popup menu If a column is enabled it has a tick mark next to its name Clicking the entry will toggle whether the column is displayed or not 228 RENESAS 5 2 3 Viewing the Assembly Language Code If there is an address at the cursor position in the Editor window selecting Go to Disassembly in the pop up menu opens the Disassembly window The first address displayed in the Disassembly window is the address where the cursor is placed in the Editor window If you do not have a source file but wish to view code in the assembly language level either choose View gt Disassembly or click on the Disassembly window s toolbar button S A while 1 00001036 40FC 26 202 F 28 29 void tutorial void tutorial O01006DF3 0000103C 01206DF4 00001040 79370028 30 00001044 OFF3 main 8 ER3 ER ER4 ER6 SP H 0028 R7 ER ER3 long a 10 long j int i class Sample p_sam P_sam new Sample 00001046 1480 SUB ERO ERO 00001048 SE002000 JSR Sample Sample 24 oo00104C OF86 MOV ERO ER6 z for i 0 i lt 10 i J o000104E a SUB R4 R4 38 j rand 00001050 SEOO11EE JSR _rand 24 Figure 5 8 Disassembly Window 5 2 4 Modifying the Assembly Language Code You can modify the assembly language code by double cl
428. t to replace is the active window 2 Position the insertion cursor at the point from which you want to start your search 3 Select Edit gt Replace press CTRL H or select Replace from the editor window s local menu A replace dialog box will be displayed figure 4 4 4 Enter the text that you want to search for into the Find what field or select a previous search string from the drop down list box If you select text before invoking the replace operation the selected text will be automatically placed into the Find what field 5 Enter the text that you want to replace the search string with into the Replace with field or select a previous replace string from the drop down list box 21x Find what str ing x Replace with rumeric 7 Replace I Match whole word only piled h __ _ Replace All Selection Match case J Regular expression Whole file Cancel C All open files Replace Figure 4 4 Replace Dialog 6 If you would like to search for character string as a whole word then check the Match whole word only check box When this option is not selected the search will be for any string that is matched by the search string 7 If you would like your search to be case sensitive i e to distinguish between upper and lower case letters then check the Match case check box 8 If your search string uses regular expressions then check the Regular e
429. tamp value when this box is checked Setting Detects the specified time stamp value Every field must be filled in Value Enter the time stamp value The format is as follows hour h minute min second s millisecond ms microsecond us nanosecond ns Not available when Don t care has been checked 5 16 5 Clearing the Trace Information Select Clear from the popup menu to empty the trace buffer that stores the trace information If several Trace windows are open all Trace windows will be cleared as they all access the same buffer 5 16 6 Saving the Trace Information in a File Select Save from the popup menu to open the Save As file dialog box which allows the user to save the information displayed in the Trace window as a text file A range can be specified based on the PTR number saving the complete buffer may take several minutes Note that this file cannot be reloaded into the Trace window Note In filtering of trace information the range to be saved cannot be selected All the trace information displayed in the Trace window after filtering will be saved Select a filtering range on the General page in the Trace Filter dialog box if you want to save the selected range For details on the filtering function refer to section 5 16 12 Extracting Records from the Acquired Information 312 RENESAS 5 16 7 Viewing the Source Window The Source window corresponding to the selected trace
430. te in a byte unit Add Displays the Edit Memory Mapping dialog box allowing the user to modify the address range and attributes of a memory map Modify Displays the Edit Memory Mapping dialog box allowing the user to modify the address range and attributes of a memory map Reset Resets the map memory to its default settings Close Closes the dialog box The memory configuration of the device being emulated is displayed by the Memory sheet in the Status window Note Some emulators may not support the emulation memory or the memory mapping function For details refer to section 8 Software Specifications Specific to This Product or the online help 223 RENESAS 5 1 5 Changing the Memory Map Setting Clicking the Add button on the Memory Mapping dialog box or clicking the Modify button after selecting the information on the memory map setting you want to change opens the Edit Memory Mapping dialog box Memory Mapping fom Carel To eT Setting On Chip Read write v Figure 5 5 Edit Memory Mapping Dialog Box Use this dialog box to change the address range and attributes of a memory map From Enter the start address of the map range To Enter the end address of the map range Setting Enter the memory map setting The choices given are listed below The User external memory and Emulator emulation memory attributes can be modified 224 On chip Read w
431. tensevestestesesvends 259 5 10 9 Searching for the Next Label oe eececes cess cecceeeseeeeeseseseeesesessseessesaeees 260 5 10 10 Viewing the Source Corresponding to a Label cece cece tees teteeeeeaes 260 Executing Your Programi 55 55iiscics Saves ates aeneae EOV ESEA EESE T 261 Sel did Rinmin MOM RESE seirer rererere ira TEETAN EEE ER 261 STAD COminuini ge RUM 4 scssseesncsedssscsnessoncstessecssbsaseasenssbssayssshsnsvestyeouscveysosscnseissyesskesd 261 SHAS Running tothe Cursor ieseana eseria iasoer iaoei iiri 261 5 11 4 Running from a Specified Address s snsssessssesesereeeresssessstsssrsrsrsrsrsrrsssrsrsrsess 262 SALS Single Step iiseciccsssececesssescsresesessosnessecssieisontsisdsanvgaeddasvsnsecanssesnsoonvasdgucbsaseeconpeasecs 263 Sk O Multiple Sepse nnna EEE EI EI EEEREN ETEEN EEEE E 264 SLOPPUIE GUE Progra oiiro onie E TE EEE EEEE A Nh 265 5 12 1 Stopping the Program by the Stop Toolbar Button eects 265 5 12 2 Standard Breakpoints PC Breakpoints 0 0 0 0 cece sees cseceeeeeeeeeeeeeeeeaeees 265 Blf DWart2 Supports vessie i oraties ereen CIC tosndaed eoaeanstaesysuatvesetecnesseaest ous 267 SA43 1 CICA OPCLALOLS co ckcersncckcnrsucstcorsnensceanndsgsarbannssavineccesviesncasssanndaondesusseusescsensreesads 267 513 2 C CP EX Pres si Ons ss csvsascatssass tain sys cases TEE EE EA EN EEEo aaide Rean EEEak 267 5 13 3 Supporting Duplicate Labels cece eeeeceeeceesaeeecseseeeesseeessesaseeeaeees 268 5 13 4 Debugging
432. tensions list Add File m Eile extension a Jasm x m File group Extension belongs to an existing group Assembly source file 7 Extension belongs to a new group peen ted application Open group with Editor z Add Modify Remove Figure 2 10 Add File Extension Dialog Existing Group In addition to opening a file with the editor the File Extensions dialog allows you to associate any application with any file group so that when you double click on a file in the Projects tab of the Workspace then the appropriate application is launched with the file Figure 2 11 shows the association between a word processor and the extension DOC RENESAS File Extensions C list file C source file Text editor CPU information file Word processor VEJ Documents Expanded assembly source file Librarian xil Library file Library list file Library section list file Linkage map file Linkage symbol file No application obj Object file Figure 2 11 File Groups and Applications gt To associate an application with a file group 1 Select the file group to be associated from the File Extensions dialog figure 2 11 2 Click the Open with button The Modify File Extension dialog will be displayed figure 2 12 None a Windows default Modify aaa REMOVE Figure 2 12 Mo
433. terface Circuit for TONED and TONEM 7 3 11 User System Interface Circuits of the H8 3927 Group Evaluation Chip HS3927EVI60H All user system interface signals are directly connected to the evaluation chip in the emulator with no buffering except for those listed below which are connected to the evaluation chip through control circuits e RES e NMI e OSCI e XI e TEST The circuits that interface the evaluation chip in the emulator to the user system include pull up resistors that cause signal delays Note that when an input terminal is in the high impedance state the pull up resistor forces the terminal to be at a high level Adjust the user system hardware to compensate for these effects The delay caused by the user system interface cable is about 3 ns The following diagrams show the user system interface signal circuits Default o User system 479 interface cable Figure 7 67 Default User System Interface Circuit 407 RENESAS RES TEST and NMI These signals are input to the evaluation chip via HD151015 Therefore the rising falling time must be within 8 ns or less User system 47Q interface cable HD151015 Figure 7 68 User System Interface Circuit for RES TEST and NMI OSC1 and X1 These signals are input to the evaluation chip via HD151015 Therefore the rising falling time must be within 8 ns or less Veco 4 7kQ User system 47Q interface cable HD151015 Figure 7 69 User Syst
434. tesceiesrotssioneonacessoneubonacucyes 125 Using the workspace and project log facilities sssssssssssesesesesesessrsrsrnrsrsrerererersrsrsrsns 127 Using the virtual desktop cccssccsssscecesssssessovenscssosentstencsaconssosasvarostssessonsseovasssstenasbones 127 VeFSION COMTO 20 ccsiesaessaeacssehieiosessionsiiabiedsdeasiesecevedearaenad edness 129 Selecting a Version Control System seeesesesesesesereseresestsrsesesesesrerererererorereresesesesesesesesese 130 Using the Custom Version Control System eee 133 Defining Version Control Menu Options 0 0 ccce eee eee cecescececeecseseesesseeesseeeeesaeees 133 8 1 1 System menu options and toolbar buttons as 8 1 2 User menu Options ies ceseseencecssvastectsvasscessescdeastvaxeisoycovadosnessyssussoeyeognassccsdnssbeesd Defining Version Control Commands ccec cece ese ceeseseeesecesceesecesseseesessesessseesesaeees 139 8 2 1 Executable return Code wie eccsisssccsseseessssetenteocetevestesioventontepestossesesaonsstescecssaens ates 139 Specifying Are uments cisas0cnce vsecscerowedeceossansceennendcassecnsdaonoursesssnctsassdesnseosasdseesdasessoavensicos 140 8 31 Specifying File Locations visi csssuscasecessseceovassatevnescasassaveadaverdeacessvasetss Rae EN Eisi 141 8 3 2 Speci ying Environment cererii atacats oreet rE EESTE EENE EET A RESY 144 8 33 Specifying Comments sc sssccsssciscisccctsteeatsssedcavenedetaceveescgucsstasacssoateccseascrsepeassine 145
435. test program Shows the results of decoding test for the trace RAM in the E6000 normal completion Shows the results of marching test for the trace RAM in the E6000 normal completion Shows the results of decoding test for the mapping RAM in the E6000 normal completion Shows the results of marching test for the mapping RAM in the E6000 normal completion Shows the results of decoding test and marching test for emulation memory in the E6000 completion normal hows the check results or the step execution he E6000 ompletion S T controlling circuits in normal c hows the check results or the forced break he E6000 ompletion S y controlling circuits in normal Shows the check results for the illegal access break controlling circuits in the E6000 normal completion 10 Internal ROM Write Protect WLLtS PLOlSCE sscscsaes eves eeaws ews OK 11 Testing Double Stack I O Stack Test Setting up please wait DOUBLE Stack s4 c s cases g argo gga gr oe gt OK L O Stack 4 4 bsg s eae ganas gene geaarean ae OK 0 total errors Tests passed emulator functioning correctly Shows the check results for the internal ROM write protection controlling circuits in the E6000 normal completion Loading the test program Shows the check results for the stack controlling circuits in the E6000 normal completion Total number of errors Shows
436. th the host computer and continues to wait for the host computer response In this case initialize the HEW turn off the emulator connect the user system and then restart the emulator 2 Setting the emulator configuration Select Option gt Emulator gt System or click the Emulator System toolbar button to open the Configuration Properties dialog box In Device select the target MCU including flash memory e g H8 3337YF For emulation in the boot mode check Enable Boot Mode Close the Configuration Properties dialog box 3 Starting emulation in boot mode Select Debug gt Reset Go or click the Reset Go toolbar button to start program execution from the reset state The evaluation chip is reset and boot programming mode emulation starts During emulation in boot programming mode the write protection of the internal ROM area is disabled 429 RENESAS 8 2 8 Notes on Use of the H8 3217 H8 3318 Group Evaluation Chip Set HS3318EVI60H e I O Register Differences Between Actual MCU and Emulator In the E6000H emulator one evaluation chip emulates several types of MCU Therefore there are some differences in I O registers between an actual MCU and the emulator as shown in table 8 19 Note these differences when accessing the I O registers T O port is in the input state at default The I O register contents indicate the emulator port status When the user system interface cable is not co
437. th to a file when it is entered from the keyboard To save this trouble a full path can be easily specified by browsing through files 232 RENESAS Choose Browse from the popup menu to open the Browse dialog box Select a file and click Open to paste the full path to the selected file to the cursor location This option can only be used when the cursor is located on the last line 5 3 8 Pasting a Placeholder Select a placeholder from the Placeholder submenu in the popup menu to paste the selected placeholder to the cursor location This function is only available when the cursor is located on the last line 233 RENESAS 5 4 Viewing the Registers If you are debugging at assembly language level then you will find it useful to see the contents of the CPU s general registers You can do this by using the Register window 5 4 1 Opening the Register Window To open the Register window choose View gt CPU gt Registers or click the Register toolbar button Fl The Register window opens showing all of the CPU s general registers and the values displayed in hexadecimal 15 x ERO H 00000000 ER1 H 00000000 ERZ H 00000000 ERS H 00000000 ER4 H 00000000 ERS H 00000000 ER6 H 00000000 ER H 00000010 PC H 000000 CER H 80 I0 IEXR H 0 lll Figure 5 14 Register Window 5 4 2 Expanding a Bit Register If a register is used as a set of flags at the bit level for the contr
438. that a register that does not exist in the actual MCU can be accessed in the emulator A indicates that the initial value of the register differs between the actual MCU and the emulator Access to the Reserved Area 1 The reserved area H FF80 to H FF9F in the H8 3814 group is used by the emulator If this area is assigned to the emulation memory by the map setting operation cannot be guaranteed Do not use this area 2 The reserved area H F000 to H F73F in the H8 3834 group or the H8 3814 group is used by the emulator If this area is assigned to the emulation memory by the map setting operation cannot be guaranteed Do not use this area User Program Execution by the Go Reset Command When the user program is executed by the Go Reset command a reset signal is input for about 500 us to the evaluation chip from the emulator For the execution time measurement result the time for reset signal input is added 432 RENESAS 8 2 10 Notes on Use of the H8 3637 H8 3877 Group Evaluation Chip Set HS3876EVI60H e T O Register Differences Between Actual MCU and Emulator In the E6000H emulator one evaluation chip emulates several types of MCU Therefore there are some differences in I O registers between an actual MCU and the emulator as shown in tables 8 21 and 8 22 Note these differences when accessing the I O registers The I O port is in the input state at default The I O register contents indicate the emulator port sta
439. that you wish to save and a name and format for the file The File name combo box contains the previous four file names used for saving memory Clicking the button can open the standard File Save As dialog box On clicking the OK button or pressing the Enter key the dialog box closes and the memory block will be saved into the disk as a file of the specified format type The access size for saving data can be selected from the Access Size drop down list When the data is saved in memory with little endian the order of data depends on the access size 242 RENESAS A memory area in the address space can be verified using the memory verify function Open the Verify Memory dialog box by choosing File gt Verify Memory The access size at verification can be selected from the Access Size drop down list verify Memory i j ixi Format ema Binary m Cancel File name Ej Offset address pe ooo o Access size Fal Figure 5 26 Verify Memory Dialog Box 5 5 11 Disabling Update of the Window Contents Automatic update of the Memory window contents which is performed when user program execution stops and in other cases can be disabled This is done by checking Lock Refresh in the popup menu The Memory window will be grayed 5 5 12 Updating the Window Contents The Memory window contents can be forcibly updated This is done by checking Refresh in the popup menu 243 R
440. the Status Window PC Break Note The items that can be displayed in this window differ depending on the product For the items that can be displayed refer to section 8 Software Specifications Specific to This Product or the online help 361 RENESAS 6 15 2 Breaking Execution at Event Points Setting up of an event point on event channel 1 Ch1 such that a break is triggered when the event point s conditions have been satisfied five times is explained as an example of the use of event points Select Eventpoints from the Code submenu of the View menu The Event window is displayed The breakpoint that has been previously set must be deleted Click the Breakpoints window with the right hand mouse button and select Delete All from the popup menu to delete all the breakpoints that have been set Click the Event tab Up to 12 event points eight event channels and four range channels can be set up as independent conditions In this example we are setting the condition for event channel 1 Figure 6 35 Event Window Event Channel 1 Ch1 Select the line for Ch1 in the Event window Double click on this line that is highlighted The Breakpoint Event Properties dialog box is displayed Make the following settings in the boxes on the General page Select the Event radio button in the Type group box Select the Address radio button in the Address group box Then use the Source window to refer to t
441. the event point is satisfied no action will be taken even if the condition is satisfied again If you want the action to be taken again reset the event point so that the state transits to that where no condition is satisfied When the user program is stopped the states of all the event points transit to that where no condition is satisfied When an event point must be in the state where its condition is satisfied or not when No occurrence of is selected as the satisfaction condition of another event point this event point is called the arm event An event point can reset the tested states of conditions of other event points or itself by satisfying the condition This event point is called a reset event A reset event resets event points regardless of their states where the condition is satisfied or not e g resetting the pass count Select an event point from the Event combo box To set an arm event on the selected event point select Is Armed By and check the box corresponding to each event The No occurrence of check box is used to set a condition that the arm event is in the state where its condition is not satisfied To set a reset event on the selected event point select Is Reset By and check the box corresponding to each event At the bottom of the screen is a diagram showing the current sequencing of the events figure 5 65 The S input sets arms an event and the R input resets it The legend S indicates the event i
442. the execution of a program e Cancel all the breaks e To execute the remaining sections of the tutorial function select Go from the Debug menu or the Go button on the toolbar Figure 6 26 Go Button e The program goes into an endless loop To force a break in execution select Halt from the Debug menu or the Stop button on the toolbar Figure 6 27 Stop Button 6 14 Resetting the MCU Resetting the MCU initializes the internal I O registers and makes the program counter jump to the address set in the reset vector To reset the MCU select Reset CPU from the Debug menu or the Reset CPU button on the toolbar Figure 6 28 Reset CPU Button To execute the program from the reset vector select Reset Go from the Debug menu or the Reset Go button on the toolbar Figure 6 29 Reset Go Button Note This tutorial program is executable from the reset vector 358 RENESAS 6 15 Break Function The emulator s break functions are of two types PC breaks and breaks at event points PC breakpoints and event points are set in the HEW s Event window An overview and setting of the break function are described below 6 15 1 PC Break Function The emulator can set up to 256 PC breakpoints e Select Eventpoints from the Code submenu of the View menu The Event window is displayed e Select the Breakpoint sheet 2101 xi 4 gt Breakpoint Event A Trigger Figure 6 3
443. the item again The item s elements will collapse back to the single item and the minus sign changes back to a plus sign The watch item can be expanded for the number of levels when a numerical key from 1 to 9 is pressed while a watch item is selected 275 RENESAS Editing a Watch Item s Value You may wish to change the value of a watch variable e g for testing purposes or if the value is incorrect due to a bug in your program To change a watch item s value use the Edit Value function gt Editing a watch item s value Enter a value directly in the window In another way select the item to edit by clicking on it you will see a flashing cursor on the item Choose Edit Value from the popup menu The Edit Value dialog box opens ax Expression jo Current H O0OO0OFG Ox00ffef80 Value New Value Cancel Ceea Figure 5 56 Edit Value Dialog Box Enter the new value or expression in the New Value field and click OK The Watch window is updated to show the new value 276 RENESAS Deleting a Watch Item To delete a watch item select it and choose Delete from the popup menu The item is deleted and the Watch window is updated To delete all watch items choose Delete All from the popup menu All items are deleted and the Watch window is updated Specifying Realtime Update The R mark shown to the left of each variable indicates whether the variable is updated in real time When a
444. the specifications design user s manual and other documentation at any time without notice Target User of the Emulator Product This emulator product should only be used by those who have carefully read and thoroughly understood the information and restrictions contained in the user s manual Do not attempt to use the emulator product until you fully understand its mechanism It is highly recommended that first time users be instructed by users that are well versed in the operation of the emulator product RENESAS LIMITED WARRANTY Renesas warrants its emulator products to be manufactured in accordance with published specifications and free from defects in material and or workmanship Renesas at its option will repair or replace any emulator products returned intact to the factory transportation charges prepaid which Renesas upon inspection determine to be defective in material and or workmanship The foregoing shall constitute the sole remedy for any breach of Renesas warranty See the Renesas warranty booklet for details on the warranty period This warranty extends only to you the original Purchaser It is not transferable to anyone who subsequently purchases the emulator product from you Renesas is not liable for any claim made by a third party or made by you for a third party DISCLAIMER RENESAS MAKES NO WARRANTIES EITHER EXPRESS OR IMPLIED ORAL OR WRITTEN EXCEPT AS PROVIDED HEREIN INCLUDING WITHOUT LIMITATION THE
445. the standard and sub command file commands 458 RENESAS F 4 Comments A character signifies a comment When this character appears as the first character on a line the rest of the line up until the next new line character is ignored There follows examples of valid comments My hmake file Variable declaration OUTPUT c dirl filel obj Descriptor OUTPUT c dirl filel c c dirl filel h set VAR1 valuel gee o dirl filel ea A comment must occupy its own line in the hmake file It is not possible to put comments on the end of other statements F 5 Message commands The message command is used to output a line of text to standard out whilst a make file is executing These text lines will be output in the order they appear in the make file in amongst output from any executables being executed as appropriate No buffering of output text will take place A message command has the following syntax MESSAGE lt text to output gt A new line character is assumed to come after the last character in lt text to output gt Any white space between MESSAGE and lt text to output gt will be ignored There follows an example of a valid message command MESSAGE Executing C Compiler 459 RENESAS 460 RENESAS Appendix G Menus Table G 1 shows GUI menus Table G 1 GUI Menus Toolbar Menu Option Shortcut Button Remarks View Disassembly Ctrl D Opens the Disassem
446. the uninstall click the No or Cancel buttons Confirmation c hewST oalchains Hitachi SH 51 O she toolchain hrf c hew T oolchains Hitachi SH4 51 O sample c hew T oolchains Hitachi SH 451 ONinclude c hew T oolchains Hitachi SH451 O4lib c hew T oolchains Hitachi SH 451 O bin c hew T oolchains Hitachi SH 51 O hew c ShewT oalchains Hitachi SH 451 O bin dwcny exe c hew T oolchains Hitachi SH 451 O bin she exe c hew T oolchains Hitachi SH 451 O binshcasm exe c hew T oolchains Hitachi SH 51 O bin shcerr msq c hew T oolchains Hitachi SH 451 O bin shcerr off c hew T oolchains Hitachi SH451 O bin sheftt exe c hewT oolchains Hitachi SH 51 O bin shcgen exe c hewT oolchains Hitachi SH 451 O bin shchip msg c hew T oalchains Hitachi SH451 O bin shemdl exe c hew T oolchains Hitachi SH 51 O bin shcpep exe Figure 5 10 Confirmation Dialog 102 RENESAS 5 7 Technical Support Issues The Tools Administration dialog is also capable of displaying information regarding hidden system components These are part of the HEW itself that cannot be unregistered registered manually If you check the Show all components check box on the tools administration dialog extra component folders are displayed see figure 5 11 5 x Tools Administration Registered components E Cancel C Utility Phases E Debugger Components E Extension Component
447. this matched configuration does not exist then the HEW will use the configuration that was last used in the dependent project gt To make projects depend upon another 1 Select Project gt Dependent Projects The Dependent Projects dialog will be displayed figure 2 25 2 Select the project to which you would like to add dependents to When you do this the Dependent projects list will display all of the projects in the workspace excluding the selected project 3 The Dependent projects list has a check box for each project listed Set the associated check boxes to make those projects depend upon the selected project 4 Click OK to confirm the new project dependencies Dependent Projects 2 x Bret main_project hd z Cancel Dependent projects Mdepend01 depend02 Figure 2 25 Dependent Projects dialog 35 RENESAS 2 12 Removing a Project from a Workspace gt To remove a project from a workspace 1 Select the project from the Projects tab of the Workspace window and click the right mouse button to invoke a pop up menu N Select the Remove Project option pa Dialog box is displayed You confirm to remove the project In the Options dialog box of the Tools menu you can select this confirmation is performed or not Note You cannot remove the current project from the workspace 2 13 Loading unloading a Project into from a Workspace gt To load
448. ting system phase button is inactive if no more system phases are available Select the Create a new custom phase button to create your own build phase New Build Phase Step 1 of 4 2 Add ah eristirg Tiphases Figure 3 3a New Build Phase Dialog Step 1 41 RENESAS The second step figure 3 3b asks what type of phase you would like to create There are two choices multiple or single When a multiple phase is executed the command is applied to each file in the project of a certain file group For example if you set the input file group to be C source files then the command will be executed once for each C source file in the project A single phase is executed once at most during a build New Build Phase Step 2 of 4 W What type of phase would you like to create Multiple phase The command is applied to each file in a file group An example of this type of tool is a compiler or assembler Select input file group Single phase The command is only ever executed once per build An example of this type of tool is a linker lt Back l Next gt Cancel Figure 3 3b New Build Phase Dialog Step 2 The input file group list contains the current file groups defined for the project It is possible to define multiple input file groups by selecting the Multiple Groups entry in the input file group list Selecting this list entry displays the dialog in figure 3 3c
449. tion Hardware HS3008EPI60H HS3308EVI60H H8 330 2 5MHz None None 4MHz HS3508EVI60H H8 350 5MHz HS3398EVI60H H8 338 8MHz H8 337 10MHz H8 336 Target H8 329 Target 2 H8 328 H8 327 H8 326 HS3334EVI60H H8 3334 H8 3332 HS3257EVI60H H8 3257 H8 3256 H8 325 H8 324 H8 323 H8 322 HS3437EVI60H H8 3534 H8 3522 H8 3437 2 5MHz H8 3437F 4MHz H8 3436 5MHz H8 3434 8MHz H8 3434F 10MHz H8 3397 16MHz H8 3396 Target H8 3394 Target 2 H8 3337Y H8 3337YF H8 3336Y H8 3334Y H8 3334YF H8 3297 H8 3296 H8 3294 H8 3292 Note Target and Target 2 in Clock are only available when the target system is connected 415 RENESAS Table 8 2 Environment for the H8 300 E6000 Emulator CPU 300 Debugging Platform cont Evaluation SubClock Expansion Hardware Chip Set Device Option Clock Option Option Hardware HS3008EPI60H HS3318EVI60H H8 3502 2 5MHz None None 4MHz 5MHz 8MHz 10MHz Target Target 2 H8 3318 2 5MHz H8 3315 4MHz H8 3217 5MHz H8 3216 8MHz H8 3214 10MHz H8 3212 16MHz H8 3202 Target Target 2 Target and Target 2 in Clock are only available when the target system is connected Note 416 RENESAS Table 8 3 Environment for the H8 300L E6000 Emulator CPU 300L Debugging Platform Evaluation SubClock Expansion Hardware Chip Set Device Option Clock Option Option Hardware HS3LO8EPI60H HS3834EVI60H H8 3837 2 5MHz 32kHz None H8 3836 4MHz Target H8 3835 5MHz H8 3834 8MHz H8 3833 10MHz H8 3832 Target H8 3814 Targe
450. tions respectively 323 RENESAS 5 16 13 Calculating the Difference in Time Stamping Select Timestamp Difference from the popup menu to calculate the time difference between the two points selected by the result of tracing in acquisition of time stamp information Select 2 line First PTR Second PTR Timestamp Difference Get Difference Clear OK 324 Timestamp Difference i 2 x Select 2 line First PTR 32764 Second PTR fo Timestamp difference information Timestamp Difference 0000h 000min 000s 003ms 897us 875ns Get Difference Clear a EE Figure 5 94 Timestamp Difference Dialog Box Select trace records to calculate the time stamp difference Specifies the first pointer to measure the difference The pointer of the line selected on the Trace window is displayed by default Specifies the second pointer to measure the difference Displays the results of calculation Calculates the difference between the specified two points and display its result in the Timestamp Difference list Clears all the results in the Timestamp Difference list Closes the dialog box All the results in the Timestamp Difference list are cleared RENESAS 5 16 14 Analyzing Statistical Information Choose Statistic from the popup menu to open the Statistic dialog box and analyze statistical information under the specified conditions
451. tiple projects and files in the same way as Windows explorer to modify the options for more than one selection On the right hand side are the 3 options tabs This is where you set the options that you want to apply to the selected file s You can also choose which configuration information is being viewed from the configuration list on the upper left of the dialog box Each configuration is listed along with a special entry named Multiple configurations If you select multiple configurations then a dialog is displayed which allows you to select more than one configuration This method is used throughout HEW for modifying multiple configurations at once 50 RENESAS 3 4 1 Options Tab The Options tab figure 3 11 allows you to define the command line options that will be passed to the phase The Command field displays the command which was entered when you defined the phase figure 3 3d Enter into the Options field the command line arguments that you would like to pass to the command If you want to insert a placeholder select the relevant placeholder from the Placeholder drop down list box and then click the Insert button For a detailed description of placeholders see appendix C Placeholders Options Output Files Dependent Files Command E Hew T oolchains HitachiSH451 O4BIN Lbr exe Options sub CONFIGDIR buildlib sub Placeholder Insert button Conf
452. to the evaluation chip via HD151015 Therefore the rising falling time must be within 8 ns or less User system 479 interface cable HD151015 Figure 7 17 User System Interface Circuit for RES NMI and MDO 393 RENESAS MD1 Includes a 12 V detection circuit for supporting microcomputers including flash memory 12 V detection User system circuit interface cable MD1 monitor register 27 kQ Figure 7 18 User System Interface Circuit for MD1 EXTAL Clock oscillator circuit is on the user system interface cable User system 47Q interface cable HD151015 Figure 7 19 User System Interface Circuit for EXTAL STBY Hardware standby cannot be used 10 KQ Evaluation chip Figure 7 20 User System Interface Circuit for STBY ANO P70 to AN7 P77 Evaluation o User system chip 470 interface cable Figure 7 21 User System Interface Circuit for ANO P70 to AN7 P77 394 RENESAS AVcc and AVss Evaluation chip User system 27KQ j interface cable Figure 7 22 User System Interface Circuit for AVcc and A Vss 7 3 5 User System Interface Circuits of the H8 3334 Group Evaluation Chip HS3334EVI60H All user system interface signals are directly connected to the evaluation chip in the emulator with no buffering except for those listed below which are connected to the evaluation chip through control circuits e RES e NMI e MDO e MDI e EXTAL The circui
453. to validate internal peripherals Note The items that can be set in this dialog box vary according to the emulator in use Some emulators may not support the Custom Device function For details refer to section 8 Software Specifications Specific to This Product or the online help 221 RENESAS 5 1 3 Selecting the Interface to be Connected Checking Change driver in start up on the Configuration Properties dialog box allows a selection of the driver next time the emulator is connected E6000 Driver Details Driver HS AE r Details Interface juse interface x Channel E6000 USB Interface Configuration Configure I Change driver in start up Figure 5 3 Driver Details Dialog Box Driver Selects the driver that connects the HEW and the emulator Details Sets the details of the driver being connected Interface The name of the interface to be connected This should not be changed in this emulator Channel Channel for the selected interface This should not be changed in this emulator Configuration Driver setting Configure A dialog box for setting will be displayed when the driver supports the configuration dialog Note that this item is not available with this emulator Change driver in start up Checking this box selects the driver when the emulator is connected the next time 222 RENESAS 5 1 4 Opening the Memory Mapping Dialog Box
454. toolchain When the setting has been completed the following dialog box is displayed 2 xi Miyyyy E6000 Emulator GPU 2000 Micox E6000 Emulator CPU 2600 Target type all Targets x lt Back Finish Cancel Figure 4 5 New Project Step 7 Dialog Box The target for the session file used when the HEW is activated must be selected here Check the box against the target platform and then click the Next button For details on the session file refer to section 4 4 Debug Sessions 203 RENESAS 4 Set the configuration file name The configuration file saves the state of HEW except for the emulator Target name E6000 Emulator CPU 2000 Configuration name Debue_yyyy_E6000_Emulator_GP Detail options Modify Finish Cancel nw I a O Q Figure 4 6 New Project Step 8 Dialog Box If multiple target platforms were selected in the New Project Step 7 dialog box shown in figure 4 5 set the name of a configuration file for each of them each time pressing the Next button to proceed to the next target Setting of the configuration file name is the end of the emulator settings Click the Finish button to display the Summary dialog box Pressing the OK button activates the HEW 5 After the HEW has been activated the emulator is automatically connected The message Connected is displayed on the Debug tab in the Output window to
455. tor may not be able to parse your code correctly and the smart edit functionality will fail In this case no pop up will be displayed Please note that Smart edit does not support macro usage 177 RENESAS 178 RENESAS Emulator Debugger Part RENESAS RENESAS Section 1 Overview 1 1 Features The breakpoint memory map performance and trace can be set through the dialog box Intuitive user interface Online help Common display and operability Supported host interfaces The PCI interface PC card PCMCIA interface USB interface or LAN interface can be used for connecting to the host computer Realtime emulation Realtime emulation of the user system is enabled at the maximum operating frequency of the CPU Excellent operability Using the HEW enables user program debugging using a pointing device such as a mouse The HEW enables high speed downloading of load module files Various debugging functions Various break and trace functions enable efficient debugging Breakpoints and break conditions can be set by the specific window trace information can be displayed on a window and command line functions can be used Memory access during emulation During emulation the memory contents can be read and modified 179 RENESAS 1 2 Warnings CAUTION READ the following warnings before using the emulator product Incorrect operation will damage the user system and the emulator product The USER PROGRA
456. trace information is displayed in the Trace window O x PTR Address Instruction Data R W Area Status Clock Probes NMI IRQ7 0 Timestamp Source Lebe1 Timestamp Difference E 05550 000000 0000 RD ROM DATA a TIIE 11111111 05549 000002 0400 RD ROM DATA 1 TILE l 11111111 05548 000400 MOV L H OOF 7a07 RD ROM PROG 1 Site 11111111 entry v Power 05547 000402 Ooff RD ROM PROG x ANANN l 11111111 05546 000404 efcO RD ROM PROG T 1lll E 11111111 05545 000406 ORC B H 80 CCR 0480 RD ROM PROG l1 1111 11111111 set_ 05544 000408 JSR _INI Se00 RD ROM PROG iL TELE E 11111111 INIT 05543 00040a 1l0e RD ROM PROG eR JIII ts 11111111 05542 00110e MOV W R2 ER 6df2 RD ROM PROG T 1111 t 11111111 Mis 05541 ffefbc 0000 WR DATA T TILL 1 11111111 05540 ffefbe 040c UR DATA 2 anit 1ll11111 05539 001110 STM L ER4 E 0120 RD PROG x 11r 11111111 05538 ffefba 5770 WR DATA ey ALIR l1 11111112 05537 001112 6df4 RD PROG 3 AELE 11111111 05536 001114 MOY L H 000 7a00 RD PROG 3 1111 1 11111111 05535 ffefb6 5770 WR DATA T 1111 11111111 xl Figure 5 68 Trace Window This window displays the following trace information items PTR Cycle number in the trace buffer When the most recent record is record 0 earlier record numbers go backwards 1 2 If a delay count has been set the cycle number where the trace stop condition has been satisfied is record 0 For the cycle d
457. ts that interface the evaluation chip in the emulator to the user system include pull up resistors that cause signal delays Note that when an input terminal is in the high impedance state the pull up resistor forces the terminal to be at a high level Adjust the user system hardware to compensate for these effects The delay caused by the user system interface cable is about 3 ns The following diagrams show the user system interface signal circuits Default o User system 47 Q interface cable Figure 7 23 Default User System Interface Circuit RES NMI and MD0 These signals are input to the evaluation chip via HD151015 Therefore the rising falling time must be within 8 ns or less User system 479 interface cable HD151015 Figure 7 24 User System Interface Circuit for RES NMI and MDO 395 RENESAS MD1 Includes a 12 V detection circuit for supporting microcomputers including flash memory 12 V detection User system circuit interface cable MD1 monitor register 27 kQ Figure 7 25 User System Interface Circuit for MD1 EXTAL Clock oscillator circuit is on the user system interface cable User system 47Q interface cable HD151015 Figure 7 26 User System Interface Circuit for EXTAL STBY Hardware standby cannot be used 10 KQ Evaluation chip Figure 7 27 User System Interface Circuit for STBY ANO P70 to AN7 P77 Evaluation o User system chip 4
458. tsession hsf c hew3 demonstration demonstrati simsessionsh 2 hsf c hew3 demonstration demonstrati Cancel Figure 6 11 HEW Workspace Auto Recovery Dialog 6 4 8 Default directory for new workspaces When a new workspace is created the High performance Embedded Workshop invokes the New Workspace dialog One of the fields on this dialog is the directory in which the new workspace will be created By default this is the HEW installation directory However if you would like to set this default directory to another location e g C Workspaces then enter the desired directory into the field or browse to it graphically via the Browse button 122 RENESAS 6 5 Using an External Editor The High performance Embedded Workshop allows you to use an external editor Once an external editor has been specified it will be launched when the following actions are performed e Double clicking on a file in the Projects tab of the Workspace window e Double clicking on an entry in the Navigation tab of the Workspace window e Double clicking on an error warning in the Build tab of the Output window e Double clicking on an entry in the Find in Files tab of the Output window e Selecting the Open lt file gt option from the Workspace windows pop up menu e Clicking the Launch Editor toolbar button gt To specify an external editor 1 Select To
459. tus When the user system interface cable is not connected the read value is 1 due to pull up resistors Table 8 21 Differences in I O Registers H8 3637 Group I O Address H8 3637 Group Note FF90 to FF97 FF9A Bits 0 1 and 3 to 7 do not exist FFA4 Bits 1 to 7 do not exist FFA5 Bits 6 and 7 do not exist FFA6 FFA7 FFAE FFAF FFB4 FFB5 FFB6 FFBC FFBF to FFC3 FFC7toFFCC FFDO to FFD2 FFD3 Bits 0 1 and 4 to 7 do not exist FFD4 FFD6 FFD7 FFD8 to FFDC FFDD Bits 4 to 7 do not exist FFDE Bits 0 to 3 do not exist FFDF to FFE2 FFES Bits 0 1 and 4 to 7 do not exist FFE4 to FFES FFE6 FFE7 FFE8 to FFEC FFED Bits 4 to 7 do not exist FFEE FFEF FFF5 FFF6 Bit 5 does not exist FFF8 x X gt X X D BD X BD BD X D D D XI D D X X x D BD X X xX gt gt gt gt Xx FFFA to FFFF Note X indicates that a register that does not exist in the actual MCU can be accessed in the emulator A indicates that the initial value of the register differs between the actual MCU and the emulator 433 RENESAS Table 8 22 Differences in I O Registers H8 3877 Group I O Address H8 3877 Group Note FF95 to FF97 FF98 Bit 4 does not exist FF9A FFA4 to FFA7 FFAE FFAF FFB4 FFB5 FFB6 FFBC FFBF FFC2 FFC3 FFC
460. types of MCU Therefore there are some differences in I O registers between an actual MCU and the emulator as shown in table 8 24 Note these differences when accessing the I O registers T O port is input at default The I O register contents indicate the emulator port status When the user system interface cable is not connected the read value is due to pull up resistors Table 8 24 Differences in I O Registers MCU Group I O Address H8 3644 Group H8 3657 Group Note F740 to F744 X X F771 a A FFA4 to FFA7 X X FFAE to FFAF X X FFB4 to FFB7 X X FFCOtoFFC3 X X FFC7 to FFCF X X FFDOtoFFD2 a FFD3 X X FFD4 a a The H8 3644 group does not have bits 1 to 3 FFD5 a a The H8 3644 group does not have bits 3 to 7 FFD6 a A The H8 3644 group does not have bits 3 to 7 FFD7 X X FFDA a A The H8 3644 group does not have bits 0 to 2 FFDC a a The H8 3644 group and H8 3657 group do not have bit 5 Note X indicates that a register that does not exist in the actual MCU can be accessed in the emulator A indicates that the initial value of the register differs between the actual MCU and the emulator 436 RENESAS Table 8 24 Differences in I O Registers cont MCU Group I O Address H8 3644 Group 48 3657 Group Notes FFDE FFE3 X X FFE4 A A The H8 3644 group does not have bits 1 to 3 FFE5 a a The H8 3644 group does not have bits 3 to 7
461. u or click on the define template toolbar button Th The dialog shown in figure 4 14 will be displayed Define Templates User Input v Shortcuts z Figure 4 14 Define Template Dialog 2 Click Add A dialog is displayed that asks you to enter your chosen template name This name must be unique otherwise a duplicated template name message will be displayed and the template will not be added 3 Ifyou want to modify an existing template use the Template name drop down menu to select which template you want to modify 4 Enter the desired text into the Template text text area You can copy text from another editor window and then paste it into this dialog using CTRL V 5 There are 10 shortcut keys reserved for templates If you want to designate one of these select the key in the drop list at the bottom of the edit template dialog These range from CTRL 0 to CTRL 9 6 Enter the following placeholder to insert special information when the template is inserted 89 RENESAS Table 4 2 Placeholders Used in Templates Menu Entry Placeholder Replaced With File path name FULLFILE Filename including full path File name FILENAME Filename excluding path including extension File leaf FILELEAF Filename excluding path and extension Workspace name Workspace name Project name Project name Line number LINE First li
462. uessa scoueseoossecssoncvnssconeh ssaeunsbasweanendvevvacvensd 457 F 3 3 Subscommand files ccossencccsusensscousanaycorsencseavsnveccsspnesscsvonenssansancedavsacucesvseeseess 458 RA COMMONS arune EEA ENTENEN ENVEE E EES RESY 459 F5 MESSaG e COMMANGS os sisecessiccssnesevaconesssacenesesaccos eteen erain OAREN SVETE REAS NOEK Si 459 Appendix G Men s essiensa sassi 461 Appendix H Command Lines iussisset eisin n E 465 Appendix I Diagnostic Test Procedure s s sssssssseseseseresestststsoseseresereseseseses 469 I 1 System Set Up for Test Program Execution eesesesssesrresessressrsssrersrersrersrreseeesrsrsrsrst 469 I 2 Diagnostic Test Procedure Using Test Program sssesssesesesssesesssssrsrsrsrsrsrstsrsesrsesrseen 470 RENESAS xiii xiv RENESAS HEW Part RENESAS RENESAS l Overview The functions for HEW version V 3 01 04 are explained in this manual This chapter describes the fundamental concepts of the High performance Embedded Workshop It is intended to give users who are new to Windows applications filling in the details that are required by later chapters 1 1 Workspaces Projects and Files Just as a word processor allows you to create and modify documents the High performance Embedded Workshop allows you to create and modify workspaces A workspace can be thought of as a container of projects and similarly a project can be though of as a container of project files Thus each workspace
463. ult The I O register contents indicate the emulator port status When the user system interface cable is not connected the read value is due to pull up resistors Table 8 23 Differences in I O Registers I O Address H8 3927 Group Note F771 F777 Bits 5 to 7 do not exist FFA4 to FFA7 Bits 5 to 7 do not exist FFA8 to FFAF FFCO FFC1 FFC4 Bits 4 and 5 do not exist FFC7 FFDO Bits 1 to 7 do not exist FFD1 Bits 6 and 7 do not exist FFD2 FFD3 FFD4 FFD5 FFD6 FFD8 to FFDB FFDC FFDF to FFE1 FFE4 FFES FFE6 to FFEB FFEC FFF7 Bit 4 does not exist DIO XO Xx DXX D oO X D xX PD D OD lt X DX X D D D FFF8 FFFA FFFB x Note X indicates that a register that does not exist in the actual MCU can be accessed in the emulator A indicates that the initial value of the register differs between the actual MCU and the emulator e User Program Execution by the Go Reset Command When the user program is executed by the Go Reset command a reset signal is input for about 500 us to the evaluation chip from the emulator For the execution time measurement result the time for reset signal input is added 435 RENESAS 8 2 12 Notes on Use of the H8 3644 H8 3657 Group Emulator HS3644EPI60H T O Register Differences Between Actual MCU and Emulator In the E6000 emulator one evaluation chip emulates several
464. unction 4 Click the Write radio button in the Direction group box to set a write cycle for the specified range This completes the setting of a memory range Click the OK button to close the Breakpoint Event Properties dialog box Breakpoint Event Properties General Bus Area Signals Action Type Address PC Break C Don tCare C Address Range AddressLo H Q0FFEFSO Event Address Hi H O0FFEFA I Outside Range r Data Compare Direction 4 F Use Mask C Bead Figure 6 49 Breakpoint Event Properties Dialog Box after Setting an Event 372 RENESAS 5 The event that has been set in the Event combo box of the Trace Events group box on the General page of the Trace Acquisition dialog box is displayed Trace Acquisition General Stop Delayed Stop Suppress _ p Time Stamp IV Free Trace I DMAC Cycles Glock I DIC Cycles Disabled hd J Refresh Cycles m Trace Events Event 9 R H FFEF80 range to H FFEFA write Edit Delete Del All Sequence OK Cancel Figure 6 50 Trace Acquisition Dialog Box Adding an Event 6 To enable time stamping select 125ns from the Clock combo box of the Time Stamp group box Trace Acquisition General Stop Delayed Stop Suppress _ p Time Stamp IV Free Trace I DMAC Cycles Clock T DIC Cycles bd I Refresh Cycl
465. undo a previous check out operation You may also select a file folder project folder a workspace folder or combination thereof 2 Select the Tools gt Version Control gt Undo Check Out menu option 154 RENESAS 9 2 6 Viewing the Status of a File Although files appear in your HEW project in the Projects tab of the Workspace window Visual SourceSafe is not necessarily controlling them Of those files which are being controlled by Visual SourceSafe some will be checked in and others will be checked out i e being edited by a user The status command displays the current status of a file or file s gt To view the status of a file or files in Visual SourceSafe 1 Select the file s whose status you would like to view You may also select a file folder project folder a workspace folder or combination thereof 2 Click the Status of Files toolbar button or select the Tools gt Version Control gt Status of Files menu option 3 Ifa file has a blue tick next to it a user different to you has checked it out 9 2 7 Viewing the History of a File Visual SourceSafe controls the edits to the files in its projects and allows you to view the complete history of these edits right back to the time that the file was first added to the project To view the history of a file or files in Visual SourceSafe 1 Select the file s whose history you would like to view You may also select a file folder project folder a workspace
466. uring delay executed until the trace has stopped earlier record numbers go forward 1 2 the most recent record Address Address 6 digit hexadecimal Instruction Disassembled code of the executed instruction Data Data bus value displayed as 2 digit or 4 digit hexadecimal R W Whether access was read RD or write WR Area Memory area being accessed ROM RAM 8 or 16 bit I O 8 or 16 bit EXT external or DTC RAM not available when a time stamp is acquired 293 RENESAS Status Clock Probes NMI IRQ7 0 Timestamp Source Label Timestamp Difference Bus status during this cycle DTC operation PROG prefetch Data CPU data access cycle Refresh refresh cycle or DMAC DMAC cycle not available when a time stamp is acquired Number of clock cycles in bus cycle as 1 to 8 To indicate more clock cycles OVR is displayed not available when a time stamp is acquired A 4 bit binary number showing the four probe pins in the order of Probe 4 Probe 3 Probe 2 and Probe from the left not available when a time stamp is acquired Status of the NMI input not available when a time stamp is acquired Status of eight IRQ inputs not available when a time stamp is acquired Time stamp of the record Time stamps start from zero each time the user program is executed The timer resolution depends on the time stamp clock rate selected in the trace acquisition
467. used in the register definitions are the address locations of the registers in the same mode When the I O register file is actually used the BaseAddress value is subtracted from the defined register address and the resultant offset added to the relevant base address for the selected mode Each module has a section that defines the registers forming it along with an optional dependency The dependency is checked to see if the module is enabled or not Each register name must be defined in the section and the numbering of each register must be sequential The dependency is entered in the section as dep lt reg gt lt bit gt lt value gt 1 lt reg gt is the register id of the dependency 2 lt bit gt is the bit position within the register 3 lt value gt is the value that the bit must be for the module to be enabled The Register definition entry is entered in the format id lt name gt lt address gt lt size gt lt absolute gt lt format gt lt bitfields gt 1 lt name gt register name to be displayed 2 lt address gt address of the register 3 lt size gt which may be B W or L for byte word or longword default is byte 4 lt absolute gt which can be set to A if the register is at an absolute address This is only relevant if the I O area address range moves about on the CPU in different modes In this case if a register is defined as absolute the base address offset calculation is not performed and the spe
468. using the machine name in the workspace then the dialog displayed in figure 10 5 is shown Simply type or browse to the machine where the service is located and click OK If you want to be the server machine then leave the radio button on its default selection use local machine 161 RENESAS Select Server Location 2 xi Use local machine Use network machine Cancel Bose Access Computer name Browse Figure 10 5 Select machine name If you have previously been the server of a workspace then the following message will be displayed when you attempt connection to another machine This dialog is displayed in figure 10 6 Clicking OK then connects your machine to the new location High Performance Embedded Workshop x N Workspace is registered to be shared on computer PA00552 you are registered to run server locally do you want to change your server registration ass fess Figure 10 6 Select machine name Note If the network is running multiple HEW workspaces with the network service enabled then a user can only access one of them at one time The only instance when this is not the case is if the same machine is serving all of the network workspaces 162 RENESAS 11 Difference View The High performance Embedded Workshop has an integrated difference view This view allows detailed difference comparisons to be made with local files on the drive and also with files in t
469. uttons allow you to select the direction of the search Selecting Down means that the search will be performed from the insertion cursor towards the bottom of the file Selecting Up means that the search will be performed from the insertion cursor towards the top of the file Click the Find Next button to begin the search Click Cancel to stop the find action The High performance Embedded Workshop editor also allows you to search for a string across many files 76 RENESAS 4 5 2 Finding Text in Multiple Files gt To search for text in many files 1 Select Edit gt Find in Files select Find in Files from the editor window s local menu or click the find in files toolbar button i The Find in Files dialog box will be displayed figure 4 3 Find In Files 27 xi Find M yStruct v p x Cancel In files types 1 c cpp exp fsy h hpp inc lis p Cancel Directory fe hew demo demo X Browse I Match case IV Search sub directories I Regular expressions Figure 4 3 Find in Files Dialog 2 Enter the text that you want to search for into the Find field or select a previous search string from the drop down list box If you select text before invoking the find operation the selected text will be automatically placed into the Find field 3 Enter the file extensions of the files you would like to search into the In files types field If
470. value and the sign The value may be split over several lines using a V character If the value contains V characters within the main text then these are taken literally Only V characters followed by a new line are considered to indicate a value wrapping over more than one line There follows some examples of valid variable declarations EXECUTABLE c dir prog exe OUTPUT c dir2 filel out INPUT c dir2 filel c DEPEND c dir2 file2 h e dir2 file3 h e dir2 file4 h In order to use a variable later in the hmake file write the variable name with added to the front and y added to the back The variable name along with the characters will be substituted with the variables value For examples of this see later under description blocks Only alphanumeric characters and underscore characters are allowed in variable names It is possible to use a variable inside the declaration of a different variable but all variables must be declared before they are used 456 RENESAS F 3 Description blocks F 3 1 Basic outline A description block specifies one or more targets zero or more dependants and a list of commands which should be executed if the newest dependent is newer than the newest target If none of the targets exist and or none of the dependants exist then the commands will always be executed It is not necessary to specify any dependants if you wish the commands to always be executed A de
471. vaversovebeceoaonnseresancesevsessvae 4 12 3 Inserting a Template 4124 Brace Matching ii isicsecsccsceccasissccascasa cay ovseacevanzsa cohoussvcsvenvsndssosavaieveuneccsavanezceveiaysens Editor Column management re Enable tooltip Wate isses E E iA e e ERE R NEER Tools Administration eseeeeeeeeeeeeeeeeeeresriereresresriseseesresrsseeresrese 95 Tool Locations icescasjnndsconsnencceninsaventiectecaviestesovsnetcases Ea AARTE EEEE EEE EI EE 96 HEW Registration Files HIRE scisssrissessossnsensssoscerovseusoronssasnnenssasssesosaceossoneisavaeetexengotocds 96 R gistering Components sisisi o riservo TEn NN EEN E 97 5 3 1 Searching Drives for Components esesesesererererererereseessrsrsrserrstrrernrererernrersnsene 97 5 3 2 Registering a Single Component sssssssrersesersssesssssivovevov vevovosssinssonsssosisssvssses se 98 Unregistering Components Viewing and Editing Component Properties Uninstalling Components Technical Support ISSUES siessen soineann eane Ea aa Las irese sidssecssddeatsonseiocss 103 On Demand Components ssicsscsesecessseeczecaiccctecsssscteesoscaxeoseusancsevecsscosseounsabcactessdeacdectyecctenss 105 Custom Proj ct TYPES is csscseciscscducssescdestestsuesnescvnsuessodeoueseodevsedasteasoteetescetontesentensenerdonesedds 106 Customizing the Environment 0 ccc eee ces ceeceeseeeeeeeeeeeeaes 113 Customizing thie Toolbars ainan a TE oaeiae tetai 113 Customizing the To
472. ved last are enforced Once HEW opens a workspace it is updated inside the memory HEW does not save the settings into a file until a user saves the workspace intentionally 439 RENESAS Iwant HEW to automatically specify default options to a file which is newly added to a project You can specify default options to a phase if the phase is a multiple build phase Select a phase from the Options menu If the phase is a multiple build phase a file list is displayed on the left hand side of the options dialog figure A 1 In the file list open a folder of a file group to which you want to specify your default options You will find a Default Options icon in the folder Select the icon specify options on the right hand side of the options dialog and click OK The options specified here will be given to any new file of that file group when it is first added to the project 44 C C source file H E C source file 5 4 C source file 7 SESS Figure A 1 Options Dialog File List I selected Build gt Build All but the dependencies in the Projects tab of the Workspace window is not updated while selecting Build gt Build updates the dependencies Build gt Build All does not update the dependencies in the Projects tab of the Workspace window To update the dependencies select Build gt Update All Dependencies 440 RENESAS Appendix B Regular Expressions The High p
473. w in half or click on the split bar button keep the button pressed move the mouse down and then release the mouse button at the point you want to split the window gt To adjust the position of the split bar Click on the split bar itself keep the button pressed then move the bar to the new position and then release the button gt To remove the split bar Double click on the split bar or move the split bar to the top or bottom of the window 85 RENESAS 4 10 Configuring Text The following sections detail how to change the appearance of the text displayed in the editor windows 4 10 1 Changing the Editor Font The High performance Embedded Workshop allows you to specify the font to be used in its internal editor All editor windows regardless of the file type use the same font gt To change the editor font 1 Select Tools gt Format Views The Format Views dialog will be displayed Select the Source icon in the tree figure 4 10 2 Select the desired font from the Font list 3 Select the size of the font from the Size list 4 Click OK to confirm the new editor settings 2x Font D Selected Text D Text D Selected Text D Text a list file ner source file Ch header file CouierNew C source file E C header file Point Size E C list file C Preprocessed C source file fio zi Expanded assembly source file C Assembly source file Li
474. whether the file is added to the project if the file is checked out and if it is checked out who did so 152 RENESAS 9 2 Visual SourceSafe commands The following 8 operations are available e Add a file to version control e Remove a file from version control e Get a read only copy of a file or files e Check out a read write copy of a file or files i e for editing e Check in a previously checked out file or files i e update Visual SourceSafe with the edits made e Undo a previously check out operation on a file or files i e cancel any edits made e View the status of a file e View the history of a file These commands can only be accessed via the Tools gt Version Control sub menu whereas all of the other commands can be accessed from both the toolbar and menu 9 2 1 Removing a File from Version Control Although files appear in your HEW project in the Projects tab of the Workspace window Visual SourceSafe is not necessarily controlling them gt To remove a file or files from Visual SourceSafe 1 Select the file s which you would like to remove from Visual SourceSafe You may also select a file folder project folder a workspace folder or combination thereof 2 Click the Remove Files toolbar button is or select the Tools gt Version Control gt Remove Files menu option 9 2 2 Getting a Read Only Copy of a File from Version Control Visual SourceSafe protects your source files and e
475. x to list add or remove the debug session Debug Settings Opens the Debug Settings dialog box to set the debugging conditions or download modules Radix Hexadecimal Uses a hexadecimal for displaying a radix in which the numerical values will be displayed and entered by default Decimal El Uses a decimal for displaying a radix in which the numerical values will be displayed and entered by default Octal Uses an octal for displaying a radix in which the numerical values will be displayed and entered by default Binary Uses a binary for displaying a radix in which the numerical values will be displayed and entered by default Emu System lator z Opens the Configuration dialog box allowing the user to modify the debugging platform settings Memory Resource 462 Ll RENESAS Opens the Memory Mapping dialog box allowing the user to view and edit the debugging platform s current memory map Table G 1 GUI Menus cont Toolbar Menu Option Shortcut Button Remarks Debug Reset CPU F Resets the target hardware and sit sets the PC to the reset vector address Go F5 Ey Starts executing the user program at the current PC Reset Go Shift F5 Resets the target hardware and mi executes the user program from the reset vector address Go To Cursor Starts executing the user program at the current PC unt
476. xpressions check box Refer to appendix B Regular Expressions for further information 9 If you clicked Find Next the editor will search for the first occurrence of the search string Click Replace if you want to replace it Click Replace All to replace all occurrences or click Cancel to stop the replace action If you select Selection in Replace In selected range of the text is replaced If you select whole file the whole files are replaced If you select all open files all files that are currently open in the editor have the replace operation carried out on them 78 RENESAS 4 5 4 Jumping to a Specified Line gt To jump to a line ina file 1 Ensure that the window whose contents you want to replace is the active window 2 Select Edit gt Goto Line press CTRL G or select Goto Line from the editor window s local menu A goto line dialog box will be displayed figure 4 5 3 Enter into the dialog box the number of the line that you want to go to and then click OK 4 The insertion cursor will be placed at the start of the line number specified Goto x Line number fi ces Figure 4 5 Goto Dialog RENESAS 79 4 6 Bookmarks When working with many large files at a time it can become difficult to locate specific lines or areas of interest Bookmarks enable you to specify lines that you want to jump back to at a subsequent time One ex
477. y you can copy the current settings in the dialog to other configurations This is described below gt To copy the linkage order from one configuration to another 1 Click the Build gt Linkage order menu item 2 Select the configuration you wish to copy in the current configuration list This defaults to the currently loaded configuration 3 Click the Copy to button this displays a dialog and asks you which one of the configurations in the current project you wish to copy the current linkage order to Select a configuration and click OK 4 Click OK to verify and save the changes 67 RENESAS 68 RENESAS 4 Using the Editor This chapter describes how to use the editor that is provided with the High performance Embedded Workshop 4 1 The Editor Window The editor window figure 4 1 contains the file windows that are being viewed or edited Only one window is active at anytime This window is called the active window or current window and its title bar will appear a different color from that of the others dbsct c is the active window in figure 4 1 All text operations such as typing pasting text and so forth only affect the active window To switch to another source file window i e to make some other window the active window there are a number of methods e Click on it if it is visible e Press CTRL TAB to cycle through the windows one after another e Select the window by name from the Window menu e
478. ze 4 m Spacing IV Enable auto indentation rM General V Save files before executing any tools IV Show files in notebook J Prompt before saving files IV Enable syntax coloring IV Enable Smart edit for C files IV Enable tooltip watch m External editor Use external editor Figure 4 7 Options Dialog Editor Tab When a TAB key is pressed in the editor a tab character is usually stored in the file However sometimes it is preferable to store spaces instead The representation of tab characters can be controlled via the Options dialog gt To use spaces as tabs 1 Select Tools gt Options The Options dialog will be displayed Select the Editor tab figure 4 7 2 Set the Use spaces as tabs check box as appropriate 3 Click OK for the tab setting specified to take effect 83 RENESAS 4 8 3 Auto Indentation When you press return in a standard editor the insertion cursor will move to the next line down at the first column i e against the left hand side of a window Auto Indentation is a feature which when return is pressed places the insertion cursor on the next line as before but under the first non white space character of the previous line This enables you to type neat C C or assembler code faster as you don t have to type leading spaces or tabs yourself Figure 4 8 illustrates two examples The first i shows the effect of pre
Download Pdf Manuals
Related Search
Related Contents
Page 1 Page 2 マルチ探知器 PS 38 `最大麦突さー20mmまでの埋設牛 11議会費 一般会計 歳 出 INSTEON 2443 Network Router User Manual BENDIX PNU-159 User's Manual Avec vous à Ploulec`h N°3 avril 2015 USER MANUAL KETO-DIABUR TEST® 5000 - SANICARE S-Series 140 W ~160 W CIS Photovoltaic Module Installation Manual world customs organization organisation mondiale des douanes Manual - Amazon Web Services Copyright © All rights reserved.
Failed to retrieve file