Home

User Guide - US Cellular

image

Contents

1. 1 Enter a number and press Kp 2 Once you have established the connection press Ka This puts the first caller on hold Phone Calls amp Settings 27 3 Select Contacts Recent History or Enter Phone 4 Select a number from your Contacts or Recent History or enter a number directly and then press D 5 When you re connected to the second party press Sex again to begin your 3 way call 6 To end the 3 way call press gal If one of the people you called hangs up during your call you and the remaining caller stay connected If you initiated the call and are the first to hang up all callers are disconnected Call Forwarding Call Forwarding lets you forward all your incoming calls to another phone number even when your phone is turned off You can continue to make calls from your phone when you have activated Call Forwarding To activate Call Forwarding 1 Enter amp eq re 2 Enter the area code and phone number to which you want your calls forwarded 3 Press Ka You will hear a tone to confirm the activation of Call Forwarding To deactivate Call Forwarding 1 Enter ky eq EJ 2 Press D You will hear a tone to confirm the deactivation Phone Call Settings You can configure various call related settings Abbreviated Dialing Abbreviated Dialing is similar to speed dialing You can use either of the following abbreviated dialing features Phone Calls amp Settings 28 e Contacts
2. Copyrights 110 Index 3 Way Calling 27 Accessibility 101 Airplane Mode 104 Alarm 55 Alert Notification 104 Alerts 104 Answer Call 23 Assigned Media 71 Auto Answer Mode 29 Automatic Speech Recognition ASR 65 Backlight 92 Battery 1 Capacity 1 Install 2 Remove 3 Bluetooth 56 Icons 56 Make Your Phone Discoverable 56 Menu 57 Pair Devices 58 Send Items 59 Trusted Devices 58 Turn On and Off 56 Brightness 91 Browser 87 Menu 88 Web Navigation 87 Calculator 71 Calendar 52 Add a To Do 53 Add an Event 52 Alerts 53 Delete Events 54 View Events 54 Call Answer 23 Index 111 End 24 Forward 28 In call Options 24 Make 19 Missed 25 Phone Call Options 27 Settings 28 Call Answer Mode 29 Call Waiting 27 Callback Number 48 Caller ID 27 Camcorder 80 Camcorder Mode Options 81 Record a Video 80 Settings 81 Store Videos 82 Camera 76 Assign Pictures 76 Camera Mode Options 77 Settings 79 Store Pictures 82 Take a Picture 76 Clock Display 93 World Clock 73 Contacts 35 Assign a Speed Dial Number 41 Create a New Contacts Entry 36 New Group Entry 36 New Personal Entry 36 Save a Number Using the Phone Keypad 36 Details 35 Edit 37 Add a Number to a Personal Entry 38 Add Members to a Group Entry 39 Assign a Picture to a Personal Entry 39 Assign a Ringtone to a Personal Entry 38 Delete an Entry 37 Edit an Entry 37 Remove Members From a Group Entr
3. 1 Press go gt Settings gt Others gt Alerts gt Repeated Tone 2 Select Voicemail or Messages 3 Select Single Tone once only or Repeated Tone once every minute Persistent Alerts Set alerts such as beep vibration or LED blinking for notifications 1 Press x gt Settings gt Others gt Alerts gt Persistent Alerts 2 Select from the following options Audible Tone to beep when notification is on the notification bar Vibrate to vibrate when notification is on the notification bar Blink LED to blink the LED indicator when notification is on the notification bar 3 Select On or Off Call Setup You can configure various call related settings See Phone Call Settings Data Settings You can turn on or off your phone s data services Enable Data Services When your phone s data services are turned off you may enable them at any time Note Your phone s data services are turned off by default To enable data services 1 Press E gt Settings gt Others gt Data Settings gt Data gt On A message is displayed Settings 105 2 Press YES left softkey to enable data services Disable Data Services You can disable data services again without turning off your phone however you will not have access to all data services including Web and messaging Disabling data services will avoid any charges associated with these services While signed out you can still place or receive phone calls check voi
4. 3 Raise the card holder with your finger Insert a microSD card into the holder Make sure to check the position of the gold terminals O 4 Gently press the card and the card holder and then slide the holder in the direction of the arrow to lock it 6 Calendar amp Tools 60 5 Place the battery back into its compartment and replace the battery cover See Install the Battery Warning Make sure you lock the battery cover properly to maintain the phone s waterproof capability Remove the microSD Card 1 Remove the battery cover and the battery The battery must be removed in order to remove the microSD card See Install the Battery 2 Slide the SD card holder into the unlocked position Raise the card and the card holder with your fingers 3 Gently pull out the card from the holder Replace the card holder and lock it 4 Place the battery back into its compartment and replace the battery cover microSD Card Settings Create Folders in the microSD Card The following steps allow your phone to create default folders for storing files in your microSD card gt Press g gt Tools gt Memory Storage gt Create Folders The phone will create the microSD s default folders DCIM VIDEO MUSIC VOICE SD_PIM BLUETOOTH and OTHER View Memory Your phone allows you to review the memory allocation of both your internal storage area and that of the microSD card 1 Press g gt Tools gt Me
5. Press and hold Ke Ea or the external speaker button When you hear Say a command say Lookup When you hear Say the name say a Contacts entry s name The phone displays the detail screen for that Contacts entry Open Menus Using ASR You can jump directly to many menu items or applications by saying Go to followed by a menu option 1 Tip Press and hold 5 fours or the external speaker button When you hear Say a command say Go To When you hear Which shortcut say an application name for example Messaging The phone opens the selected menu Say More Options to display additional application names Check Phone Status Using ASR You can use ASR to obtain information about your phone Status all of the following except My Phone Number Time Signal Strength Network Calendar amp Tools 67 e Battery e My Phone Number 1 Press and hold Ke orre f or the external speaker button 2 When you hear Say a command say Check 3 When you hear Which status item say a command ASR Settings To change ASR confirmation 1 Press and hold K orre f or the external speaker button 2 Press SETTINGS right softkey gt Confirmation 3 Highlight an option and press g Automatic to ask for confirmation only when the system is not sure what you said Always Confirm to always ask for confirmation Never Confirm to nev
6. File Manager In Phone to delete all files saved in File Manager All Stuff to delete all user added data Read the message and press DELETE left softkey Reset Your Phone and Phone Content This option lets you clear different types of personal information stored on your phone reset your phone to factory settings or both 1 2 3 Press x gt Settings gt Reset Delete Enter your lock code Highlight an option and press Reset Settings to restore all the factory defaults including ringtone types and display settings Contacts History Calendar and Messaging are not affected Reset Phone to reset all settings and erase all data on your phone Read the message and press the left softkey RESET SETTINGS or RESET PHONE Settings 100 Accessibility Settings The Accessibility menu lets you enable and manage accessibility related features Set Up Voice Guide Voice Guide allows you to hear voice prompts and spoken numbers or key names as you press a key and also to hear menus and options Contacts names email addresses URLs etc aS you highlight each item onscreen The default setting is Off Enable Voice Guide 1 Press amp gt Settings gt Others gt Accessibility gt Voice Services gt Voice Guide gt Speech Output 2 Select On or Off Note When the incoming ringtone volume is set to Silence All or Vibrate All Voice Guide does not work See Volume Settings Note When P
7. Manager Calendar amp Tools 62 File Manager File Manager allows you to view copy move and perform other housekeeping operations on files such as pictures videos music and applications stored in your phone or on the microSD card Access File Manager 1 2 Note Open 2 3 Press go gt File Manager Highlight an option and press g In Phone to access files stored in your phone s memory In Phone Downloaded to access files downloaded in your phone s memory In Phone Preloaded to access files preloaded in your phone s memory Memory Card to access files stored on the memory card All unknown or unsupported file types are displayed as or Files in File Manager Press g gt File Manager gt In Phone In Phone Downloaded In Phone Preloaded or Memory Card Highlight a folder and press p Highlight an item and press g File Manager Options When viewing files or folders in File Manager press OPTIONS right softkey to display available options Highlight an option and press x to select it Move to move a file from the current folder to another folder in your phone or in the memory card Move to Card Move to Phone to move a file from one storage area to another Copy to copy a file from the current folder to another folder in your phone or in the memory card Copy to Card Copy to Phone to copy a file from one storage area to another Calendar amp Tools 63 e Delete to d
8. the phone is locked or the phone is powering on or off SIM Toolkit SIM Toolkit allows you to access to SIM menu Note To use this feature you must insert a valid SIM card in the SIM card holder and the services must be supported by your service provider Contact your wireless service provider for more details 1 Press x gt Tools gt SIM Toolkit 2 Follow the onscreen instructions to proceed Input PIN PUK You can set up a PIN number and PUK number for your SIM card as a security measure 1 Press Q gt Tools gt Input PIN PUK 2 Enter your four to eight digit PIN code 3 Enter your eight digit PUK code 4 Enter and re enter your new PIN code to proceed Calendar amp Tools 74 Note If you enter a wrong PIN code three times your SIM card will be locked You must then enter the PUK code to unlock it The PUK code is a number printed on the SIM card next to the PIN number Calendar amp Tools 75 Camera Take Pictures Taking pictures with your phone s built in camera is as simple as choosing a subject aiming the lens and pressing a button Take a Picture 1 Press E gt Photos amp Videos gt Camera to activate camera mode Additional camera options are available See Camera Mode Options for more information Tip To activate camera mode you can also press and hold the CAMERA key Wi 2 Using the phone s main screen as a viewfinder aim the camera lens at your subject 3 Press
9. 40 recipients per message NEW ADDRESS right softkey to enter a recipient s phone number or email address directly Press CONTINUE left softkey to proceed 4 Compose a message Press OPTIONS right softkey to select additional options 5 To add an attachment select lt Add Attachment gt You can choose from Picture Video Voice Audio or File Manager 6 Review your message and press SEND left softkey Access Messages Read and reply to the messages you have received Messaging 45 To read a message gt When you receive a message your phone will display a notification message Use your navigation key or select View To reply to a message 1 While the message is displayed press REPLY left softkey Select Reply to Sender or select Reply All if you are replying to a message with multiple recipients 2 Compose a reply and press SEND left softkey Threaded Messaging Threaded messaging lets you follow a chain of messages to and from a particular contact To display the thread list gt In standby mode press MESSAGING left softkey gt Messages You will see a thread list Each thread has an entry s name if saved in Contacts a phone number or an email address You will also see the number of unread messages if any for each thread View Messages Highlight a thread and press o to display the messages sent to and received from a particular contact in reverse chronological order
10. Complete to automatically display the word that may follow the current text input Phrase Complete to set the phone to predict possible phrases after one word with a space is entered Word Scan to allow the predictive text input system to recognize words by searching Contacts Word Choice List to select whether to display the word choice list Input Language to select the language to enter English or Spanish My Words to edit or delete custom words you have added to the predictive text database e Add Word to store words that you frequently use Auto Substitution to edit or delete the custom texts you have added to the XT9 database e Add New to store texts you frequently use Select Text to select text for copying cutting or adding if applicable Delete All to delete all text if applicable Help to view the XT9 instructions Copy and Paste Text You can copy and paste the text in the text entry field 1 In the text entry field move the cursor next to the text you want to copy and press Text Entry OPTIONS right softkey gt Text Options gt Select Text 17 2 Press the navigation key and highlight the text you want to copy 3 Press NEXT ACT left softkey gt Copy The text is saved in the Paste List 4 In the text entry field move the cursor to the place where you want to paste the text to and press OPTIONS right softkey gt Paste List On the message entry screen press OPTIONS right softk
11. Due to different specifications and features of other Bluetooth compatible devices display and operations may be different and functions such as transfer or exchange may not be possible with all Bluetooth compatible devices View the Trusted Devices List This list displays a list of devices which are paired with your phone and set as trusted devices gt Press x gt Bluetooth gt Trusted Devices Trusted Devices List Menu Once you have created trusted devices several options are available from the Trusted Devices list Left Softkey Menus 1 Press o gt Bluetooth gt Trusted Devices Calendar amp Tools 58 Highlight a device and press the available left softkey options CONNECT to connect to the selected Bluetooth device if not connected for headsets hands free and other devices excluding computers PDAs phones or printers TRANSFER to send data saved on your phone to the selected Bluetooth device for computers PDAs or phones See Send Items via Bluetooth Options Menu li 2 Press o gt Bluetooth gt Trusted Devices Highlight a device and press OPTIONS right softkey to display the following options Add New to add a new Bluetooth device Delete to delete the selected device from the list Delete All to delete all devices from the list Auto Accept to configure your phone s accessibility to other Bluetooth devices View Edit Info to view or edit the information of t
12. G or CAPTURE left softkey to take a picture Camera Settings You can customize the camera settings 1 From camera mode press OPTIONS right softkey gt Camera Settings 2 Highlight an option and press g Camera Resolution to select a picture s file size from 5 0M 2560x1920 3 2M 2048x1536 2 0M 1600x1200 1 3M 1280x960 0 3M 640x480 or 0 1M 320x240 Quality to select the picture quality setting Fine Normal or Economy Shutter Sound to select a shutter sound Default Say Cheese or Ready Auto Save to to select the storage area for the pictures See Set Storage Options Auto Review to select whether or not the picture is displayed for review after you take a picture 79 Record Videos In addition to taking pictures you can record view and send videos to your friends and family with your phone s built in video camera Record a Video Recording a video is as easy as taking a picture 1 2 Note Note Press g gt Photos amp Videos Press Camcorder gt Video Mail or Long Video to activate camcorder mode Additional video options are available See Camcorder Mode Options for more information Video Mail is limited to 25 seconds if Quality is set to Fine and 50 seconds if set to Normal See Camcorder Settings The length of a Long Video will vary depending on the quality settings and storage type used phone or memory card Using the phone s main scr
13. Match Retrieve any number saved in your Contacts by entering four or more digits of any part of the number e Prepend Prepend the first five or six digits for example the area code and prefix to any four or five digits you enter To activate the Prepend feature 1 Press amp gt Settings gt Others gt Call Setup gt Abbrev Dial 2 Select Prepend gt On 3 Enter a five or six digit number and press g To place a call using Abbreviated Dialing 1 Enter the four or more digits of any part of a Contacts entry s phone number to use the Contacts Match feature Enter the last four or five digits of the number to use the Prepend feature Note Contacts Match will not retrieve numbers if you enter 9 1 1 or reserved three digit service numbers such as 411 or 611 2 Press Ke to call the displayed number If there are two or more matched numbers in your Contacts a list is displayed Highlight the name or the phone number you want to call and then press Sena to place a call Call Answer Mode Select how to answer incoming calls on your phone 1 Press g gt Settings gt Others gt Call Setup gt Call Answer 2 Select SEND Key Any Key or Flip Open Auto Answer Mode Set your phone to automatically pick up incoming calls Remember your phone will answer calls in auto answer mode even if you are not present 1 Press o gt Settings gt Others gt Call Setup gt Auto Answer Phone Calls amp Sett
14. Open gt Press ex to answer an incoming call Depending on your settings you may also answer incoming calls by pressing other keys See Call Answer Mode Answer an Incoming Call with the Phone Closed gt When your phone rings or vibrates press the external speaker button The call will be answered in speakerphone mode Open the phone to use the earpiece See Call Answer Mode Answer an Incoming Call in Speakerphone Mode gt Press or the external speaker button Mute the Ringtone and Stop the Vibration gt Select Silence on the screen or Press or the volume button up or down Send an Incoming Call to Voicemail gt Select Send to Voicemail on the screen Reject an Incoming Call gt Press es or the call list button or Press and hold eisd Reject an Incoming Call and Send a Message gt Select Ignore with Text Phone Calls amp Settings 23 In call Options Pressing OPTIONS right softkey during a call displays a list of available in call features To select an option highlight the option and press x e Transfer Audio to switch the call to a Bluetooth device if applicable e Save to save the current call s phone number in your Contacts e Contact Details to display information about the caller stored in your Contacts e Main Menu to display the phone s main menu e 3 Way Call to open a call with two other parties e Contacts to display your Contacts list e Phone Info to display
15. Record your greeting Important Voicemail Password It is strongly recommended that you create a password when setting up your voicemail to protect against unauthorized access Without a password anyone who has access to your phone is able to access your voicemail messages Voicemail Notification There are several ways your phone alerts you to a new message You will be notified of a new voicemail e By displaying a message on the screen e By sounding the assigned ringtone type e By displaying at the top of the screen Phone Calls amp Settings 25 New Voicemail Message Alerts When you receive a new voicemail message your phone alerts you and prompts you to call your voicemail To call your voicemail from the notification screen 1 Press D 2 Enter your voicemail password if prompted 3 Follow the voice prompts to listen to and manage your voicemail messages To set the frequency of new message alerts 1 Press g gt Settings gt Others gt Alerts gt Repeated Tone gt Voicemail 2 Select Single Tone once only or Repeated Tone once every minute Retrieve Your Voicemail Messages You can review your messages directly from your wireless phone or from any other touch tone phone Use Your Phone to Access Your Messages 1 Press and hold aay or In standby mode press MESSAGING left softkey gt Voicemail 2 Enter your voicemail password if prompted 3 Follow the voice prompts to listen
16. Self Timer 1 From camera mode press OPTIONS right softkey gt Self Timer 2 Highlight a delay time 5 Seconds or 10 Seconds and press g 3 Press o or START left softkey when you are ready to start the timer A countdown is displayed in the middle of the screen and your phone will beep during the countdown 4 Get ready for the picture When the timer is down to three seconds the tone of the beep will change To cancel the self timer after it has started gt Press CANCEL right softkey or Ga Multiple Shots This feature allows you to take three six or nine shots in a continuous sequence When you take multiple shots the Mh icon will be displayed on the upper left corner of the screen 1 From camera mode press OPTIONS right softkey gt Fun Tools gt Multiple Shots Note When taking multiple shots the resolution is temporarily set to 0 1M 320x240 2 Highlight an option and press g 3 Highlight the duration of the interval between shots Normal or Fast and press Camera 78 4 Press o G or CAPTURE left softkey to take the pictures The screen will display up to nine thumbnail pictures Zoom This feature allows you to zoom in on an object when you take a picture You can adjust the zoom from 1 to 12 1 From camera mode press the navigation key right to zoom in or left to zoom out From camera mode press the volume button up to zoom in or down to zoom out 2 Press o
17. You can store up to 600 memos on your phone Maximum recording time depends on the available memory space on your phone Record Voice Memos To record an audio memo 1 Press o gt Tools gt Voice Services gt Voice Memo gt Record 2 Start recording after the beep Press PAUSE RECORD left softkey to pause and resume recording Calendar amp Tools 69 cy To stop recording press orre f roy or STOP right softkey Play Voice Memos To play one or all memos 1 2 3 Press go gt Tools gt Voice Services gt Voice Memo gt List Select In Phone or Memory Card Highlight the memo you want to play and press p or Press OPTIONS right softkey gt Play gt All to play all memos continuously To play multiple memos i 2 3 4 Press o gt Tools gt Voice Services gt Voice Memo gt List Select In Phone or Memory Card Press OPTIONS right softkey gt Play gt Multiple and select memos you want to play Press PLAY left softkey Voice Memo Options Your phone offers several options for managing voice memos you have recorded 1 2 3 Press o gt Tools gt Voice Services gt Voice Memo gt List Select In Phone or Memory Card Highlight a memo and press OPTIONS right softkey to display available voice memo options Play to play selected memos or all memos Speaker On or Speaker Off to activate or deactivate the speakerphone mode Edit
18. access code for your location for example 011 for international calls made from the U S 1 Press and hold to display on your phone screen 2 Enter the country code and phone number and then press Ka The phone automatically prepends the access code for international dialing followed by the country code and phone number Call Using a Speed Dial Number You can store up to 98 numbers in your phone s speed dial memory to make contacting friends and family easier You must have already assigned a speed dial number to an existing phone number See Assign Speed Dial Numbers To use speed dial for locations 2 9 gt In standby mode press and hold the appropriate key for approximately two seconds To use speed dial for locations 10 99 gt In standby mode enter a two digit speed dial number and then press Ka The display confirms that the number has been dialed when it shows Connecting Call a Phone Number with Pauses You can dial or save phone numbers with pauses for use with automated systems such as voicemail or credit card billing numbers There are two types of pauses available on your phone e Hard Pause sends the next set of numbers when you press SEND TONES left softkey Phone Calls amp Settings 20 e 2 Sec Pause automatically sends the next set of numbers after two seconds Note You can have multiple pauses in a phone number and combine two second and hard pauses To dial or sa
19. amp Tools Calendar Use Calendar to create and manage events meetings and appointments Your Calendar helps organize your time and reminds you of important events Add an Event to the Calendar Your Calendar helps organize your time and reminds you of up to 100 important events 1 2 oy Tip Press o gt Calendar Highlight a day to which you would like to add an event and press OPTIONS right softkey gt Add Schedule Enter a description and press g Highlight a setting and press Category to select a category of the event Priority to select a priority of the event Start to set a start time of the event End to set an end time of the event Location to enter a location of the event Press EDIT left softkey for entering texts Ringtone to select a ringtone for the alarm Alarm Time to set the time for the alarm to go off Repeat to select the frequency of the alarm e If you select Specific Period set a start and end date e If you select Weekly select the day s of the week Press SAVE left softkey To change the calendar display views press the left softkey MONTH or WEEK repeatedly to toggle between monthly and weekly views Calendar amp Tools 52 Tip On the weekly view press the navigation key up or down to display the previous week or the next week respectively Tip Press OPTIONS right softkey gt Settings gt Holiday Weekday to enter holidays and weekday
20. gt Accessibility gt Screen Contrast 2 Select Standard Color or High Contrast BW Phone Setup Options There are many settings that you can customize to match your own preferences Airplane Mode Airplane Mode allows you to use many of your phone s features such as games and voice memos when you are on an airplane or in any other area where making or receiving calls or data is prohibited When you set your phone to Airplane Mode it cannot send or receive any calls or access online information 1 Press go gt Settings gt Others gt Airplane Mode 2 Read the disclaimer and press OK left softkey 3 Select an option from the following On to activate Airplane Mode Airplane Mode will be deactivated when you turn the phone off Off to deactivate Airplane Mode On Power up to activate Airplane Mode each time you turn the phone on While in Airplane Mode your phone s screen will display the airplane mode icon G gt Alerts You can change the alert settings according to your needs Alerts Notification Set your phone to alert you with an audible tone when you change service areas once a minute during a voice call or when a call has been connected 1 Press o gt Settings gt Others gt Alerts 2 Select Beep Each Minute Out of Service or Connect Settings 104 3 Select On or Off Repeated Tone You can set how often your phone alerts you when there is a new voicemail or message notification
21. in XT9Word mode enter a letter A word choice list opens 2 Scroll down the list and select lt Add Word gt 3 Enter a word and press SAVE left softkey The word will appear as an option the next time you scroll through options during XT9 Text Input For more information about XT9 Smart Input visit the Nuance website at www nuance com ABC Mode In Abc mode also known as multi tap entry you press keys one two three or four times to enter the letters you see on the keypad By default the first letter of a sentence is capitalized and the following letters are lowercased To switch between lowercase and uppercase press the key After a character is entered the cursor automatically advances to the next space after two seconds or when you enter a character on a different key 1 Select the Abc text input mode See Select a Text Input Mode 2 Press the corresponding key repeatedly until the correct letter appears For example to enter Abc press I once for a twice for b and three times for c Text Entry 16 Set Text Entry Options The text entry options menu allows you to specify a suitable feature during the text entry process See Text Entry for the options available from the settings menu 1 When entering text press OPTIONS right softkey gt Text Options 2 Highlight an option and press g Word Complete to suggest possible words based on letters you have entered Next Word
22. information about your phone Further options may also be available gt Press MUTE UNMUTE left softkey to mute unmute the microphone gt Press the volume button up or down to adjust the receiver volume gt Press or the external speaker button to turn the speaker on Press again to turn it off Warning Because of higher volume levels do not place the phone near your ear during speakerphone use End Phone Calls There are two ways to disconnect a call gt Press ga Press the call list button After you have finished your call the phone will display the caller s name if already in your Contacts phone number if available and the duration of the call Pressing OPTIONS right softkey will display the Recent History options See History Options for details Phone Calls amp Settings 24 Missed Call Notification When an incoming call is not answered your screen displays the Missed Call log Press Sexe to dial the phone number To display a Missed Alerts entry in standby mode 1 Press x gt Missed Alerts 2 Highlight the entry you wish to view and press p Voicemail Set Up Voicemail You should set up your Voicemail and personal greeting as soon as your phone is activated Always use a password to protect against unauthorized access 1 Press and hold ka in standby mode to dial your voicemail number 2 Follow the system prompts to Create your password Record your name announcement
23. last four digits of your wireless phone number If this doesn t work call U S Cellular Customer Care at 1 888 944 9400 Dial Services Your Contacts list is preprogrammed with contact numbers for various services 1 In standby mode press CONTACTS right softkey 2 Press OPTIONS right softkey gt Settings gt Services 3 Select Directory Assistance Voicemail Customer Service or Emergency 911 Call 4 Press Sena Contacts 44 Messaging Text and Multimedia Messaging Messaging allows you to stay connected 24 hours a day anywhere on the network With your phone you can use two types of messaging text messaging SMS and multimedia messaging MMS With text messaging you can send and receive instant text messages between your phone and another messaging ready phone Multimedia messages may consist of text images audio or voice recordings or any combination of these Compose Messages Use your phone to send text messages 1 Press o gt Messaging Tip For a shortcut press MESSAGING left softkey in standby mode 2 Select Send Message 3 Select a recipient from the list or from the following options Go to Contacts to select a recipient from your Contacts Qualifying Contacts entries must contain a phone number or an email address MULTIPLE left softkey to select multiple recipients Press CONTINUE left softkey when you have finished selecting and entering recipients You may include up to
24. places where using a wireless device is prohibited such as aboard an aircraft and in hospitals Make Your Phone Discoverable To make your phone discoverable allowing other Bluetooth devices to detect it you must set your phone s visibility to other than Hidden 1 Press gt Bluetooth gt Visibility 2 Select Visible for 3 min or Always visible If you select Always visible your phone will be discoverable by all in range Bluetooth devices until you change the setting If you select Visible for 3 min your phone will return to hidden mode after three minutes Bluetooth Status Indicators The following icons show your Bluetooth connection status at a glance Your phone s Bluetooth feature is turned on Calendar amp Tools 56 Your phone is visible to other Bluetooth devices Your phone is connected to a Bluetooth device Gi Your phone is connected to or communicating with a Bluetooth device via Hands free Profile HFP Your phone is connected to or communicating with a Bluetooth t device via Advanced Audio Distribution Profile A2DP The above icons will blink while your phone is communicating with a Bluetooth device Supported Bluetooth Profiles You can use different profiles for specific Bluetooth functions Following Bluetooth profiles are supported e A2DP Advanced Audio Distribution Profile e AVRCP Audio Video Remote Control Profile e HFP Hand free Profile e HSP Headset Profile e OPP Objec
25. right softkey gt Edit Contact or Edit Group 3 Highlight the information you wish to edit 4 Add or edit the information and press G3 5 Press DONE left softkey or SAVE left softkey to save your changes Delete a Contacts Entry You can delete existing entries from your Contacts 1 In standby mode press CONTACTS right softkey 2 Highlight an entry or a group you want to delete 3 Press OPTIONS right softkey gt Delete Contact or Delete Group 4 Press DELETE left softkey Contacts 37 Add a Number to a Personal Entry You can add numbers to existing personal entries in your Contacts 1 2 3 4 5 In standby mode press CONTACTS right softkey Highlight the entry you want to add a number to and press OPTIONS right softkey gt Edit Contact gt lt Add Number gt Enter the new number and press x Highlight a label for the number and press G Press DONE left softkey to save the new number Assign a Ringtone to a Personal Entry Assign a ringtone to a Contacts entry so that you can identify the caller by the ringtone See Ringtone Settings 1 2 6 In standby mode press CONTACTS right softkey Highlight an entry and press g Select Set Ringtones gt Incoming Calls or Message Select Change Highlight a ringtone category such as Default Ringtone My Videos Downloaded Preloaded Ringtones Memory Card or No Ringtone and then press Highlight a ringtone an
26. the external speaker button and the call list button sequentially while the phone is closed Settings 95 Text Entry The Text Entry menu allows you to specify a suitable feature during the text entry process See Text Entry Options for the options available from the text entry screen 1 Press o gt Settings gt Text Entry Highlight an option and press Word Complete to suggest possible words based on letters you have entered Next Word Complete to automatically display the word that may follow the current text input Phrase Complete to set the phone to predict possible phrases after one word with a space is entered Word Scan to allow the predictive text input system to recognize words by searching Contacts Word Choice List to select whether to display the word choice list Input Language to select the language to enter English or Spanish My Words to edit or delete custom words you have added to the predictive text database e Add Word to store words that you frequently use Auto Substitution to edit or delete the custom texts you have added to the XT9 database e Add New to store texts you frequently use Select Text to select text for copying cutting or adding if applicable Delete All to delete all text if applicable Help to view the XT9 instructions Phone Information Your phone provides information specific to your phone such as the phone number memory status an icon glossary your pho
27. to find the best hearing point depending on the surrounding environment Do not cover the microphones during a call Do not apply any sheet or sticker to the display area as it may compromise the hearing quality Main Screen displays all the information needed to operate your phone such as the call status the Contacts list the date and time and the signal and battery strength Softkeys let you select softkey actions or menu items corresponding to the bottom left and right lines on the main screen while the phone is open Volume Button allows you to adjust the ringtone volume in standby mode or the voice volume during a call MENU OK Key amp lets you access the phone s menus and selects the highlighted choice when navigating through a menu CAMERA Key i lets you activate the camera or video mode and take pictures and videos with the phone open SEND Key Gy allows you to place or receive calls answer Call Waiting use 3 Way Calling or activate Automatic Speech Recognition ASR CLEAR Key E deletes characters from the display in text input mode When in a menu pressing it returns you to the previous menu This key also allows you to return to the previous screen in a data session or activate Automatic Speech Recognition ASR Primary Microphone transmits your voice and ambient sound during voice calls voice recordings and videos Navigation Key lets you scroll through the phone s menu options SPEAKER Key ey l
28. to and manage your voicemail messages Note You are charged for airtime minutes when you are accessing your voicemail from your wireless phone Use Another Phone to Access Messages 1 Dial your wireless phone number 2 When your voicemail answers press the asterisk key 3 Enter your password Phone Calls amp Settings 26 Phone Call Options Caller ID Caller ID identifies a caller before you answer the phone by displaying the number of the incoming call If you do not want your number displayed when you make a call follow these steps 1 In standby mode press Sa r ay 2 Enter the number you want to call 3 Press D Call Waiting When your re on a call Call Waiting alerts you to incoming calls by sounding a beep Your phone s screen informs you that another call is coming in and displays the caller s phone number if available To respond to an incoming call while you re on a call gt Press Ka This puts the first caller on hold and answers the second call To switch back to the first caller gt Press Sex again Tip For those calls where you don t want to be interrupted you can temporarily disable Call Waiting by pressing eq eM before placing your call Call Waiting is automatically reactivated once you end the call 3 Way Calling With 3 Way Calling you can talk to two people at the same time When using this feature the normal airtime rates will be charged for each of the two calls
29. wwiieostdiaeiiatenatvhadceaneiednnueebabionneieebaenannecas aanenaeemants 57 BIUStoOtMMe NU ssie a a a E 57 Pair BIUGtOOUT DEVICES sorron EEE EEE EE EE EE 58 View tne Trusted Devices List ics ccsusicsasenersencacereeaetniweceoeicaontseiseraniontecteseneteemnesie 58 Send Items via Bluetooth s ssssssssnensnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnunannnannnannnannnannnannnnn nna 59 MICOS D Cadis E E a A E 60 MicroSD Card SCTEINGS irritorna E A 61 MIGOS D CaL FOGG Orasa e e a 62 FIG Manag oE vonia a E A neat 63 Connect Your Phone to Your Computer sessssssssssnasnnnunnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnns 64 VOCE SOINI OS eraa E ES E S eet 65 Automatic Speech Recognition ASR s s sssessssesssnsrnsnennnnnennnnnnnnnnnnnnnnnnnnnnnnnnnnnrnennnnne 65 Manage Voce Memos saaa a E arate temicNnd 69 ASSINCA MEd a aeien eE A AEA 71 CaO e E E E E E E N R 71 TPCC UO User etree spe ade eee ata eeu anette ened EAE 72 COUNECI GW FNO ears cenceattece aster E E EE EAEE 72 TOC IV SEO WAEG i vanecuseniveiet danteroentie aes rorsntinginnsteterseeientnia aa cinieraiaiavesnavonisetaainataerenniveaserea 72 WONG CIOCK rirni EERTE T ERE E tice tnmen agence 73 NOtopa deana vecns tun doneuaneslerautueaeawanadasavaniiousain ced ddeniaasnnsearnaamnnatands 73 FRCS FNCU Aea A E E E E PAE vale inns ane ta na E E aE teenie oer aaa 74 TOO Meester aces EEE OEO EEE OAE OEE 74 AO PAE er E T S AAT eeu saaieuucnoeewts 74 O e AE E E E AA OAE E A E E E E E 76 TRO P
30. 20 Menu Navigation 10 Index 114 Style 93 Messaging Text and Multimedia Messaging 45 Access Messages 45 Callback Number 48 Clear Alerts Icon 48 Compose Messages 45 Emergency Alerts 49 Long Message Reassembly 50 Message Alerts 49 Preset Messages 48 Settings 48 Signature 48 Threaded Messaging 46 microSD Card 60 Connect to Computer 64 Create Folders 61 File Manager 63 Format 62 Remove 61 Missed Calls 25 Multiple Shots 78 Navigation Key Shortcuts 109 Notification Pop up 92 Phone Illustration 7 Information 96 Key Functions 8 Lock 97 Reset 100 Turn On and Off 6 Unlock 97 Phone Number Display 14 Find 40 With Pauses 20 Picture and Video Storage 82 Assigned Media Folder 84 Auto Save to 82 Folder Options 83 Index 115 In Phone Folder 82 On Memory Card 83 Picture ID 92 Pictures Assign 39 76 92 Auto Save to 82 Send 85 Store 82 Take 76 Plus Code Dial 20 Power Save Mode 93 Preset Messages 48 Receive a Call 22 Answer 23 In call Options 24 Mute the Ringtone 23 Reject a call 23 Send to Voicemail 23 Reset 100 Ringtones 94 Assign 38 Mute 23 Roaming 108 Icon 108 On Other Networks 108 Settings 108 Save Number From History 33 Number Using Keypad 36 Number With Pauses 20 Screen Contrast 104 Secret Contacts Entries 43 Security 97 Delete Phone Content 99 Limit Use 98 Lock Code 97 Lock Phone 97 Reset Phone 100
31. All to unlock all messages Note Messages are automatically deleted starting with the oldest To save messages lock them Delete to delete the selected message Delete All to delete all messages Call to dial the phone number appearing in the selected message Launch to open the URL appearing in the selected message Save Number to save the phone number appearing in the selected message Save Email to save the email address appearing in the selected message Messaging 47 Settings to display the Messaging Settings menu Combine Uncombine to display segmented messages as one message or vice versa More Information to display more information when receiving an Emergency Alert message See Emergency Alerts Messaging Settings Set Clear Alerts Icon Clear Alerts Icon will clear the envelope icon on the display 1 In standby mode press MESSAGING left softkey gt OPTIONS right softkey gt Clear Alerts Icon 2 Press YES left softkey Set a Callback Number With this feature you can specify the callback number your recipients see when you send messages 1 In standby mode press MESSAGING left softkey gt OPTIONS right softkey gt Callback Number 2 Select None My Phone Number or Other If you select Other enter a callback number and press SAVE left softkey Add a Customized Signature Add a customized signature to each message you send 1 In standby mode press MESSAGING lef
32. Enter a hint and press g Settings 97 Press NO right softkey to return to the previous menu To edit or delete a lock code hint 1 Press o gt Settings gt Lock Phone and enter your lock code 2 Select Lock Code Hint 3 Edit the hint and press g or Delete the hint by pressing and press p Tip If you can t recall your lock code try using the last four digits of your wireless phone number or check your lock code hint If this doesn t work call U S Cellular Customer Care at 1 888 944 9400 Limit Use This feature allows you to limit the use of certain functions on the phone Activate the Limit Use Feature 1 Press x gt Settings gt Limit Use gt On Off gt On 2 Enter your new code 3 Re enter your new code The next time you try to access this setting you will be required to enter your Limit Use code Change the Limit Use Code 1 Press o gt Settings gt Limit Use and enter your limit use code 2 Select Change Limit Use Code 3 Enter your new code 4 Re enter your new code Settings 98 Restrict Voice Calls and Messages 1 Press g gt Settings gt Limit Use and enter your limit use code 2 Select Restriction 3 Select an option Voice Calls to restrict incoming and outgoing voice calls except those placed to 911 Messages to restrict sending messages except to designated recipients 4 Select On Off gt On Read the message and press OK left softkey Note If you se
33. Failed pending and draft messages are also listed Highlight a message to see details for that message e Me Message you sent e Me Failed Message you did not send successfully e Me Pending Message you have not sent yet because your phone has no network connection The message will be sent automatically when your phone reconnects to the network e Me Draft Message you saved as a draft Only one draft can be saved in each thread and that draft appears at the top of the thread Messaging 46 Message Details Highlight a message and press go to display the message details and view the entire message You can select certain information from a message and automatically save it or use it in a related application See Simple Data Exchange Threaded Messaging Options When you are viewing a messaging thread list a message thread or a message details screen you can choose from among the following options Options will vary according to screen gt Press Bex or to make a call gt Press SEND MESSAGE left softkey to send a message to the entry gt Press REPLY left softkey to reply to a message gt Press SEND left softkey to send a draft message gt Press RESEND left softkey to resend a failed message gt Select a message press OPTIONS right softkey and select an option Forward to forward the selected message Lock to lock the selected message Unlock to unlock the selected message Unlock
34. ICU CS en eaten oeataoueedenmaneccnqaun cemncdo cameos eceutentccucconsgunnsaeieceeetenccuteateces 76 Take a PICGUI Guso na seeders rane ence eed ata 76 PASSION PICLUIES cinama a aaa a aa a aa has a 76 camera Mode OD LONG sinsin AA 77 Camera e a E E E et 79 RECOV O aar E piaeatnre aaaonn seteuerers secant areseces 80 Recorda Vide Orere ine EEEa 80 Camcorder Mode OPHONS casina a naka cuit oanuietatdebaiaannenel aanaacenenes 81 camcorder SOUUIG einne ee E E oiae 81 Stre Pictures and VIG COS ssrrirerni iea aa Ei E EEAS EE EEE E EE 82 SCE Storage OPUON S erine EA AE niaaa ai 82 EPON FOO ean aE E EEE EE E A E ER 82 On Memory Cara Folde oeenn E A E NAE 83 In Phone and Memory Card Folder Options esessesesssnennsnnnnnnennnnnnnnnnnnnnennnnennrnennnns 83 Review Pictures and Videos in the Assigned Media FOIer ccccscsecseeeceeeeseeeeeeeeees 84 Od g see 40 99 Steer eee eee re A Rene ere eres nr neers rere rr ty Tere 84 Sona Pictures and W COG Sh tennis eter tate gaceb ete Sureatant ieee utate easeieaewctunat yosweeiam tam nouiind 85 Wep and Dala fee ee eee en ec ee ae ee ee 86 Ale DCEW IC CS E A A E A A E winnie monn iat A E E A E 86 Laune WeDLCONNeECHON ensenha 86 Data Connection Status and Indicators s sssesssessssrsrsrnrnrnrnrnrnrnnnrnrnrnrnrnrnrnenenenennt 86 DOW SE careieni O E E a 87 Learn to Navigate the Webinars uoeeei aiea aa aa EN E EAE SAA 87 DrOWSer MENU sigoni annrnin Sene aA Ee NEEE aR 88 TOC V SOUN sevaise
35. KYOCERA DURAXA User Guide Table of Contents PRONG eS eetedewecacerces acer a EEE EEEE NEE EE E EE EE 1 Batay ane CCSD dirann eras EA SENESE E NATA AT 1 BEET CCIE A E E E E E E E E A 1 Maaa Ea O aeara EEEE EA EEEE ELEN 2 Charge the Battery ee ee ee ee 3 Remove tne Bally ccnaventanercnnestevetiextavetirecanemsacescanatanenentapedeeneaaennenevcntenceeiaeeayete 3 eere NE A e a ae EE EE E E EEA E EEEE 4 near CIS Mill CRO D Car eeen uE aE EEA E AES 5 T r YOU POMS ON QING HOT sore epee cong oeee speyeese aeinn nET EEEE EENES 6 PRONG VSI NOVY areira EEE oven cad oases ove sara aie ee EEE see 7 Key FUNCHONS eee ee eee 8 Navigate Through the MenuS 5 cists cennticy sancasieecnmhe near wemiaaenotiay cutpudiacknnbeignenpeianenatinveater 10 VIEW TIE DISD lay SO Glier aeri Enui EENE een ai EREE eE 11 Display Your PON NUD OF oscsssiriryis arri AE 14 TOCE UV a E E A E E E E 15 Select a Text INDU MOQUE iserrssrirsrisarorsrinpinre ironta rannt NAKENT ENA ASNT E EEN NE EErEE 15 PVD SIRE LINO r aE E E T T eiisyntascisaneeuier 15 ABC MOG aaen E E 16 DCG MSE ENUY COONS airin iner E EEEE EEE TEEI FEES EAE E EATE I AENEA 17 Copy and Paste TeX iressirinverireiiisnsiderinnenoiii saira vanai ieia anair eiaa 17 Phone Calls amp Settings n nsesssesensensnsnununnenrnnnennensnsnununnennnnnunnensnsnurunnennnnnunnensnnnuruenennune 19 MaKe PHONG CAMS rsi enin nipeni eA Ee a EAE EETAS 19 Call Using the Phone K ypad cccceesscsseressecuecreesseuecueeuse
36. MULTIPLE left softkey to select multiple recipients Press CONTINUE left softkey when you have finished selecting and entering recipients You may include up to 40 recipients per message NEW ADDRESS right softkey to enter a recipient s wireless phone number or email address directly Press CONTINUE left softkey to proceed Compose a message Confirm the recipients message and pictures or videos You may also select additional options by pressing the right softkey Follow the onscreen instructions to add available options Press SEND left softkey to send the pictures and videos Camera 85 Web and Data Data Services With your service you are ready to start enjoying the advantages of data services This section will help you learn the basics of using your data services including launching a data connection and navigating the Web with your phone Launch a Web Connection Launching a Web connection is as simple as opening the browser on your phone gt Press gt Web While connecting you may see an animation before the home page appears Tip To change the default launch page to the last page you viewed press Options right softkey and select Browser settings gt Startup page gt Use the last page I visited gt Confirm left softkey Data Connection Status and Indicators Your phone displays the current status of your data connection through indicators at the top of the screen The following s
37. New Address or Contacts to enter a new phone number or address or to select an entry from your Contacts Each group entry can contain up to 40 members When you have selected all the entries you want to add press CONTINUE left softkey Enter a group name and press x gt SAVE left softkey History 33 Delete History You can delete individual or all entries in your History 1 Press go gt History 2 Highlight an entry you wish to delete and press OPTIONS right softkey gt Delete Select Delete All to delete all entries 3 If you are certain you want to delete one or all entries from History press DELETE left softkey History 34 Contacts About Contacts There are two types of Contacts entries e Personal Contacts Entries Entries for an individual Your phone can store up to 1000 personal Contacts entries Each entry can contain up to seven phone numbers and three email addresses three IM addresses and three Web addresses e Group Contacts Entries Entries that contain more than one personal Contacts entry Your phone can store up to 25 Group Contacts entries Each group entry can contain up to 40 members View Contacts The Contacts List The Contacts list shows the Contacts entries stored in your phone 1 In standby mode press CONTACTS right softkey You will see the Contacts list 2 Highlight a personal entry to show the entry s main phone number or highlight a group entry to show ho
38. Phone Basics 3 Insert the SIM Card To use your phone outside the U S Cellular network you must insert a valid GSM SIM card into the SIM card slot Note The SIM card is not required for activation or use on the U S Cellular network Note The SIM card is only required when the DuraXA is used outside of North America on a GSM network 1 Remove the battery cover and the battery 2 Slide the SIM card holder in the direction of the arrow to unlock it O 3 Raise the SIM card holder with your finger 4 Place the SIM card into the holder with the gold contacts facing down and the cut off corner on the bottom right O SIM Card Holder 5 Replace the SIM card holder 4 and slide the holder in the direction of the arrow to lock it G 6 Place the battery back into its compartment and replace the battery cover Note When you turn your phone on for the first time with a new SIM card you will be asked to enter a PIN code to unlock your SIM For details see Input PIN PUK Phone Basics 4 Insert the microSD Card A microSD card is an optional accessory that allows you to store images videos music documents and voice data See microSD Card for more information 1 Remove the battery cover and the battery 2 Slide the card holder in the direction of the arrow to unlock it O 3 Raise the card holder with your finger O 4 Insert a microSD card into the holder Make sure to check the position o
39. Scrolling As with other parts of your phone s menu you ll have to scroll up and down to see everything on some websites To scroll line by line through websites gt Press the navigation key up or down Selecting Once you ve learned how to use softkeys and scroll you can start navigating the Web To select onscreen items gt Use the navigation key to highlight an item and press E Tip If the items on a page are numbered you can use your keypad number keys to select an item Links which are displayed as underlined text allow you to jump to Web pages select special functions or even place phone calls Web and Data 87 To select links gt Highlight the link and press the appropriate softkey Go Back To go back one page gt Press on your phone Tip You can also use for deleting text like a BACKSPACE key when you are entering text Browser Menu The browser menu offers additional options to expand your use of the Web on your phone Open the Browser Menu You may open the browser menu anytime you have an active data session from any page you are viewing gt From any open Web page press Navigation left softkey Use the navigation window for the following operations To open a specific page gt Highlight the text input field on the top enter a URL and press g To open a new window gt Highlight Open a new page and press g To switch windows gt Highlight the icon for the page you want to dis
40. Title to edit the title of a memo Properties to display information about a memo Sort by to sort memos by time recorded name or file size Calendar amp Tools 70 Go to Time to set the point from which the memo starts playing Go to Card Go to Phone to switch between memos recorded on the memory card and to the In Phone folder Send Media to send a memo by attaching it to a message Copy to Card Copy to Phone to copy selected memos to the memory card or to the In Phone folder Move to Card Move to Phone to move selected memos to the memory card or to the In Phone folder Delete to delete either selected memos or all memos Select from This Multiple or All Assigned Media The Assigned Media folder automatically stores copies of pictures assigned as picture IDs or wallpapers on your phone See Assign Pictures 1 Press g gt Tools gt Assigned Media 2 Use your navigation key to view and scroll through the pictures To switch a picture from thumbnail view to expand view mode select a picture and press B Calculator Your phone comes with a built in calculator 1 Press o gt Tools gt Calculator 2 Enter numbers using your keypad Press the appropriate key for an arithmetic option Press the left softkey to enter a decimal point Press CLEAR right softkey to clear all numbers 3 Press o for the total Calendar amp Tools 71 Tip Calculator This feature allows
41. Unlock Phone 97 Self Timer 78 Index 116 Services Dial 44 Set Up Voicemail 25 Settings Accessibility 101 Alerts 104 Camcorder 81 Camera 79 Display 91 Language 107 Messaging 48 Phone Call 28 Phone Setup Options 104 Ringtones 94 Roaming 108 Security 97 Text entry 96 Volume 94 Signature 48 Silence All 94 Simple Data Exchange 50 Speed Dial 20 Assign Numbers 41 Stopwatch 72 Text and Multimedia Messaging 45 Access Messages 45 Callback Number 48 Clear Alerts Icon 48 Compose Messages 45 Emergency Alerts 49 Long Message Reassembly 50 Message Alerts 49 Preset Messages 48 Settings 48 Signature 48 Threaded Messaging 46 To Do 53 TTY Use 101 Turn Your Phone On and Off 6 Index 117 Unlock Your Phone 97 Vibrate Type 103 Videos Auto Save to 82 Record 80 Send 85 Store 82 Voice Guide 101 Voice Memos 69 Voice Services 65 Automatic Speech Recognition ASR 65 Voice Memos 69 Voicemail 25 New Message Alerts 26 Notification 25 Retrieve Messages 26 Set Up 25 Volume 94 Adjust 94 Silence All 94 Web 86 Browser 87 Launch 86 Navigation 87 Status and Indicators 86 World Clock 73 Zoom 79 Index 118
42. above steps condense into gt Press amp gt Settings gt Phone Info gt Icon Glossary Back Up Within a Menu To go to the previous menu gt Press ied To return to standby mode gt Press oe Phone Basics 10 View the Display Screen The status bar at the top of your phone s display screen provides information about your phone s status and options The following tables identify the symbols you ll see on your phone s display screen Tip To view a list of your phone s icons and descriptions from the main menu select Settings gt Phone Info gt Icon Glossary Status Icons Fiil Signal Strength Your phone s current signal strength More bars stronger signal 30 hse go No Service Your phone cannot find a usable signal OWO Data Services 3G Your phone is connected to the 3G data service ORO Data Services 1x Your phone is connected to the 1X data service Data Services GSM Your phone is connected to the GMS data service ave Data Service Available Data service is available When active the icon is animated a Data Service Dormant Data service is currently dormant Data Service Unavailable Data service is currently unavailable OBO Roaming Your phone is roaming off the home network Battery Your phone s current battery charge level The icon to the left shows the battery is fully charged The icon is animated while the battery is charging Ringtone and Vibr
43. andeen sa etmepia seine aareiauete 27 Call FOWA diN G cienia EEA 28 PRODO Call SeRiNG Suinae a E 28 ADDreviated DialNO dessiner aa E E oie 28 Cal ANSWE IM OGG vrare EEEE E E E E SEESE E EEE E OEE 29 AULOANSWET MOOC oansuanivi tsnena Ea EENAA asa 29 International Dialing s sssssserenssssnsrnrnnrsnennrnnnrnennrnrnnnnnrnnrnrnnnenennrnrnnnenernrnnrenennenne 30 PISTO rar E A a A 31 VIEW HISTO cirean A O aaucane pen eee wee eenenaees 31 PAR Or E a E a O A 31 FI TOV ICON ernn N E a TC 31 ASON IN ddos rere ee armen cr rrr ren wrt ten fatter tnt ter nn a tre re tree rent 31 PISTON Detalls iisen E A E A itive cedieneanat aueinds 32 HISO ODI ORN S iarra T tana 32 Make a Call FIOM FISUONY oenen orar E 32 Save the Information in Your H StOTY s ssssssusssnunnnnunnnnnnnnnnnnnnnnunnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn 33 Save a NU UMDEr MOn HISTO astsntoncedansnnswiatianteinuanntnsatoncelsvseetausdionouiansiatwasentetasane 33 Make a New Group Entry from History ssssesssnenesnnnnrennnnnnnnnnnnnnnnnnnnnnnnnnnennnnnnnrnnnnne 33 Derete PISTO nperi e EEEE EE ana 34 TOC li OAC US suiosa avons cx femnaente A a T 35 PIOOUL CONAC inea 35 VIEW COMLACES eicae E E EAEE 35 MG CO MAGES EIST sirana Ea EEEE 35 Contacto DEAG marake EE E veri ates cima ESEE E E emer oast ee 35 View History from Contacts ssessssssssnnnensnunnrnennnnsennnnnnunnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnne 35 Create a New Contacts Entry s sssssssssnanuasssnnnnnannnan
44. applicable Web Shortcuts to enter Web shortcuts for example www http or com Text Options to display the text entry options menu if applicable See Set Text Entry Options Tip When entering text press ey to change the capitalization style as Abc gt ABC gt abc ABC mode or as XT9Word gt XTOWORD gt XT9word T9Word mode The selected style is displayed in the bottom right corner of the screen above the right softkey label if applicable XT9 Smart Input XT9 Smart Input is a predictive text input technology which uses the word database to analyze the letters you enter and create a suitable word Text Entry 15 Enter Text in the XT9 Mode 1 Select the XT9Word text input mode 2 Press the corresponding keys once per letter to enter a word For example to enter the word Bill press E lel Ss ED if you make a mistake press to erase a single character Press and hold to erase an entire word 3 As you type a word choice list opens The word may change as you type Press the navigation key to scroll to the word you want to enter and press OK left softkey or o to select it If the word you want is not displayed after you have entered all the letters see Add a Word to the XT9 Database in this chapter Add a Word to the XT9 Database If the word you want to enter is not displayed in the word choice list when you are using XT9 Input add it to the database 1 While you are
45. ate The volume level is set to between 1 and 8 and vibrate is turned on 1 Beep A beep sounds when you receive an incoming call a message etc ee 1 Beep and Vibrate 1 Beep and vibrate are set RQ Ringtone Off Your phone s ringtone is turned off eB Vibrate All Your phone s sound is turned off but vibrate is turned on Phone Basics 11 ee Silence All Your phone s sound is turned off Location On Your phone s location feature is on and available for location based services such as GPS Navigation Location Off Your phone s location feature is off Your location is available only for 911 TTY Mode Your phone is connected to a TTY device Alarm An alarm or countdown is set HAC Enabled Your phone s HAC hearing aid compatibility setting is enabled Missed Call You have one or more missed voice calls Calendar You have event notifications New Messages You have one or more new messages waiting New Voicemail Messages You have one or more new voicemail messages waiting New Urgent Messages You have one or more new urgent messages waiting Multiple Alerts You have different kinds of alerts waiting Urgent Multiple Alerts You have different kinds of alerts including urgent messages waiting Bluetooth Icons ES Visible Your phone is discoverable by visible to other Bluetooth devices Connected Your phone is connected to a Bluetooth device Enabled Your phone s Blue
46. bers e Web addresses URLS Email Address Options gt Highlight an email address press E and then select an option Send Message gt Message The messaging application will open and the email address will appear as the message s recipient Share gt Message The messaging application will open and the email address will appear in the message body Save to Contacts to save the email address in Contacts Contact Details to display the Contacts entry if the email address is already saved in Contacts Phone Number Options gt Highlight a phone number press and then select an option Messaging 50 Call to call the phone number Prepend to prepend a number to the phone number Send Message to send a message to the phone number The messaging application will open and the phone number will appear in the To field Share gt Message The messaging application will open and the phone number will appear in the message body Save to Contacts to save the phone number in Contacts Contact Details to display the Contacts entry if the phone number is already saved in Contacts Web Address URL Options gt Highlight a Web address URL press 6x J and select an option Messaging Browse to open the browser to the Web page Share to select Message The messaging application will open and the Web address will appear in the message body Save to Contacts to save the Web address in Contacts 51 Calendar
47. cemail and use other voice services To disable data services 1 Press o gt Settings gt Others gt Data Settings gt Data gt Off 2 Read the disclaimer and press DISABLE right softkey to sign out Data Profile The Data profile menu allows you to view your data profile 1 Press x gt Settings gt Others gt Data Settings gt Data Profile 2 Choose which ones you want to be shown APN Settings You can view or edit the Access Point Name APN for data services on your phone To add an APN 1 Press E gt Settings gt Others gt Data Settings gt APN 2 Highlight New APN1 New APN2 or New APN3 and press EDIT left softkey 3 Enter the required field and press OK left softkey To change the APN 1 Press o gt Settings gt Others gt Data Settings gt APN 2 Highlight your desired APN and press x 3 Read the message displayed and press YES left softkey The phone will reboot to update the configuration To reset your APN settings 1 Press g gt Settings gt Others gt Data Settings gt APN Settings 106 2 Highlight an APN and press RESET right softkey 3 Read the message displayed and press OK left softkey Headset Mode Set the sound output destination including the incoming ringtone 1 Press x gt Settings gt Others gt Headset Mode 2 Select an option from the following Normal to play the sound through both the headset and the speaker Headset Only to play
48. d press x Assign a Vibrate Type to a Contact You can assign a specific vibrate type to a contact 1 In standby mode press CONTACTS right softkey Highlight an entry and press Select Set Vibrate Type gt Incoming Calls or Message Select Change Contacts 38 5 Highlight a vibrate type category such as Default Vibrate Type Preloaded Vibrate Type or No Vibration and then press E 6 Highlight a vibrate type and press p Assign a Picture to a Personal Entry Assign a picture to display each time a certain contact calls you 1 In standby mode press CONTACTS right softkey 2 Highlight an entry and press E 3 Highlight and press 4 Select Choose Photo 5 Select a photo category and press g 6 Select an image and press g to assign it Add Members to a Group Entry You can add a group member to an existing group 1 In standby mode press CONTACTS right softkey 2 Highlight the group you want to add members to and press OPTIONS right softkey gt Edit Group gt Add More 3 Read the message and press START left softkey 4 Highlight an entry you want to add and press g If the entry has more than one phone number or email address select a number or numbers or address or addresses Each selected number or address will be added as a separate entry to the group 5 Repeat step 4 to add additional members 6 Press CONTINUE left softkey gt SAVE left softkey Remove Member
49. de You can reassign the default shortcuts to the menu items you choose 1 Press o gt Settings gt Others gt Navigation Keys 2 Highlight the navigation key you wish to reassign and press E 3 Using the navigation key or your keypad highlight a function 4 Press ASSIGN left softkey to save For options with submenu levels such as Settings you can assign submenu options by navigating to the desired option before pressing ASSIGN Settings 109 Copyrights 2014 Kyocera Corporation KYOCERA is a registered trademark of Kyocera Corporation All other trademarks are the property of their respective owners This product contains NetFront Browser of ACCESS CO LTD ACCESS and NetFront are trademarks or registered trademarks of ACCESS CO LTD in Japan and other countries This software is based in part on the work of the Independent JPEG Group The Bluetooth word mark and logos are registered trademarks owned by Bluetooth SIG Inc and any use of such marks by Kyocera Corporation is under license Other trademarks and trade names are those of their respective owners Nuance the Nuance logo VSuite and XT9 are trademarks or registered trademarks of Nuance Communications Inc or its subsidiaries in the United States of America and or other countries Copyright 2008 2014 Nuance Communications Inc All rights reserved micro ms gt microSD and microSDHC L trad ks of SD 3C LLC SD ICro and micro ogos are trademarks o
50. e of the following options TTY Off to disable TTY mode TTY VCO to enable TTY mode in Voice Carry Over mode which allows you to send voice and receive text during a call TTY HCO to enable TTY mode in Hearing Carry Over mode which allows you to send text and receive voice during a call TTY Full to enable all TTY settings You can send and receive text during a call Note In TTY Mode your phone will display the TTY icon if a TTY device or an optional headset is connected to your phone Note When enabled TTY mode may impair the audio quality of non TTY devices connected to the headset jack Warning 9 1 1 Emergency Calling It is recommended that TTY users make emergency calls by other means including Telecommunications Relay Services TRS analog cellular and landline communications Wireless TTY calls to 9 1 1 may be corrupted when received by public safety answering points PSAPs rendering some communications unintelligible The problem encountered appears related to TTY equipment or software used by PSAPs This matter has been brought to the attention of the FCC and the wireless industry and the PSAP community are currently working to resolve this Font Size Adjust the font size for the screen This setting does not affect all screens For details see Change the Font Size Settings 102 Vibrate Type You can select vibration patterns for incoming calls messages alarms and scheduled events Select Vibra
51. een as a viewfinder aim the camera lens at your subject Press RECORD left softkey o or a to begin recording Press PAUSE CONTINUE left softkey to pause or resume the recording as needed Press Eon or STOP right softkey to stop recording The video will automatically be saved in your designated storage area To return to camcorder mode to take another video press CAMCORDER left softkey or o Press OPTIONS right softkey for more options Play to play the video you just took Send to send your video in a message See Send Pictures and Videos Assign to assign the video Select an option and press E Delete to delete the video you just took Camera 80 Review Media to go to the In Phone folder or memory card folder to review your saved videos Details Edit to edit or display details relating to your videos Camcorder Mode Options Various options are available from camcorder mode Press OPTIONS right softkey to display additional options Video Mode to select a camcorder mode from Normal Beach Snow Scenery Mirror Image or Night Dark Video Light to turn on the video light The video light turns on once this option is set to On Zoom to zoom in on an object You can adjust the zoom from 1 to 12 Self Timer to activate the timer function See Self Timer for details Color Tone to select from a wide variety of color tones for your video Image Controls to adjust settings for Bright
52. elete a file or folder from File Manager e Import to import a Contacts file or a calendar file e Sort by to sort folder contents by name date or size e Properties to view the properties of the selected file e Rename to change the name of a selected file Note You may not be able to use the file if you change the file name extension e Assign to set images as your wallpaper or picture ID for Contacts entries e Send Media to send a file by attaching it to a message e Use Bluetooth to play an audio file through a Bluetooth device e Create Folders to create preset folders on the memory card See Create Folders in the microSD Card e List Thumbnail to switch between list view and thumbnail view e Memory Info to view the used and available memory space e Go to Card Go to Phone to switch from one storage area to another e Play Listen View to play a video listen to audio or view a picture Connect Your Phone to Your Computer Before using your phone s mass storage capabilities you need to prepare your phone s data services to synchronize with your desktop or laptop computer Once you have connected the phone to the computer you can transfer your data to or from the microSD card 1 Press go gt Tools gt Memory Storage gt Connect to PC You will see a confirmation message 2 Press OK left softkey to continue 3 Connect your phone to your computer using a compatible USB cable Wait for the connection to be com
53. eos Select This Selected or All Note Deleting data will free up memory space in your phone to enable you to take more pictures and videos e Copy Move to Card to copy or move pictures and videos from your phone to your memory card e Copy Move to Phone to copy or move pictures and videos from the memory card to your phone e Copy Move to copy or move pictures and videos from a memory card folder to another memory card folder e Details Edit to edit or display details relating to your pictures or videos Text Caption to edit the selected picture s or video s caption Special Effects for pictures to select from Fun Frames Color Tone Fun Stamps or Rotate Resize for pictures to resize the selected pictures Trimming for pictures to crop the selected picture Camera 83 Photo Info or Video Info to display information such as the picture s or video s caption time date and size Full Screen for pictures to display the selected picture in full screen view Display Size for videos to change the display size Actual Size or Full Screen Review Pictures and Videos in the Assigned Media Folder The Assigned Media folder automatically stores copies of pictures or videos assigned as picture IDs or wallpapers on your phone See Assign Pictures 1 Press o gt Tools gt Assigned Media 2 Use your navigation key to view and scroll through the pictures and videos To switch a picture or video from
54. er ask for confirmation To adapt the system to your voice 1 Press and hold 5 fours or the external speaker button 2 Press SETTINGS right softkey gt Adaptation gt Adapt Voice 3 Press START left softkey and repeat each word phrase or telephone number you hear To reset the adaptation 1 Press and hold w orre f or the external speaker button 2 Press SETTINGS right softkey gt Adaptation gt Reset Voice gt YES left softkey To change the ASR mode 1 Press and hold e orre or the external speaker button Calendar amp Tools 68 2 Press SETTINGS right softkey gt Audio Modes 3 Highlight an option and press g Expert Mode to sound a beep only Prompt Mode to prompt for required information Readout Mode to prompt for required information and to read the text displayed on the main screen To change the ASR dialing region 1 Press and hold Ka orre f or the external speaker button 2 Press SETTINGS right softkey gt Dialing Region 3 Highlight an option and press North America to recognize only numbers valid in North America Other to recognize any number regardless of location To display the ASR software version 1 Press and hold Ka orre f or the external speaker button 2 Press SETTINGS right softkey gt About Manage Voice Memos Use your phone s Voice Memo to record brief memos to remind you of important events phone numbers or grocery list items Note
55. eting No Greeting to not to show a greeting Custom to create your own custom greeting Enter a custom greeting up to 15 characters and press OK left softkey Press Done left softkey to save your greeting Change the Phone s Menu Style Choose the layout of your phone s menu 1 Press go to display the main menu Settings 93 2 Press OPTIONS right softkey gt Grid View or List View to change the menu style Volume Settings Adjust your phone s volume settings to suit your needs and your environment Adjust the Phone s Volume Settings You can separately adjust the volume of various sounds your phone makes 1 Press x gt Settings gt Volume 2 Select Incoming Ringtone Playback Volume Power Up Down Key Beeps or E911 Alert If you select Power Up Down or E911 Alert select On or Off If you select Key Beeps select Tone Volume or Tone Type 3 Select a volume level and press 3 Tip You can adjust the ringtone volume in standby mode or during an incoming call and the volume during playback by using the volume button Silence All The Silence All option allows you to mute all sounds without turning your phone off To activate Silence All gt Press and hold the volume button down in standby mode The screen will display Silence All To deactivate Silence All gt Press the volume button up repeatedly to select a volume level Ringtone Settings Ringtones help you identif
56. ets you place or receive calls in speakerphone mode or turn the speakerphone on and off during a call END POWER Key 55 lets you turn the phone on or off end a call or cancel your input and return to standby mode Phone Basics 8 Keypad lets you enter numbers letters and characters and perform functions Call List Button lets you display the recent call history or end a call External Speaker Button lets you place or receive calls in speakerphone mode turn the speakerphone on and off during a call activate Automatic Speech Recognition ASR or unlock the keyguard Camera Lens as part of the built in camera lets you take pictures and videos Secondary Microphone suppresses background noise improving audio quality for the other party during voice calls except in speakerphone mode Flash allows you to take pictures or record videos in low light situations It can also work as a flashlight See Flashlight Outer Screen displays the information such as the call status the date and time and the signal and battery strength Charger Accessory Jack allows you to connect a compatible charging cable or USB data cable not included CAUTION Inserting an accessory into the incorrect jack may damage the phone USB Charging Port allows you to connect the phone and the USB cable for use with the charger adapter or other compatible accessories Speaker lets you hear the different ringtones and sounds The speaker also lets you
57. ey gt Text Mode gt Paste List 5 Press the navigation key to scroll to the text you want to paste and press E Note This feature is not available where you cannot select the text input mode or in the Web application Text Entry 18 Phone Calls amp Settings Make Phone Calls Call Using the Phone Keypad The most traditional way to place a call is by using the phone s keypad 1 Enter a phone number from standby mode If you make a mistake while dialing press to erase the numbers 2 Press 5 iy or the external speaker button 3 Press gz when you are finished Call from History Place a call to the numbers in your History 1 Press go gt History Press E or the call list button in standby mode 2 Highlight an entry and press R Tip To redial your last outgoing call press E twice Note You cannot make calls from History to entries identified as No Caller ID Private Restricted ID or Unavailable ID Call from Contacts Place a call to the numbers stored in your Contacts 1 In standby mode press CONTACTS right softkey 2 Highlight the entry you want to call 3 Press Sex to dial the entry s default phone number Phone Calls amp Settings 19 To dial another number from the same entry press o to select the entry highlight a numter and then press D Call Using the Plus Code When placing international calls use Plus Code Dialing to automatically enter the international
58. f the gold terminals O a Sy ge microSD Card Holder 5 Gently press the card and the card holder 4 and then slide the holder in the direction of the arrow to lock it 6 Place the battery back into its compartment and replace the battery cover Phone Basics 5 Turn Your Phone On and Off Turn Your Phone On gt Open the phone and press ga Turn Your Phone Off gt Open the phone and press and hold aes for two seconds until you see the powering down animation on the main screen Phone Basics 6 Phone Overview Smart Sonic a Receiver internal Jan 7 2015 Wed Main Screen MESSAGING CONTACTS Kyr Ra Softkeys Volume Button i Navigation Key MENU OK Key 7 raii SPEAKER Key CAMERA Key E a END POWER Key SEND Key CLEAR Key ag Keypad Primary Microphone ii Call List Button External Speaker Button Camera Lens j 2 Secondary km Microphone f Flash Outer Screen Port Speaker o Phone Basics r EE lM lM M M M Headset Jack microSD Card Slot internal S SIM Card Slot internal Screw Internal Antenna gt n _ _ _ _ Key Note Functions Smart Sonic Receiver internal lets you hear the caller and automated prompts Place your ear around the internal receiver and adjust the position of the phone
59. he selected device Help to display the Trusted Devices list help Send Items via Bluetooth Depending on your paired devices settings and capabilities you may be able to send pictures or videos Contacts information or other items using a Bluetooth connection 1 Z Press o gt Bluetooth gt Trusted Devices Select the device from the Trusted Devices list and press TRANSFER left softkey Select an item Send Contacts Send Name Card or Exchange Name Cards and press E Follow the onscreen instructions to select items to send Read the message and press SEND left softkey Calendar amp Tools 59 microSD Card A microSD card is an optional accessory that allows you to store images videos music documents and voice data on your phone Your phone supports a microSD card up to 32GB Note Be sure to use only recommended microSD cards up to 32 GB Using non recommended microSD cards could cause data loss and damage your phone Note Make sure your battery is fully charged before using the microSD card Your data may become damaged or unusable if the battery runs out while using the microSD card Note You can easily damage the microSD card by improper operation Please be careful when inserting removing or handling it Insert the microSD Card 1 Remove the battery cover and the battery See Install the Battery 2 Slide the microSD card holder in the direction of the arrow to unlock it C4
60. hear the caller s voice in speakerphone mode Headset Jack allows you to plug in an optional headset for convenient hands free conversations microSD Card Slot internal allows you to insert an optional microSD card to Support external memory The microSD compartment is behind the battery See Insert the microSD Card SIM Card Slot internal allows you to insert a SIM card The SIM compartment is behind the battery See Insert the SIM Card Battery Cover Screw opens the battery cover to replace the battery Internal Antenna facilitates reception and transmission To maximize performance do not obstruct while using the phone Phone Basics 9 Navigate Through the Menus The navigation key on your phone lets you scroll through onscreen items To navigate through a menu press the navigation key up or down Many menus feature a scroll bar on the right to help you keep track of your position in the menu Select Menu Items As you navigate through the menu menu options are highlighted Select any option by highlighting it and pressing If the option is numbered you can select it by pressing the corresponding number on the phone s keypad For example to view the Icon Glossary screen 1 Press x to access the main menu 2 Select Settings by highlighting it and pressing g 3 Select Phone Info by highlighting it and pressing g 4 Select Icon Glossary by highlighting it and pressing g For the purposes of this guide the
61. ht an entry you want to add to a group and press g A check mark will appear in the box next to the selected entry If the entry has more than one phone number or email address select a number or numbers or address or addresses and press DONE left softkey Each selected number or address will be added as a separate entry to the group Tip Press OPTIONS right softkey gt Enter New Address or Recent History to enter a new phone number or email address or to select an entry from your history 4 When you have selected all the entries you want to add press CONTINUE left softkey 5 Enter a group name and press g gt SAVE left softkey Save a Number Using the Phone Keypad You can save a phone number to Contacts directly from the phone keypad Contacts 36 1 In standby mode enter a phone number 2 Press OPTIONS right softkey gt Save If this is the first time you are saving an entry to Contacts skip to step 4 3 Select New Entry or Existing Entry 4 If you chose New Entry select a number type and then enter the new entry name If you chose Existing Entry select an entry to which you want to save the number and then highlight a number type and press E 5 Press DONE left softkey to save the entry Edit a Contacts Entry Edit a Contacts Entry You can edit existing entries in your Contacts 1 In standby mode press CONTACTS right softkey 2 Highlight the entry you want to edit and press OPTIONS
62. ings 29 2 Highlight an option and press g Hands free to answer calls automatically when the phone is connected to an optional headset or hands free device Speakerphone to answer calls automatically in speakerphone mode 3 Highlight the time you would like your phone to wait before answering and press International Dialing You can set the international dialing code to your current location By default the international dialing code is set to 011 Tip The international dialing code is the number you insert to replace the code in front of the number See Call Using the Plus Code for details 1 Press o gt Settings gt Others gt Call Setup gt International Dial 2 Enter an international dialing code and press OK left softkey Phone Calls amp Settings 30 History View History History is a list of the last 60 incoming outgoing or missed phone calls History makes redialing fast and easy It is continually updated as new numbers or entries are added to the beginning of the list and the oldest entries are removed from the bottom of the list Each entry contains the phone number if available and Contacts entry name if the number is in your Contacts Duplicate calls calls from the same number may appear only once on the list The History List The history list displays your recent call history at a glance gt Press go gt History Tip In standby mode press exe or the call list butto
63. ive a new notification except for incoming call and alarm while an application is running 1 Press g gt Settings gt Display gt Notification 2 Select Enable Pop up or Disable Pop up Tip If you select Disable Pop up you will see only a notification icon The notification pop up will not appear while an application is running Select a Picture ID You can select an image as a picture ID 1 Press g gt Settings gt Display gt Picture ID 2 Select Contact Unsaved Numbers or Private Unknown If you select Contact select an entry 3 Select a picture ID option and press p Settings 92 4 Select an image and press o or ASSIGN left softkey to assign it Power Save Mode This feature helps conserve your battery power by automatically adjusting the backlight setting of your phone 1 Press go gt Settings gt Display gt Power Save Mode 2 Select On Select Off to deactivate this feature 3 Read the message and press CONTINUE left softkey Change the Clock Calendar Display Select a clock calendar display on the main screen in standby mode 1 Press go gt Settings gt Display gt Clock Calendar 2 Highlight an option and press g 3 Press OK left softkey to confirm Change the Greeting You can display your own custom greeting in standby mode 1 Press amp gt Settings gt Display gt Greeting 2 Select an option from the followings US Cellular to display the phone s default gre
64. k However you may not be able to access certain features such as data services depending on the available network Roaming Icon Your phone s display screen always lets you know when you re off the home network Anytime you are roaming the phone displays the roaming icon Roaming Settings Your phone allows you to control your roaming capabilities By using the Roaming menu option you can determine which signals your phone accepts To set the roaming mode 1 Press o gt Settings gt Others gt Roaming gt Roaming Mode 2 Select an option Home Only to access only the home network and prevent roaming on other networks Automatic to seek service on the home network When the home service is unavailable the phone searches for an alternate service When the roaming mode is set to Automatic you can select to allow data services while roaming or not 1 Press o gt Settings gt Others gt Roaming gt Data Roaming 2 Select On or Off Access GSM Networks While Outside the United States When you turn on your phone for the first time while abroad your phone will automatically select an available GSM network If you need to manually select a network make sure your Settings 108 roaming mode is set to Automatic and not Home Only For details see Roaming Settings Navigation Key Shortcuts You can use the navigation keys as shortcuts to access specific menu items directly from standby mo
65. layback Volume is set to Volume Off enabling Voice Guide will automatically change the setting to Level 1 Tip To change the language used for Voice Guide see Language Settings Adjust the Speech Rate You can adjust the rate at which onscreen text is spoken by the phone 1 Press o gt Settings gt Others gt Accessibility gt Voice Services gt Voice Guide gt Speech Rate 2 Select Slow Normal or Fast Voice Recognition You can use your phone s built in automatic speech recognition ASR software to dial a phone number in your contacts or to launch phone functions See Automatic Speech Recognition ASR for details TTY Use A TTY also known as a TDD or Text Telephone is a telecommunications device that allows people who are deaf hard of hearing or who have speech or language disabilities to communicate by telephone Settings 101 Your phone is compatible with select TTY devices Please check with the manufacturer of your TTY device to ensure that it is compatible with digital cell phones Your phone and TTY device will connect via a special cable that plugs into your phone s headset jack If this cable was not provided with your TTY device contact your TTY device manufacturer to purchase the connector cable To turn TTY Mode on or off 1 Press g gt Settings gt Others gt Accessibility gt TTY You will see an informational message 2 Read the disclaimer and press OK left softkey 3 Select on
66. lect On you cannot add edit or delete any Contacts or group entries 5 Select Allowed Contacts gt All Contacts or Choose Contacts If you select Choose Contacts select lt Add Contact gt and then choose a member from the list If you want to remove a member from the list highlight the member and press REMOVE left softkey Restrict Web Camera and Location Mode 1 Press x gt Settings gt Limit Use and enter your limit use code 2 Select Restriction 3 Select an option Web to prevent using the browser Camera to disable the camera function Force Location On to prevent turning the Location function off See Location Settings 4 Select On Delete Phone Content You can quickly and easily delete all the content that you have created or stored in your phone 1 Press g gt Settings gt Reset Delete and enter your lock code Settings 99 4 Select Delete Stuff Highlight an option and press g Messages to delete all messages Call Logs to delete all call history from the phone Browser Cookies and Cache to delete all Web cookies and all Web cache memory saved in the phone Downloaded Content to delete all data downloaded to your phone Contacts to delete all of your Contacts including speed dial numbers saved in your Contacts Voice Memo to delete all voice data saved in the phone My Photos amp Videos to delete all pictures and videos stored in My Photos amp Videos
67. lign Gently press down to secure the battery Replace the battery cover making sure all the tabs are secure and there are no gaps around the cover Phone Basics 2 5 Using a coin rotate the battery cover screw in clockwise direction until the cover locks Warning Make sure you lock the battery cover properly to maintain the phone s waterproof capability Charge the Battery Fully charge the battery before powering the phone on Important Before turning on your phone charge the battery fully with the charger that came with your phone 1 Open the cover to the USB charging port on the left side of the phone 2 Plug the smaller end of the micro USB cable into the phone s USB charging port 3 Plug the other end of the USB cable into the charger and then plug the charger into an electrical outlet 4 When charging is complete remove the cable from the port and close the cover Press around the edges of the cover to ensure that it is securely closed Warning Be sure all ports and covers are properly sealed to maintain the phone s waterproof capability Remove the Battery 1 Make sure the power is off so that you don t lose any stored numbers or messages 2 Insert a coin into the slot on the back cover and turn it counter clockwise to open the back cover 3 Remove the battery and replace the cover See Install the Battery Warning Do not handle a damaged or leaking Li Ion battery as you can be burned
68. ll to delete all History entries See Delete History e Prepend to add numbers to the beginning of the selected number Make a Call From History You can make a call from your History 1 Press o gt History 2 Highlight an entry and press R Note You cannot make calls from History to entries identified as No Caller ID Private Restricted ID or Unavailable ID History 32 Save the Information in Your History You can save the information which appears in your History to your Contacts Save a Number from History You can easily save a number from your History to your Contacts 1 2 3 5 Press o gt History Highlight an entry and press OPTIONS right softkey gt Save Contact Select New Entry or Existing Entry If New Entry was selected select a number type and then enter the new entry name If Existing Entry was selected select an existing entry to which you want to save the number and then highlight a number type and press G Press DONE left softkey to save the entry Make a New Group Entry from History You can create a new group from your History and save it to your Contacts 1 2 3 Tip Note Press go gt History gt OPTIONS right softkey gt New Group Read the message and press START left softkey Highlight an entry you want to add to a group and press x A check mark will appear in the box next to the selected entry Press OPTIONS right softkey gt Enter
69. mation will be attached to the message To enter or edit the emergency message 1 In standby mode press CONTACTS right softkey gt ICE 2 Select Emergency Message gt EDIT right softkey 3 Enter or edit the message and press DONE left softkey Personal Information You can register your own information medical information etc To enter or edit your personal information 1 In standby mode press CONTACTS right softkey gt ICE 2 Select My Information gt EDIT right softkey 3 Enter or edit the necessary information and press DONE left softkey To access your personal information 1 In standby mode press CONTACTS right softkey gt ICE Tip When the phone is locked using the Lock Phone feature you can also press ICE right softkey 2 Select My Information Secret Contacts Entries When you make an entry secret and hide it that entry is not displayed in your Contacts In History a telephone number is displayed but the Contacts entry s name is not To set or unset an entry secret 1 In standby mode press CONTACTS right softkey 2 Highlight an entry and press OPTIONS right softkey gt Set as Secret or Set as Not Secret To hide or show secret entries 1 In standby mode press CONTACTS right softkey 2 Press OPTIONS right softkey gt Settings gt Hide Secret or Show Secret Contacts 43 3 Enter the four digit lock code Tip If you can t recall your lock code try using the
70. mory Storage gt Memory Info The Memory Info page is divided into two sections In Phone and Memory Card Calendar amp Tools 61 2 Press your navigation key down to display memory in the microSD card Format the microSD Card Formatting a microSD card permanently removes all files stored on the card 1 Press go gt Tools gt Memory Storage 2 Highlight Format Memory Card and press g A warning will be displayed 3 If you are sure you wish to remove all the files from your microSD card press YES left softkey Note The formatting procedure erases all the data on the microSD card after which the files CANNOT be retrieved To prevent the loss of important data please check the contents before you format the card Back Up Your Contacts Data to the microSD Card You can easily back up your phone s Contacts data to the microSD card 1 Press g gt Tools gt Memory Storage gt Save Contacts You will see a confirmation message 2 Press YES left softkey to proceed Please wait while the system creates your data microSD Card Folders All the files stored in your microSD are accessible through your microSD card folders Display Your microSD Card Folders 1 Press o gt File Manager gt Memory Card 2 Highlight a folder and press p 3 To view or play a file highlight it and press o or the appropriate softkey Note For information on file and folder options available through File Manager see File
71. mos Automatic Speech Recognition ASR You can use your phone s built in automatic speech recognition ASR software to dial a phone number or to launch phone functions All you have to do is to talk into the phone and ASR will recognize your voice and complete tasks by itself Activate ASR gt In standby mode press and hold a orre f or the external speaker button Tip You can also activate ASR and use certain features with the phone closed Press and hold the external speaker button while in standby mode to turn the keyguard off if Calendar amp Tools 65 it is enabled and then press and hold the external speaker button and follow the voice prompts The phone prompts you to say the name of the command you want to use To complete your task simply follow the voice prompts Available ASR commands include Tip Tip Call lt Name or gt to call an entry in your Contacts list or a spoken phone number See Make a Voice Call Using ASR for details Send Message lt Name or gt to send a message to an entry in your Contacts list or to a spoken phone number See Send a Message Using ASR for details Lookup lt Name gt to display the detail screen of an entry in your Contacts list See Display a Contacts Entry s Information Using ASR for details Go To lt Menu gt to jump directly to menu items or applications See Open Menus Using ASR for details Check lt Item gt to check your phone s status See Check Phone S
72. n to display your recent calls Note History records only calls that occur while the phone is turned on If a call is received while your phone is turned off it will not be included in History History Icons You can determine if an entry was an incoming outgoing or missed call from the icons shown below History Thread The History thread screen shows all history for a selected entry You can also keep track of all the messages you have sent and received for the selected entry To display a History thread 1 Press o gt History 2 Highlight an entry and press G History 31 History Details You can see further details on the history from the History thread screen To display History details 1 Press o gt History 2 Highlight an entry from the list and press E The History thread is displayed 3 Highlight an entry and press G3 An onscreen menu may also be available according to the type of call See History Options History Options You may see several menu items on the onscreen menu Press OPTIONS right softkey for additional options e Call to call the selected entry e Send Message to send a message to the selected entry e New Group to create a new group entry See Create a Group Entry e Contact Details to display information about the entry if it has already been saved in your Contacts e Save Contact to save a phone number See Save a Number From History e Delete to delete the entry e Delete A
73. nasonnnnnnnnnnanuannnnnnnnnnnnunuanennnnnnnnnnanne 36 Create a Personal ENUY sissdsacvntisnnnianinunaeabesnnergnecsdeansvdeantateacuannsraumnnneneiammniunmantiinns 36 create a GroOuUD ENU V rrrniiiniori a a a 36 Save a Number Using the Phone Keypad s sssssussssunnnnunnnnnnnnnnnunnnnunnnnunnnnnnnnnnennnnnns 36 Edita COMICE NUV vivini naa E settanatnde atanustamtaumeehiutae 37 ECG es ON ear le Va E A 37 Delete a Contacts Entry s ssssessssunnsnnnunnnnunnnnunnnnnnnnnnnnnnunnsnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn 37 Add a Number to a Personal Entry s ssssesssssnunnnnunnnnunnnnunnnnnnnnnnnnnnunnnnnnnnnnnnnnnnnnnnnnnnne 38 Assign a Ringtone to a Personal Entry sssessessssnenunnsnsnnnunnensnnnununnennnnnurnensnnnnrennene 38 ASsign a Vibrate Type toa COMTACE faaisinnishiancosnnnareredsonmbalsimmebshenrnaiasmanenasunmianannnis 38 Assign a Picture to a Personal Entry ssesssssennsnsnsnunurnsnsnnnunnensnnnununnennnnnunnennnnnnrunnene 39 Add Members t0 a Group ENUY iscaecsmacsassanasteauinaneasesnietawmnein aatenenananatigawiatmentainesnes 39 Remove Members from a Group Entry cccccsecvessecsccueuseeseureusesseureusenseusersenseusarsenes 39 Find Contacts ENTIE Giniren E a san oat E amaonta Ucn neataeceamea weet 40 Fipan Enty rom Conaclon a a a wen aaanetia ks 40 Find an Entry Using the Phone Keypad jeostdencintatcuteadecniacenie a aae h 40 Use Contacts Information in Other Applications sessssesessenenesnunnnnnnnnnennnnnnnn
74. ncy Contacts Registering ICE information might help rescue workers such as paramedics and police officers as well as hospital personnel identify your primary contact or special medical needs you might have in case of emergency ICE Contacts You can register up to five ICE contacts To add an ICE contact 1 In standby mode press CONTACTS right softkey gt ICE 2 Highlight Add to ICE Contacts and press amp or ASSIGN left softkey 3 Highlight the entry you want to register as an ICE contact and press p If the entry has more than one number press the navigation key right or left to display the number you want to assign and then press p To remove an ICE contact 1 In standby mode press CONTACTS right softkey gt ICE 2 Highlight an ICE contact and press REMOVE right softkey gt YES left softkey Call the ICE Contact When you call an ICE contact the registered emergency message and the GPS information will be sent to the contact 1 In standby mode press CONTACTS right softkey gt ICE Tip When the phone is locked using the Lock Phone feature you can also press ICE right softkey 2 Highlight an ICE contact and press Sex iy the external speaker button or CALL left softkey 3 Read the message and press OK left softkey Note When Location settings is turned off it will be automatically turned on Contacts 42 Emergency Message Register a message to accompany an ICE call The GPS infor
75. ne s software version advanced information channel frequency etc and information about your account Settings 96 1 Press g gt Settings gt Phone Info 2 Select Phone Memory Status Icon Glossary Version Advanced Life Call Timers or Software Update Security Settings The Security settings menus let you set phone security lock code and more Lock Your Phone When your phone is locked using the Lock Phone feature you can only make calls to 9 1 1 and the ICE contacts 1 Press g gt Settings gt Lock Phone 2 Enter your lock code 3 Select Auto Lock gt Lock Now Tip The first time you access the Lock Phone menu you will be advised to change the default lock code by pressing CHANGE left softkey Enter and re enter your new lock code to proceed For details see Change the Lock Code Unlock Your Phone 1 In standby mode press UNLOCK left softkey 2 Enter your lock code Tip You can access the ICE contacts by pressing ICE right softkey when your phone is locked using the Lock Phone feature For more information see ICE In Case of Emergency Contacts Change the Lock Code 1 Press o gt Settings gt Lock Phone and enter your lock code 2 Select Change Lock Code 3 Enter your new lock code 4 Re enter your new lock code You will be prompted to create a lock code hint to help you remember your new lock code 5 If you want to create a lock code hint press YES left softkey
76. nennrnennnns 41 PASSIONS Gi Dial IN UNIO CS isceaveete a wtianreiragespeica i deaarceuretiacea oa a a 41 ICE In Case of Emergency Contacts cccscvessscsscreescusareeneeusareeuseusaueenseueareenseusarenes 42 Secrel COMA CEERI Ss re R ERE 43 al SOrVICOS aina 44 MESSAGING enan E 45 Text and Multimedia MessagiN iinchencatewasntarshinceataunmocneyeencidshanceied eocseinineassenenndaeuet 45 COMPOSE MeEcSaIgES rasa Ea e E E EEEE AEAEE 45 ACCESE MESSAGES aaan E EE 45 TOC lil Threaded Messaging si rccmisurievecientapare aisiesvaisatanauaayenl eisseio ei seniie tetera entrees 46 Messaging SENOS ahicados cart ataca cies iucenienema deca tenenevenanndiun EEE EE NaS 48 SMHS Data EXENA NOE enparien aee EAT EERE EE 50 Garnaal Gt TOOS aripi nA A SEEE 52 cand aE reer E E ESEE EAE R 52 Add an Event to the Calendar sssssssssnsnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnanananananananananannnanannnn 52 Add a To Do List Item to the Calendar susunenununennnnnnnnnnrnrnrnrnnnnnrnrnrnrnnnrnnnrnenenenns 53 Calenidar Event Alerto cenone a E E a E EE 53 View Calendar Eve Suinn na Ea 54 Delete Calendar Events c asna a eer ed aa 54 PAM eee T Rohe A A A E A AEA ante ae A A A E E 55 BUE OOU enea E E enemas 56 Turn Bluetooth On and Off sssssssssnunananananannnnnnnnnnnnnnnnnnnnnnnnnnnnnnannnannnannnannnnnnnnnnna 56 Make Your Phone Discoverable sssssssssnsnannnananannnannnnnnnnnsnnnnnnnnnnnnnnnnnnanananananannnnna 56 S pported Bluetooth ProllleS
77. ness White Balance and Contrast Video Settings to adjust your settings See Camcorder Settings for details Review Media to go to the In Phone folder or memory card folder to review your saved videos Camera Mode to switch to camera mode if applicable Video Mail Mode Long Video Mode to select a video length Key Guidance to indicate the key functions in camcorder mode User Settings to provide convenient access to your favorite settings Camcorder Settings You can customize the camcorder settings 1 i From camcorder mode press OPTIONS right softkey gt Video Settings Select an option and press E Camera 81 Resolution to select video resolution from QVGA 320x240 or QCIF 176x144 Quality to select video quality from Fine or Normal Silent Movie to select On to record without sound Select Off to deactivate this feature Cue Sound to select a cue sound Default Action amp Cut or Ready amp Stop Auto Save to to select the storage area for the videos See Set Storage Options Auto Review to select whether or not the video is displayed for review after you finish recording Store Pictures and Videos Your phone s picture and video storage area is called My Photos amp Videos There are two types of folders in My Photos amp Videos e In Phone See In Phone Folder e On Memory Card See On Memory Card Folder Set Storage Options You can specify where to
78. nsnnunanunananananananannnnnn 100 Accessibility SettingS sssssessunsnsnununnensnsnunnensnnnnnunnensnnnurunnennunnunnensnsnununnennnnuuruenene 101 Set UH Voice GUIA Erian A a 101 VOCS RECON IUO oiean nant nm erates 101 WAP Nd SO e E E E a 101 FONT SIZE sessie a E E A a oa 102 Ne TYDE veian tape ee etn tae ode pet NEEE EEEE EAEE 103 Hearing Aid Device Compatibility scucmeiscnsconeratapaeiecadssnentidwrntasoatahananensniseeseiniaaaamnits 103 TOC yi Sereen CONAS cas8s te asca dea tauetoventuntonsuvechevcosesaacanemavonleyinceroutevontenseadabeisevannenccaince 104 PHONE SetuP OPU NS cronan aTa 104 Atpane Modeen n E A 104 AELE aa E A E E A E EE 104 CS T a EE E EEO T E I EEE EO EN 105 Daa ENNO E Ea A E A E ene on rans 105 Headset MOU rerea ro cata IE R 107 Kangu ACG Setn ern E E ncneee aurea 107 VOCATION SERINO S sora a e a 107 ROSMINI 108 Navigation Koy SOC Es oiiznsooin aa a A AAA 109 CODON a E ease ieee 110 MO e E E o ccoon tages epateuavere tcasteesieeees Lid TOC vil Phone Basics Tip Phone Software Upgrades Updates to your phone s software may become available from time to time U S Cellular will automatically upload critical updates to your phone You can also use the menu to check for and download updates Press o gt Settings gt Phone Info gt Software Update gt Check for Update to search for and download available updates Battery and Charger Warning Use only U S Cellular approved or Kyocera approved ba
79. o x or CAPTURE left softkey until the shutter sounds The picture will automatically be saved in the selected storage area See Store Pictures and Videos To return to camera mode to take another picture press CAMERA left softkey or AEB Note By default the camera is set to Auto Focus mode It takes a few seconds for the focus tracking to lock onto the subject To change the Auto Focus settings see Camera Mode Options 4 Press OPTIONS right softkey for more options Send to send your picture in a message See Send Pictures and Videos Assign to assign the picture See Assign Pictures Delete to delete the picture you just took Review Media to go to the In Phone folder or memory card folder to review your saved pictures Details Edit to edit your picture or display details relating to your pictures Assign Pictures Assign a picture as a wallpaper or as a picture ID 1 Take a picture See steps 1 3 on Take Pictures Camera 76 2 With the picture displayed press OPTIONS right softkey gt Assign and select an option Picture ID to assign the picture to a Contacts entry as well as to unsaved phone numbers or to private and unknown phone numbers See Select a Picture ID Wallpaper to assign the picture as a wallpaper Tip You can also assign pictures from the My Photos amp Videos menu See In Phone and Memory Card Folder Options Camera Mode Options Various options are available from camera m
80. ode Press OPTIONS right softkey in camera mode to display additional camera options e Picture Mode to select a picture mode from Normal Beach Snow Scenery Mirror Image or Night Dark e Flash to select an option from the following Off to prevent flash from firing On This Shot to fire flash only for the current shot On Always to fire flash for all shots Auto to automatically fire flash when the light level is too low for an available light shot e Focus Settings to select the focus setting from Auto Focus or Infinity e Zoom to zoom in on a subject See Zoom e Self Timer to activate the camera s timer See Self Timer e Fun Tools to select an option from the following Multiple Shots to take multiple shots See Multiple Shot Fun Frames to select your favorite fun picture frame to decorate your picture displayed only when the resolution setting is 0 3M or 0 1M Color Tone to select a wide variety of color tones for the picture e Image Controls to adjust settings for Brightness White Balance Sharpness or Contrast Camera 7 e Camera Settings to adjust Resolution Quality and other settings See Camera Settings e Review Media to go to the In Phone folder or memory card folder to review your saved pictures e Camcorder Mode to switch to video mode See Record a Video e Key Guidance to show keypad shortcuts in camera mode e User Settings to provide convenient access to your favorite settings
81. omes with a built in alarm that has multiple alarm capabilities 1 Press go gt Alarm 2 Highlight an alarm number and press p 3 Highlight a setting and press E Alarm to set the alarm to on or off Description to enter a description of the alarm Time to set the time for the alarm to go off Repeat to select a frequency of the alarm Ringtone to select a ringtone for the alarm Volume to select a volume level of the alarm Ringtone Length to set the duration for the selected ringtone to ring Snooze Interval to select the interval between the snoozes Calendar amp Tools 55 Snooze Times to select the number of times for the snooze to repeat 4 Press SAVE left softkey Tip Press ON or OFF left softkey to toggle the alarm on and off Bluetooth Bluetooth is a short range communications technology that allows you to connect wirelessly to a number of Bluetooth devices such as headsets and hands free car kits and Bluetooth enabled handhelds computers printers and wireless phones The Bluetooth communication range is usually approximately 30 feet Turn Bluetooth On and Off By default your phone s Bluetooth feature is turned off Turning Bluetooth on enables your phone s Bluetooth functions 1 Press g gt Bluetooth gt On Off 2 Press ON left softkey to enable Bluetooth Press OFF left softkey to disable Bluetooth Note Turn off Bluetooth when not in use to conserve battery power or in
82. only or Repeated Tone once every minute Emergency Alerts Your phone is compatible with federally supervised cell phone alert services which send out broadcast SMS messages for public warning 1 In standby mode press MESSAGING left softkey gt OPTIONS right softkey gt Emergency Alerts 2 Check the box next to the options you wish to select Presidential Alerts to deliver a national Presidential alert Presidential Alerts is always grayed out not selectable and cannot be excluded Imminent Threat Extreme to deliver emergency alerts in an extreme emergency situation an extraordinary threat to life or property Messaging 49 Imminent Threat Severe to deliver emergency alerts in a severe emergency situation a significant threat to life or property Amber Alerts to deliver alerts related to missing or endangered children Long Message Reassembly When you receive a long message it is divided into up to 15 messages and delivered to your phone You can choose to combine them to display as one message rather than segmented ones 1 In standby mode press MESSAGING left softkey gt OPTIONS right softkey gt Long Message Re assembly 2 Select On or Off Simple Data Exchange This feature makes it easy to select certain information in a message and automatically save it or use it in a related application Simple Data Exchange works with these types of information e Email addresses e Phone num
83. play and press To close a window gt Highlight in the top right corner for the page you want to close and press x To go back a page gt Highlight and press E To go forward a page Web and Data 88 gt Highlight and press g To reload a page gt Highlight and press g Open the Browser Options gt From any open Web page press Options right softkey Options available within the browser menu include to change the display font size on the Web page Search the web to launch a Web search e Add this page to bookmarks to store the address of the currently viewed Web page e View all bookmarks to display a bookmark list e View browsing history to display a list of the Web pages visited e Send this page to a friend to send a URL of the currently viewed Web page e Overview Mode to display the entire Web page e Browser settings Startup page to change the default launch page Automatic Overview Mode to change the default view to overview mode Default zoom size to select the zoom value Do not show images Show images to display or hide the images on the Web page Icon row to display or hide the area showing icons Popups to allow or block pop ups Clear private data to delete the cookies cache history or stored passwords Advanced e Page information to display information about the currently viewed page Web and Data 89 Web and Data Browser information to display information abou
84. pleted When connected the host computer will automatically detect your phone To remove the connection Calendar amp Tools 64 gt When you have finished transferring data click the USB device icon in your computer s notification area and follow the onscreen instructions to safely unplug the USB cable The process may vary depending on your computer Press EXIT left softkey gt YES left softkey Important Connection Information e To avoid loss of data DO NOT remove the USB cable the microSD card or the battery while files are being accessed or transferred e DO NOT use your computer to change or edit folder or file names on the microSD card and do not attempt to transfer large amounts of data from the computer to the microSD card Doing so may cause the microSD card to fail e DO NOT turn off or restart your computer or put it into standby mode while using a mass storage device Doing so will result in loss or damage of data e While you are connected to the computer your phone s screen will display the airplane mode icon gt You cannot make or receive calls e If you connect a mass storage device to a peripheral device your device may not work properly Voice Services Your phone s voice services let you place calls using your voice store voice reminders and record memos right on your phone This section includes easy to follow instructions for using voice activated features and managing voice me
85. r phone is saving a picture or video to the phone memory Saving to Memory Card Your phone is saving a picture or video to the memory card Gh Camera Flash On This Shot The camera flash is enabled only for the current shot Camera Flash Always On or Video Light On The camera flash is always enabled in camera mode or the video light is on in camcorder mode Gh Automatic Camera Flash The camera flash will be enabled when needed Display Your Phone Number You can display your phone number and other information about your phone and account gt Press go gt Settings gt Phone Info gt Phone Phone Basics 14 Text Entry Select a Text Input Mode Your phone provides convenient ways to enter letters numbers and symbols whenever you are prompted to enter text 1 From a screen where you can enter text press OPTIONS right softkey to change the text mode If you are in the message entry screen press OPTIONS right softkey gt Text Mode 2 Select one of the following options Abc to enter characters by using the alphabet mode See ABC Mode XT9Word to enter text using a predictive text system See XT9 Smart Input 123 to enter numeric characters Symbols to enter symbols Smileys to enter smile icons Emoticons to enter emoticons This is available for example when composing a message or when editing a Schedule or To Do description in Calendar Paste List to paste copied or cut text if
86. s Add a To Do List Item to the Calendar Your phone can store and manage up to 40 To Do list items 1 Press g gt Calendar 2 Highlight a day to which you would like to add a To Do list item and press OPTIONS right softkey 3 Press the navigation key right and select Add To Do 4 Enter a description and press g 5 Highlight a setting and press x Category to select a category of the item Priority to select a priority of the item Due Time Date to set a time and date of the item Status to select the status of the item Select Needs Action for a new item and select Completed for a completed item 6 Press SAVE left softkey Calendar Event Alerts When your phone is turned on and you have an event alarm scheduled your phone alerts yOu There are several ways your phone alerts you to scheduled events e By playing the assigned ringtone or vibration type e By showing the event icon EF on the status bar e By showing the Alert pop up screen Calendar amp Tools 53 Event Reminders If you have set at least one reminder for an event the upcoming event icon E will appear in the notifications area of the status bar to remind you of the upcoming event To view dismiss or snooze the reminder gt Select View to display the event detail screen gt Select Snooze or press SNOOZE left softkey after selecting View to stop the alarm and start snooze mode if applicable gt Press DISMISS right sof
87. s from a Group Entry You can remove group members from existing groups Contacts 39 1 In standby mode press CONTACTS right softkey 2 Highlight the group you want to remove members from and press OPTIONS right softkey gt Edit Group 3 Highlight a member and press OPTIONS right softkey gt Remove from Group gt YES left softkey 4 Repeat step 3 to remove additional members 5 Press SAVE left softkey Find Contacts Entries Find an Entry from Contacts You can quickly access the stored information in your Contacts 1 In standby mode press CONTACTS right softkey 2 Scroll through all the entries or Enter the first few letters of any part of an entry s name Contacts with matching letters are listed The more letters you enter the more your search narrows 3 Highlight an entry and press Sex to dial the number displayed Press the navigation key left or right to display other listed numbers Highlight an entry and press go to display the details Find an Entry Using the Phone Keypad You can search Contacts entries for the numbers that contain a specific string of numbers 1 Enter four or more digits of the number in standby mode The more numbers you enter the more specific the search becomes 2 All Contacts entries matching the entered numbers will be displayed 3 Highlight an entry and press Ea to dial the number Contacts 40 Highlight an entry and press g to display fur
88. s o gt Tools gt World Clock 2 Press the navigation key left or right to scroll through different time zones Note Press OPTIONS right softkey gt Standard or Summer to change between daylight saving time and standard time Notepad Your phone offers a simple notepad to allow you store your notes Write a Note 1 Press g gt Tools gt Notepad gt Add New 2 Enter a note and press OK left softkey to save it Press OPTIONS right softkey to access various text options See Select a Text Input Mode View a Note 1 Press x gt Tools gt Notepad 2 Highlight a note and press p Edit a Note 1 Press amp gt Tools gt Notepad 2 Highlight the note you want to edit and press EDIT left softkey 3 Edit the note and press OK left softkey Delete Notes 1 Press o gt Tools gt Notepad 2 Highlight the note you want to delete and press DELETE right softkey Calendar amp Tools 73 3 Select an option This to delete the highlighted note All to delete all notes on the list 4 Press YES left softkey Flashlight Your phone is equipped with a powerful LED flashlight Warning Do not shine the LED flashlight into anyone s eyes as doing so may compromise their vision and cause an accident To turn the LED flashlight on or off 1 Press o gt Tools gt Flashlight 2 Select On or Off Note You cannot use the LED flashlight in certain situations such as where the battery is very low
89. save your pictures and videos 1 Press g gt Photos amp Videos gt Other Settings gt Auto Save to 2 Select In Phone On Memory Card or Switch w Card Switch w Card stores pictures and videos to the memory card when the card is installed In Phone Folder Your phone s internal storage area is called the In Phone folder From the In Phone folder you can view all the pictures and videos you have stored there delete files and access additional options To review your stored pictures and videos in the In Phone folder gt Press gt Photos amp Videos gt My Photos amp Videos gt In Phone Camera 82 On Memory Card Folder You can save pictures and videos directly to the memory card using your phone s photo and video settings To review your stored pictures and videos on the memory card gt Press amp gt Photos amp Videos gt My Photos amp Videos gt On Memory Card In Phone and Memory Card Folder Options When you are viewing the In Phone or On Memory Card folder press SEND left softkey to send your pictures and videos see Send Pictures and Videos or OPTIONS right softkey to display the following options e Select Multiple to select multiple pictures and videos e Slideshow to view your pictures in slideshow mode only available when you save two or more pictures to the folder e Assign to assign the picture or video Select an option and press p e Delete to delete pictures and vid
90. ss ey Enhanced 9 1 1 E911 Information This phone features an embedded Global Positioning System GPS chip necessary for utilizing E911 emergency location services where available When you place an emergency 9 1 1 call the GPS feature of your phone seeks information to calculate your approximate location Depending on several variables including availability and access to satellite signals it may take up to 30 seconds or more to determine and report your approximate location Important Always report your location to the 9 1 1 operator when placing an emergency call Some designated emergency call takers Known as Public Safety Answering Points PSAPs may not be equipped to receive GPS location information from your phone Receive Phone Calls You can select the most convenient way to respond to a call Your phone notifies you of incoming calls in the following ways e The phone rings or vibrates e The LED indicator flashes e The backlight illuminates e The screen displays an incoming call message If the incoming call is from a number stored in your Contacts the entry s name is displayed The caller s phone number may also be displayed if available Phone Calls amp Settings 22 Note If your phone is turned off all calls automatically go to voicemail Note Your phone will answer an incoming call by opening the phone by default To change the setting see Call Answer Mode Answer an Incoming Call with the Phone
91. t Push Profile e PBAP Phone Book Access Profile Bluetooth Menu The Bluetooth menu allows you to set up many of the characteristics of your phone s Bluetooth feature including e Setting your phone s visibility or discoverability for other Bluetooth devices e Adding a new Bluetooth device to your phone e Displaying your Bluetooth trusted devices list e Displaying your phone s Bluetooth information To access the Bluetooth menu gt Press go gt Bluetooth to select from following options Calendar amp Tools 57 Select On Off to enable or disable Bluetooth Select Visibility gt Hidden Visible for 3 min or Always visible to set your Bluetooth visibility Select Add New to add a new Bluetooth device Select Trusted Devices to display a list of trusted Bluetooth devices Select My Bluetooth Info to display your phone s Bluetooth name address class and supported profiles Pair Bluetooth Devices The Bluetooth pairing process allows you to establish trusted connections between your phone and another Bluetooth device When devices are paired a passkey PIN is shared between devices allowing for fast secure connections while bypassing the discovery and authentication process j Press o gt Bluetooth gt Add New Select the device you wish to pair with and press p 3 Enter the passkey and press g JS Optional Edit the device name and press SAVE left softkey Note
92. t affect all screens Note The first time you access this setting you will see a message saying Font Size setting doesn t affect all screens Press OK left softkey to proceed 1 Press go gt Settings gt Display gt Font Size Press x gt Settings gt Others gt Accessibility gt Font Size 2 Highlight a font size You can see the current and new font sizes in the display window above the menu 3 If you are satisfied with the font size press SAVE left softkey Settings 91 gt In standby mode press o to display the main menu and then press OPTIONS right softkey gt Large Font or Normal Font Change the Backlight Settings Select how long the display screen remains backlit after any keypress is made To change the main screen backlight setting 1 Press o gt Settings gt Display gt Backlight 2 Select Backlight Dim or Backlight Off If you select Backlight Dim select Always Bright Always Dim or a preset length of time to elapse before the screen backlight dims If you select Backlight Off select a preset length of time to elapse before the screen and keypad backlights turn off When you select Always Bright for the Backlight Dim setting in step 2 the keypad backlight will turn off after about one minute Note Long backlight settings reduce the battery s talk and standby times Set the Notification Pop up This option allows you to enable or disable notification pop up when you rece
93. t softkey gt OPTIONS right softkey gt Signature 2 Select On If you do not wish to attach a signature to your outgoing messages select Off 3 Enter a signature and press OK left softkey Manage Preset Messages Your phone is loaded with 20 preset messages to help make sending messages easier Customize or delete these messages such as Where are you Let s get lunch and Meet me at to suit your needs or add your own messages to the list Messaging 48 To edit or delete a preset message 1 In standby mode press MESSAGING left softkey gt OPTIONS right softkey gt Preset Messages The list of preset messages will be displayed 2 To edit or delete a message highlight it and press OPTIONS right softkey 3 Select Edit edit the message and press OK left softkey Select Delete gt YES left softkey to delete the message You can also reset all messages by selecting Reset all messages gt YES left softkey To change the language of the preset message 1 In standby mode press MESSAGING left softkey gt OPTIONS right softkey gt Preset Messages 2 Press OPTIONS right softkey gt Select Language 3 Select English or Spanish Message Alerts You can set how often your phone alerts you when there is a new message notification 1 In standby mode press MESSAGING left softkey gt OPTIONS right softkey gt Repeated Tone gt Messages 2 Select Single Tone once
94. t the browser Disable JavaScript Enable JavaScript to disable or enable Java scripting Disable error log Enable error log to set whether to save error logs text files useful for debugging browser errors To display the error log select the View error log option from the submenu available only when the error log is enabled Do not send referrer header Send referrer header to set whether to send HTTP URL referrer information Turn off redirect prompt Turn on redirect prompt to set whether to display a prompt when your data is being redirected Root certificate to display the certifications Disable Virtual Mouse Enable Virtual Mouse to activate or deactivate the virtual mouse Virtual Mouse to set the speed of the virtual mouse Reset browser to reset all browser settings 90 Settings Display Settings Adjusting your phone s display settings not only helps you see what you want they can also help increase battery life Change the Wallpaper You can set a wallpaper to display while in standby mode 1 Press o gt Settings gt Display gt Wallpaper 2 Select a wallpaper option by pressing the navigation key up or down and select a wallpaper Change the Brightness You can adjust the brightness on the main screen 1 Press g gt Settings gt Display gt Brightness 2 Highlight a brightness level and press go twice Change the Font Size Adjust the font size for the main screen This setting does no
95. tatus Using ASR for details Use ASR in a quiet environment so it can accurately recognize your commands During ASR operation press TUTORIAL left softkey or HELP right left softkey to get instructions for using the software Make a Voice Call Using ASR 1 2 3 4 Tip Note Press and hold Ke Ea or the external speaker button When you hear Say a command say Call When you hear Say the name or number say a name or a phone number When you hear Which location say a number type for example Mobile You can skip steps 3 and 4 by saying a name and location after Call without pausing for example Call John Jones mobile If ASR does not recognize the name or number it will find the most likely matches and display a list of up to three names or numbers You will hear Did you say Call followed by the name or number You can confirm by saying Yes Say No to change the selection Calendar amp Tools 66 Send a Message Using ASR 1 Press and hold Ke Ea or the external speaker button When you hear Say a command say Send Message When you hear Say the name or number say a name or a phone number When you hear Which location say a number type for example Mobile The phone displays the text entry screen See Messaging for how to compose a message Display a Contacts Entry s Information Using ASR 1
96. te Type for Incoming Calls and Messages 1 Press go gt Settings gt Others gt Accessibility gt Vibrate Type gt Incoming Calls or Messages 2 Select Contacts Unsaved Numbers or Private Unknown If you select Contacts select All Contacts or select One Contact and then select an entry 3 Select a vibrate type option by pressing the navigation key up or down and then select a vibrate type Tip Vibrate Type can be assigned from the Contacts menu See Assign a Vibrate Type to a Contact Tip In standby mode press and hold mE J to set your incoming call to Vibrate All Select Vibrate Type for Voicemail and Alarm Calendar 1 Press go gt Settings gt Others gt Accessibility gt Vibrate Type 2 Select Voicemail or Alarm Calendar 3 Select a vibrate type option by pressing the navigation key up or down and then select a vibrate type Hearing Aid Device Compatibility Your phone has been tested and rated for hearing aid device compatibility To use this function effectively set the hearing aid option to On 1 Press x gt Settings gt Others gt Accessibility gt Hearing Aid 2 Read the disclaimer and press OK left softkey 3 Select On or Off On to use a hearing aid device with your phone Off to use your phone without a hearing aid device Settings 103 Screen Contrast You can make your screen easier to read with a high contrast color scheme 1 Press o gt Settings gt Others
97. the sound through the headset only Language Settings You can choose to display your phone s onscreen menus in English or in Spanish 1 Press amp gt Settings gt Others gt Language 2 Select English or Espanol Location Settings Before using any of the location based services you must turn on your phone s location mode Enable Location Services 1 Press o gt Settings gt Others gt Location gt On Off You will see the Location disclaimer 2 Read the disclaimer and press OK left softkey 3 Select On When the Location feature is on your phone s standby screen will display the icon When Location is turned off your phone will display the icon Note Turning Location on will allow the network to detect your position using GPS technology making some applications and services easier to use Turning Location off will disable the GPS location function for all purposes except 9 1 1 but will not hide your general location based on the cell site serving your call No application Settings 107 or service may use your location without your request or permission GPS enhanced 9 1 1 is not available in all areas Roaming Roaming is the ability to make or receive calls and access data services when you re off the home network Roaming on Other Networks When you re roaming on other networks your call quality and security will be similar to the quality you receive when making calls on the home networ
98. ther options available Use Contacts Information in Other Applications You can use saved Contacts information in other applications To copy information into a message 1 In standby mode press CONTACTS right softkey 2 Highlight an entry and press G 3 Highlight the information you want to copy such as phone numbers email addresses or URL and press g 4 Select Share 5 Select Message After you select one or more recipients the text entry screen for the type of message specified will open and the selected text will appear in the body of the message Note For more information about messaging see Messaging Assign Speed Dial Numbers Your phone can store up to 98 phone numbers in speed dial locations See Call Using a Speed Dial Number 1 Add a number to a new or to an existing Contacts entry See Add a Number to a Personal Entry if the number is not in your Contacts In standby mode press CONTACTS right softkey highlight an entry and press 2 Highlight the number and press OPTIONS right softkey gt Set Speed Dial 3 Highlight an available speed dial location and press g 4 Press to return to the Contacts menu Tip To replace a current assignment select a location and press REPLACE left softkey To check speed dial assignments Contacts 41 1 In standby mode press CONTACTS right softkey 2 Press OPTIONS right softkey gt Settings gt Speed Numbers ICE In Case of Emerge
99. thumbnail view to expand view mode highlight a picture or video and press p Other Settings There are few other options which you can set for camera 1 Press g gt Photos amp Videos gt Other Settings 2 Highlight an option and press Auto Save to to specify where to save your pictures and videos e In Phone to store pictures and videos in your phone s memory e On Memory Card to store pictures and videos on the memory card e Switch w Card to store pictures and videos to the memory card when the card is installed Location to choose whether to insert location info when you take a picture Slideshow Interval to select the time each picture will stay on screen in a slideshow Help to display more information on cameras Camera 84 Send Pictures and Videos Once you have taken a picture or a video you can use the messaging or Bluetooth capabilities of your phone to instantly share it with family and friends as an attachment 1 Press o gt Photos amp Videos gt My Photos amp Videos gt In Phone or On Memory Card Select your pictures or videos to send Press OPTIONS right softkey gt Select Multiple to select multiple pictures or videos Press SEND left softkey and select the recipient from the list or from the following options Go to Contacts to select a recipient from your Contacts Qualifying Contacts entries must contain a wireless phone number or an email address
100. tkey to clear the alarm if applicable To set reminder settings gt On any Calendar view press OPTIONS right softkey gt Settings gt Alarm and set the items View Calendar Events Display the scheduled events on your Calendar Tip Days with scheduled events are indicated by small colored rectangles just below the date A rectangle s color depends on the repeat status for an event 1 Press gt Calendar 2 Highlight the day for which you would like to view events and press p The day s event list is displayed Press OPTIONS right softkey gt Schedule List or To Do List 3 Highlight an event and press E The event s details are displayed You can edit the event on this screen Delete Calendar Events 1 Press o gt Calendar 2 Highlight the day from which you would like to delete an event and press p Calendar amp Tools 54 Press OPTIONS right softkey gt Schedule List or To Do List 3 Highlight an event and press OPTIONS right softkey gt Delete 4 Highlight an option and press This to delete the highlighted event Select to delete multiple events All on This List to delete all events on the list All Completed Events to delete completed To Do List items 5 Press YES left softkey To delete old events or all events gt Press o gt Tools gt Calendar gt OPTIONS right softkey gt Delete Memory gt Delete Old or Delete All gt YES left softkey Alarm Your phone c
101. tooth feature is enabled Phone Basics 12 Connected via HFP Your phone is connected to or communicating with a Bluetooth device via Hands free Profile HFP Connected via A2DP Your phone is connected to or communicating with a Bluetooth device via Advanced Audio Distribution Profile A2DP Note The above icons will blink while your phone is communicating with a Bluetooth device Camera Icons A Beach Snow Mode The picture video mode is set to Beach Snow OR Scenery Mode The picture video mode is set to Scenery Image ronyons me peue nees enavo g Self Timer 5 Seconds The self timer is set to 5 seconds g Self Timer 10 Seconds The self timer is set to 10 seconds rutin sts me nuno sistant Camera Resolution 5 0M The camera is set to 5 0 megapixel resolution 2560x1920 Camera Resolution 3 2M The camera is set to 3 2 megapixel resolution 2048x1536 Camera Resolution 2 0M The camera is set to 2 0 megapixel resolution 1600x1200 Camera Resolution 1 3M The camera is set to 1 3 megapixel resolution 1280x960 Camera Resolution 0 3M The camera is set to 0 3 megapixel resolution 640x480 Camera Resolution 0 1M The camera is set to 0 1 megapixel resolution 320x240 Video Resolution QVGA The video resolution is set to QVGA Que 320x240 Phone Basics 153 Video Resolution QCIF The video resolution is set to QCIF Qeltr 176x144 Saving to Phone You
102. tteries and chargers with your phone The failure to use a USCC approved or Kyocera approved battery and charger may increase the risk that your phone will overheat catch fire or explode resulting in serious bodily injury death or property damage Battery Capacity Your phone is equipped with a Lithium Ion Li Ion battery It allows you to recharge your battery before it is fully drained For a quick check of your battery level glance at the battery charge indicator located in the upper right corner of your phone s display screen When there are approximately five minutes of talk time left the battery icon turns red and the phone sounds a warning tone After an additional five minutes or so the phone sounds a warning tone three times and then turns off Note Long backlight settings searching for service vibrate mode browser use and other variables may reduce the battery s talk and standby times Tip Watch your phone s battery level indicator and charge the battery before it runs out of power Phone Basics 1 Install the Battery 1 Note Using a coin rotate the battery cover screw in a counter clockwise direction as far as it goes The battery cover screw is permanently mounted on the cover and cannot be removed Insert your fingernail into the slot at the bottom of the battery cover and lift the cover off gently Insert the battery into the battery compartment making sure the connectors a
103. ueareeneeueareeneeuearsuseeusarsenesues 19 all TROP ISON Y eane EEN REEE E EEE EEE EEA 19 Cal OM CON ICS sects espe nener EEEE ate eee ane ps nea ec ose eae eae ese 19 Call Using the Plus Code ssesessssssssnunnsnnnnnnnnunnnnunnnnunnnnnnnnnnnnnnnnnnnnnunnnnnnnnnnnnnnnnns 20 Call sind a speed Dial NUMDET t2 cnsinnwsanssenna peas veu nanan Ea 20 Call a Phone Number with PauSeS sssssssssssssnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnenennne 20 Call a Phone Number in a M SS GC cecsscseoncsecensecrsneneeseeceneearsuenecanssenseeatsneueseness 21 TOC Call Emergency Numbers stacisctacscatiassientacaai enn stannavier aipere titer viatseiaer alae nimaree 21 RECEIVE PHONG Calls mia seccniancncthesdumeriiacensiedsdancmrtatenatuntucun arene tadadeeotevataredice AE 22 Ena PHONE CANS wascevsc cites senoete cat iis A e Ee 24 Missed Call NOUNCIA essin AE EAEE EEEE 25 VOCOMA Ilie E E eines venous cana E EE E ERA EE E EE EE E EEER 25 SE UP VOICEMA en siser nans E S A S 25 Volema NONICAUO sssrini rer rrenean nAra EE E ATEO IONER 25 New Voicemail Message Alerts nsesssssenennuensnnnununnennnnnurnnnsnnnsrunnensnnnununnennnnnunnenennnni 26 Retrieve Your Voicemail Messages sessessssnesurnsnsnnnernrnsnnnnrunnensnnnsrunnennnnnuruenennani 26 PRONS Call ODORS carener a a a a a a a veumeuauoess 27 Ez E a e E A E T E A A E A E A AE T E E 27 CEAN T a E voeeue woetenseseanticuneraiae 27 De Ay COMIC aie eceaiesaneaeig andes panreisim
104. ve phone numbers with pauses 1 Enter all or part of a number 2 Press OPTIONS right softkey gt Hard Pause or 2 Sec Pause 3 Enter additional numbers 4 Press Sex to dial the number Press OPTIONS right softkey gt Save You can save to a new or existing Contacts entry Note When dialing a number with a hard pause press SEND TONES left softkey to send the next set of numbers Call a Phone Number in a Message You can place a call to a number that appears in a message 1 In standby mode press MESSAGING left softkey gt Messages 2 Select a message with the number you want to call and highlight the number 3 Press Ka For more information on utilizing the information in a message see Simple Data Exchange Call Emergency Numbers You can place calls to 9 1 1 even if your phone is locked or your account is restricted gt Press EP m m E Note After you have placed an emergency call your phone automatically enters Emergency mode During an emergency call press OPTIONS right softkey to display your options Highlight an option and press G Phone Calls amp Settings 21 e Transfer Audio to switch the call to an external device if applicable e Contacts to show the Contacts list e Phone Info to display information about your phone Tip Press MY PHONE left softkey to display your phone number during an emergency call To exit emergency mode 1 Press ees to end a 911 call 2 Pre
105. vratentiaiaria event yer acaeseehesbcatiaaninst ives vanyei seein ovaed woliaaereyiiveniianesteln a avaetesieaseeeis 91 DISBIAY SCT S arrecani aa dean acu ieaseantaceauaetvevseradinn tune tiwkenies 91 Cian Ge the Wall DAD Cl eerren a 91 Change tme BrOMENCSS saisusscicievinneusanapartrayianvsisemnriseeniassakeeiusetaoraesenmanieoroienat 91 Change tho FONU SIZO veranear trenita learn tate Gas E EEEREN TEE AET 91 Change the Backlight Settings c ccsseccsscsssscsecensccrsneneceseeceneearsueueseseneeseearsneueseness 92 Set the Notification POp UpD s sssssnunsnnunnnnannnnnnnnnnnnnnnnnnnnnunnnnunnnnannnnunnnnnnnnunnnnnnnnnnnnne 92 Select a Picie IDin E EAT 92 Power save MOU oraire 93 Cnange the Clock Calendar DISDIAY ssrrenereriea aea a 93 change tme Greeting iniri a a a 93 Change the Phone s Menu Style ssssesessensnsnenuennnsnnnunnensnnnununnennnnnununnennnnnernenennnnnunn 93 Voume SENOS aariin 94 Adjust the PHONES Volume SettingS s ssesenssssnsnunsnnsnrnnrnnnrrnnennrnrnnnennnnrnenenennrnenene 94 MENCE Al rian a a 94 RINGONE SEHIN esaia E R E i 94 FS CY tse cancer tata EO nc EAE TEE OAE OEE EEEE EEEE 95 TOCE MY aaor E E A RAEE 96 PIA Ine INO MAON Ea EEEE E E AE ER 96 SCCUR SE ULINIG S enia a E seawtectneoae tects 97 LOCK YOUN PRONG seonicosiiercss teat ccueeaacediasasncusuinsenset 97 LIMIT USE eer E E E O EE E E E 98 Delete PHON COMNEN oia E a A 99 Reset Your Phone and Phone Content sssssnsssnansnsnrnnnnnsnnnn
106. w many members it has Contacts Details You can see details about each of your Contacts by accessing the Contacts list screen 1 In standby mode press CONTACTS right softkey 2 Highlight an entry and press o to show the details Tip Highlight any data field and press g on the details screen Menu options for that field will appear if available View History from Contacts You can view the history of a selected Contacts entry from the Contacts list 1 In standby mode press CONTACTS right softkey 2 Highlight an entry and press OPTIONS right softkey gt Contact History Contacts 35 Create a New Contacts Entry Create a Personal Entry Create personal Contacts entries which also will be the basis of group entries 1 In standby mode press CONTACTS right softkey gt Add New gt New Contact 2 Enter a name for the new entry and press the navigation key down 3 Enter the phone number and press g 4 Highlight a number type for the entry Mobile Home Work Pager Fax or Other and press g 5 Press DONE left softkey After you have saved the number the new Contacts entry is displayed Create a Group Entry You can create a group by assigning personal Contacts entries as members and then naming the new group Each group entry can contain up to 40 members 1 In standby mode press CONTACTS right softkey gt Add New gt New Group 2 Read the message and press START left softkey 3 Highlig
107. y 39 Index 112 Find 40 ICE contacts 42 List 35 Make a Call From 19 Secret Entries 43 Use Information in Other Applications 41 View History From 35 Countdown Timer 72 Data Services 86 Browser 87 Data Profile 106 Disable 106 Enable 105 Launch 86 Status and Indicators 86 Web Navigation 87 Data Settings 105 Delete Calendar Events 54 Contacts Entry 37 History 34 Phone Content 99 Display Settings 91 Emergency Alerts 49 Emergency Call 21 End Call 24 Enter Text ABC Mode 16 Text Entry Options 17 Text Input Mode 15 XT9 Smart Input 15 File Manager 63 Find Contacts Entry 40 Font Size 91 Forward a Call 28 GPS Satellites 107 Greeting 93 Index 113 Headset 107 Hearing Aid Device Compatibility HAC Mode 103 History 31 Delete 34 Details 32 Icons 31 List 31 Make a Call From 19 32 Make a New Group Entry From 33 Options 32 Save a Number From 33 Save the Information in 33 Thread 31 ICE In Case of Emergency Contacts 42 Emergency message 42 43 Personal information 43 Icon Indication 11 31 56 86 108 Key Functions 8 Keyguard 95 Language Preset Messages 49 Settings 107 Limit Use 98 Location Settings 107 Lock Code 97 Lock Your Phone 97 Make a Call 19 From Contacts 19 From History 19 32 To a Number in a Message 21 50 To Emergency Numbers 21 Using ASR 66 Using Speed Dial 20 Using the Phone Keypad 19 Using the Plus Code 20 With Pauses
108. y incoming calls and messages You can assign ringtones to individual Contacts entries types of calls and messages Select Ringtones for Incoming Calls and Messages 1 Press x gt Settings gt Ringtones gt Incoming Calls or Messages Settings 94 2 Select Contacts Unsaved Numbers or Private Unknown If you select Contacts select All Contacts or select One Contact and then select an entry 3 Select a ringtone option by pressing the navigation key up or down and then select a ringtone Tip Ringtones can be assigned from the Contacts menu See Assign a Ringtone to a Personal Entry Select Ringtones for Voicemail Calendar and Power Up Down 1 Press o gt Settings gt Ringtones 2 Select Voicemail Calendar or Power Up Down 3 Select a ringtone option by pressing the navigation key up or down and then select a ringtone Keyguard This feature enables you to lock the side buttons while the phone is closed To set the keyguard timer 1 Press g gt Settings gt Keyguard gt Keyguard Timer 2 Highlight an option Always Off 8 Seconds 15 Seconds or 30 Seconds and press x To set the unlock key settings 1 Press go gt Settings gt Keyguard gt Unlock Key Settings 2 Choose from following options Long Press to temporarily disable the keyguard by pressing and holding the external speaker button while the phone is closed Press Twice to temporarily disable the keyguard by pressing
109. ymbols are used Your phone is connected to the data network When the triangles are animated your phone is transferring data for example when you are av av opening a Web page when the triangles are solid gray your phone is connected to the network but is not currently transferring data for example when you are viewing a Web page that is completely open In either state you can receive incoming calls Your phone is outside of the data network service area Your phone is connected to the 3G data service Your phone is connected to the 1X data service Oa Your phone is connected to the GSM network Web and Data 86 Browser Your phone s Web browser gives you access to websites on the go using data connections Learn to Navigate the Web Navigating through menus and websites during a data session is easy once you ve learned a few basics Softkeys During a data session the bottom line of your phone s display screen contains one or more softkeys These keys are shortcut controls for navigating around the Web and they correspond to the softkeys directly below the phone s display screen Tip Depending on which websites you visit the labels on the softkeys may change to indicate their function To use softkeys Pm Press a softkey If an additional pop up menu is displayed when you press the softkey select the menu items using your keypad if they re numbered or by highlighting the option and pressing p
110. you to calculate tip and split the bill 1 Press g gt Tools gt Tip Calculator 2 Enter the total bill into the Bill field 3 Type the tip amount in percent you would like to leave into the Tip field 4 If the bill is shared by more than one person enter the number of the people into the Paying field The phone will display a table showing the tip total bill and each pay Countdown Timer This feature allows you to use your phone as a countdown timer to alert you when a specified period of time has elapsed You can set up to five timers 1 Press go gt Tools gt Countdown 2 Highlight a countdown timer number and press p 3 Highlight a setting and press x Time to enter the length of the countdown Alarm to set the countdown alarm to on or off 4 Press SAVE left softkey Tip Press ON or OFF left softkey to toggle the countdown alarm on and off Stopwatch You can record split times or lap times with the built in stopwatch 1 Press o gt Tools gt Stopwatch 2 Press MODE left softkey to select split timing or lap timing 3 Press START right softkey to start the stopwatch 4 Press SPLIT or LAP left softkey to record the time 5 Press STOP right softkey to stop timing Calendar amp Tools 72 6 Press RESET left softkey to reset the stopwatch to zero World Clock You can view the local time in various cities around the world To view the time in different locations 1 Pres

Download Pdf Manuals

image

Related Search

Related Contents

Bedienungsanleitung Design Wireless LAN Internet-Radio  Kenwood eXcelon XR-5S User's Manual  FRONIUS IG 300, FRONIUS IG 400, FRONIUS IG 500  Jura ENA 3  

Copyright © All rights reserved.
Failed to retrieve file