Home
Preface
Contents
1. 25 Resetting the Default CMOS Values 26 L Tin DIO eea 21 Standard CMOS SCM cerir iiron areni 28 Advanced Setup 30 Advanced Chipset Setup 32 Integrated Peripherals eenean 33 Power Management Setup 34 PCI PNP Configuration 35 PC Heat SUS i u y wa maqusamupusopiukastususaykupassqhauusak6un 36 M I B MB Intelligent BIOS 38 Load BLA nti Setti ny uu c 40 Supervisor PF OSSWOTE ascrinininaiei ii 40 User P aWW0WI MP rm 41 SAVE xk P Vf S CUD MM 41 Exit Without Saving 41 Updaling the BIOS u a aaasaaawaqawaakhuyaapaaac kieaqaqaq 42 Chapter 4 43 Using the Motherboard Software 43 About the Software DVD ROM CD ROM 43 Auto installing under Windows XP Vt sta 7 43 Puro SOLID c HER 44 Manual Installation 46 Utility Software Referenc UU u ruere etus 46 Chapter 5 47 ATI CrossFireX Technology Support 47 ISEQUIPEPHCTIS oce N E A T E GU En ene 47 Installing a single graphics card
2. 47 Installing CrossFireX graphics cards 48 The Catalyst M Control Center Dialog Box 50 J iss mn u ss 50 To Enable CrossFiveXM nennen 50 Chapter 6 51 Intel Matrix Storage Manager RAID Configurations 51 Before creating a RAID set 5l Entering Intel Matrix Storage Manager RAID BIOS utility 52 Creating a RAID set 53 Deleting a RAID set 55 Resetting disks to Non RAID 56 li SU sees esesicse cana sec E cues sapaasaatnes ences dananecueae 56 Chapter 7 57 Setting Up eJIFFY 57 lili GUC 1 L uuu A E Mdb rai Sina 57 Installation and BIOS Setup 58 Fil iii roJ GIXIgIOOCXIGWI C lt z G u u unun usu anus 61 Features Ieomsu uuu tueri a remp PD FUU eu QQ 62 8 uo T me 63 Chapter 8 67 Trouble Shooting 67 Start up problems during assembly 67 Start up problems after prolong use 68 Maintenance and care tips 68 Basic Troubleshooti
3. Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Optimized Defaults CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc Smart Fan Function SMART Fan Control SMART Fan start PWM value SMART Fan start Offset CPU DeltaT Fan1 Slope PWM value 1 Unit Fan1 Full Speed Offset SMART Fan2 Control Enabled Help Item 28 30 Options 3 I 5 Disabled 10 Enabled Disabled ESC Exit l Move Enter Select Value F10 Save F1 General Help F9 Optimized Defaults Press lt Esc gt to return to the PC Health Status page System Component Characteristics These items display the monitoring of the overall inboard hardware health events such as System amp CPU temperature CPU amp DIMM voltage CPU amp system fan speed etc System Temperature CPU FAN Speed SYS FAN Speed CPU Core VDIMM Offset to TCC Activation Temp Press lt Esc gt to return to the main menu setting page Using BIOS 38 M I B MB Intelligent BIOS This page enables you to set the clock speed and system bus for your system The clock speed and system bus are determined by the kind of processor you have in stalled in your system CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc M I B MB Intelligent BIOS Manufacturer Intel Help item Ratio Actual Value 8 CPU Frequency Setting 333MHz Options Over clocking Function Disab
4. 14 Expansion Slots Installing Add on Cards The slots on this motherboard are designed to hold expansion cards and connect them to the system bus Expansion slots are a means of adding or enhancing the motherboard s features and capabilities With these efficient facilities you can increase the motherboard s capabilities by adding hardware that performs tasks that are not part of the basic system PCIE1 3 Slots Ur ka E Ji x 43 a g J CN D em aan aan ee i ki F EL F 2 3 Lg a 1 ga ome in t AE mi P4ST A z E B M k Ea 5r TEL E F LEE m E Fri K d E r a n PCIE16X 1 2 Slots d A pi j PCI2 3 Slots PCIE16X 1 2 Slots PCIE1 3 Slots PCI2 3 Slots FE e S ity d The PCI Express x16 slots are used to install the external PCI Express graphics cards that are fully compliant to the PCI Express Base Specification Revision 2 0 For CrossFireX information please refer to Chapter 5 The PCI Express x1 slots are fully compliant to the PCI Express Base Specification Revision 1 1 This motherboard is equipped with two standard PCI slots PCI stands for Peripheral Component Interconnect and is a bus standard for expansion cards which for the most part is a supplement of the older ISA bus standard The PCI slots on this board are PCI v2 3 compliant Before installing an add on card check the documentation for the card carefully If the card is not Plug and Play you
5. 50 The Catalyst Control Center Dialog Box View The Catalyst Control Center provides two views one is Standard view for begin ners the other is Advance view for advanced users to access and configure the complete features of the software To enable CrossFireX Set the view to Advance Click the CrossFireX item in Graphics Settings In the CrossFireX Setting dialog tick the box opposite Enable CrossFireXTM Click OK to effect the setting CrossFire Graphics MI Digtal Pane DVI 4 1 ATI Radeon HD 3870 X2 DELL 3007WFP l amp amp 3D CrossFire delivers exceptional performance on a single display by SERA UC PE E a A SAA te SE Configure CrossFire fe Set to Advanced View to enable the CrossFireX function ATI CrossHreX Technology Support Jd Chapter 6 Intel MatrixStorage Manager RAIDConfigurations The Intel Matrix Storage Manager allows you to configure RAID 0 and 1 sets on the external Serial ATA hard disk drives Before creating a RAID set Prepare the following items One SATA HDD A write enabled floppy disk Microsoft Windows OS installation disk Windows XP Vista Motherboard support CD with Intel Matrix Storage Manager driver BRWN Complete the following steps before you create a RAID set 1 Install the external Serial ATA hard disk drive HDD on your system 2 Set the Onboard SATA Mode item in the BIOS to RAID See
6. ECS Gall Senes Cove Step Further to Full Your tetetsemes oes ws dM Ove your mouse pointer on rata sare NEHME toms os the text box and press ww ecsusa cony AST Berm Sin onal Mans neon control fos Ctrl Space The language ECE De mura sag ender wa dere P will then appear as fol lows wwwecustalcomi AGT Muria r Tra education pokcy to help state leaders develop educational systems wwweta org FLU ony Jakarta ECS Ejement Construction Set miguel Gerverates elements tor vanout markup languages Owecthy supperts HTML 4 0 and Mp jakarta apache orgiecefedes hemi ET Pur L L ars d eere suen e UDtersty ct sau Dapton Click the language bar here Research groups Declarative systema and software engrwenng Micro Paralel and dtrbuted computing Coemmurnicabons mage wees soton ac ul BESO Bory Done Amharic Amharic Bengali Gujarati Select your desired Hindi language Vf Japanese Korean M Malayalam Nepali Punjabi Tamil Thai Chinese simplified Chinese traditional Other amp English Keyboard Setting Up eJ IFFY 65 How to change display language Open the Language Control Panel and click to show the display language list Check your desired display language Your selected display language will be applied after rebooting FEMME Bits EM ETLTEITETS T JE SIE EET TS Check to select your language Your selection will be applied after rebooting Check Lang
7. Tue 03 25 2008 Help Item hh mm ss 00 02 19 Use Enter TAB or SHIFT TAB to select a field Not Detected Not Detected Not Detected Not Detected Not Detected Not Detected Use or to configure system Date IDE BusMaster Enabled Drive A te 1 44 MB 3 Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings Date amp Time The Date and Time items show the current date and time on the computer If you are running a Windows OS these items are automatically updated whenever you make changes to the Windo gt SATA1 ws Date and Time Properties utility This motherboard supports six SATA channels and each channel allows one SATA device to be installed Use these items to configure each device on the SATA channel CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc SATA1 Device Type LBA Large SATA1 Help Item Not Detected Selectthe type Auto of device connected Mode Auto to the system Block Multi Sector Transfer Auto PIO Mode Auto DMA Mode Auto S M A R T 32Bit Data ll Auto Transfer Enabled Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings I Finn DIS CINN p Using D J 29 Type Auto Use this item to configure the type of the IDE device that you specify If the feature is enabled it will enhance hard disk performance by
8. Use the lower PS 2 port to connect a PS 2 keyboard Use the COM port to connect serial devices such as mice or fax modems Use this port to connect to an external SATA box or a Serial ATA port multiplier Before connecting the eSATA cable make sure to turn off the power of the external enclosure Use the USB ports to connect USB devices Connect an RJ 45 jack to the LAN port to connect your computer to the network Use the audio jacks to connect audio devices The D port is for stereo line in signal while the F port is for microphone in signal This motherboard supports 8 channel audio de vices that correspond to the A B C and E port respec tively In addition all of the 3 ports B C and E provide users with both right amp left channels individually Users please refer to the following note for specific port function definition A Center amp Woofer B Back Surround E Front Out C Side Surround The above port definition can be changed to audio input or audio output by changing the driver utility setting Installingthe Motherboard 21 Connecting Case Components After you have installed the motherboard into a case you can begin connecting the motherboard components Refer to the following Connect the CPU cooling fan cable to CPU_FAN1 Connect the system cooling fan connector to SYS_FAN1 Connect the case cooling fan connector to CASE_FAN Connect the standard power supply connector to ATX_POWER C
9. Exit Setup PCI PnP Setup Exit Without Saving PC Health Status Ti Hove Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default Settings v02 61 C Copyright 1985 2006 American Megatrends 5 And then enter the Advanced Setup page to enable the item ECS eJIFFY Func tion Press F10 to save the configuration and exit Restart your computer CHOS Setup Utility Copyright C 1985 2007 American Megatrends Inc Advanced Setup HT Frequency Auto Auto Help Item AND Cal Enabled Oo Quick Power on Self Test Enabled Boot Up Numlock Status On LOGO Display Enabled Disabled APIC Mode Enabled Enabled ist Boot Device ARYO1 NUIDIR SPAN 1 2nd Boot Device CD DUD 3rd Boot Device Removable Dev Hard Disk Drives Press Enter Boot Other Device Yes ECS eJIFFY Function Enabled Restore Default Settings No Tles Hove Enter Select Ualue F10 Save ESC Exit Fl General Help F9 Load Default Settings Note 1 eJIFFY is available in SATA IDE AHCI mode It does not support RAID configuration and the onboard 34 pin floppy drives 2 Please refer to ECS website for new eJIFFY application updates Setting Up eJIFFY 61 Entering eJIFFY The post screen appears within several seconds after boot up and it has three buttons on it Operating system eJIFFY and BIOS Setup Click to enter the normal OS you have installed such as Windows Click to set the BIOS If you click eJIFFY the following screen
10. 2 Visit the ECS website www ecs com tw for a list of qualified CrossFireX ready graphics card for this motherboard 3 Make sure that your graphics card driver supports the ATI CrossFireX technology Download the latest driver from the ATI website www ati com 4 Make sure that your power supply unit PSU can provide at least the minimum power required by your system Installing a single graphics card 1 Install a PCI Express x16 graphics card on the PCIEI6X 1 slot 2 Connect one end of the external cable to the graphics card 3 Connect the loose end to the corresponding port on your monitor 4 Connect an auxiliary power source from the power supply to the graphics card ATI CrossHreX Technology Support 48 Installing CrossFireX graphics cards 1 Insert the CrossFireX graphics cards into the PCIE16X 1 and PCIE16X 2 slots Make sure that the card is properly seated on the slot 2 Connect an external cable to the CrossFireX ready graphics card installed on the PCIE16X 2 slot External Cable 3 Connect the two CrossFireX Edition graphics cards installed on PCIE16X 1 and PCIE16X 2 slots with the CrossFire Bridge 4 Connect the external cable to the corresponding port on your monitor 5 Connect an auxiliary power source from the power supply to the graphics cards ATI CrossHreX Technology Support Table A Supported PCI Express VGA Card List for CrossFireX Func tion ATI 49
11. Handle this page with caution Any changes can affect the operation of your computer CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc Advanced Setup Help Item Thermal Management Enabled TM Status TM1 TM2 Limit CPUID MaxVal Disabled For the processor its Enhanced Halt C1E Enabled CPUID belows 0F41h Intel XD Bit Disabled TM2 only can be enbale Intel EIST Enabled under below setting Intel Virtualization Technol Enabled 1 Freq gt 3 6GHz FSB800 Quick Power on Self Test Enabled 2 Freq gt 2 8GHz FSB533 Boot Up Numlock Status ON APIC Mode Enabled 1st Boot Device Hard Drive 2nd Boot Device CD DVD 3rd Boot Device 1st FLOPPY DRIVE Removable Drives Press Enter Boot Other Device Yes ECS eJIFFY Function Disabled tl lt gt Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings Thermal Management Enabled This item displays CPU s temperature and enables you to set a safe temperature to Prescott CPU TM Status TM1 TM2 This item displays CPU Monitor status Limit CPUID MaxVal Disabled Use this item to enable or disable the Max CPU ID value limit When suppports Prescott and LGA775 CPUs enables this to prevent the system from rebooting when trying to install Windows NT 4 0 Enhanced Halt C1E This item enables or disables enhanced halt Intel XD Bit Disabled This item enables or disables the Intel XD Bit technology Intel EIST Ena
12. CA ONS es esiseina E 7 Choosing a Computer Case i Installing the Motherboard in a Case 7 Checking Jumper SettIngs 8 SOLO TU DOES TE E AE SEI ONNEA EEN T E Checking Jumper Settings 9 Jumper Settings dea ex bea t den 9 Installing Hardware 10 Installing the PIOGOSSOR vcecizacancessanvintiatidaneicieoaemeersiank 10 Installing Memory Modules 12 TUO SONS OS i a a essa en E E EAEE REE 14 Connecting Optional Devices 16 Installing a Hard Disk Drive CD ROM SATA Hard Drive 18 Installing a Floppy Diskette Drive 19 Connecting I O Devices 20 Connecting Case Components 2l Front Panel HOGdlef osestensaeik vette d qaa sayaskapaqwaqwaqwaqwwakawawwan 24 Chapter 3 25 Using BIOS 25 About the Setup Utiltty 25 The Standard Configuration 25 iii Entering the Setup Utility
13. TCC Activation Temp 70 l lt gt Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings Smart Fan Function Scroll to this item and press lt Enter gt to view the following screen CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc Smart Fan Function i Help Item CPU SMART FAN Control Disabled SYS SMART FAN Control Disabled Options Disabled Enabled l lt gt Move Enter Select 4 Value F10 Save ESC Exit F1 General Help F9 Load Default settings CPU SYS SMART FAN Control Disabled These items enable you to define the CPU System temperatur by smartly adjustingthe CPU System fan When it is set at certain temperature the CPU SYS Fan PWM value will change accordingly Press Esc to return to the PC Health Status page Using BIOS 37 ECS supports the latest PECI host technology While using Wolfdale or Yorkfield CPU the original images of the BIOS item PC Health Status and Smart FAN Function will be replaced by PECI mode and negative num ber The max data from PECI is zero CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc PC Health Status Hardware Health Event Monitoring Smart Fan Function System Temperature CPU Fan Speed SYS FAN Speed CPU Vcore VDIMM PECI Mode Offset to TCC Activation Temp Help Item Press Enter 33 91 F 2537 RPM 0 RPM 1 280V 1 840V
14. changes in the future This Setup Utility should be used when changing the system configuration when a configuration error is detected and you are prompted to make changes to the Setup Utility when trying to resolve IRQ conllicts when making changes to the Power Management configuration when changing the password or making other changes to the Security Setup Entering the Setup Utility When you power on the system BIOS enters the Power On Self Test POST routines POST is a series of built in diagnostics performed by the BIOS After the POST routines are completed the following message appears Press DEL to enter SETUP Using BIOS 25 26 Press the delete key to access the BIOS Setup Utility CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc p Standard CMOS Setup p M I B MB Intelligent BIOS p gt Advanced Setup Load Default Settings p Advanced Chipset Setup p Supervisor Password p Integrated Peripherals B User Password p gt Power Management Setup Save amp Exit Setup p PCI PnP Setup Exit Without Saving p PC Health Status l lt gt Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default Settings v02 61 C Copyright 1985 2008 American Mega trends Inc Resetting the Default CMOS Values When powering on for the first time the POST screen may show a CMOS Settings Wrong message This standard message will appear following a
15. displays Change Supervisor Password Press Enter You can select this option and press Enter to access the sub menu You can use the sub menu to change the supervisor password Press Esc to return to the main menu setting page Using BIOS User Password This page helps you install or change a password CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc User Password User Password Not Installed Help item Change User Password Press Enter Installor Change the password l Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings User Password Not Installed This item indicates whether a user password has been set If the password has been installed nstalled displays If not Not Installed displays Change User Password Press Enter You can select this option and press Enter to access the sub menu You can use the sub menu to change the user password This item will show if Supervisor Password is set Press Esc to return to the main menu setting page Save amp Exit Setup Highlight this item and press Enter to save the changes that you have made in the Setup Utility and exit the Setup Utility When the Save and Exit dialog box appears select OK to save and exit or select Cancel to return to the main menu Exit Without Saving Highlight this item and press Enter to discard any changes that you have made in the Setup Utili
16. from English to your local language The changes will be applied after rebooting eJIFFY Configuration e E i micos Language English LIS English Us Arabic German English UK English US Spanish French Hebrew Indonesian Italian Japanese Korean Dutch Polish Portuguese Russian Thai Keyboard Ukrainian Vietnamese Chinese Simplified Chinese Traditional eJIFFY Configuration lt gt Et cero Language T rk e Turkish 4 Keyboard T rk e Turkish German English UK English UK English L S English us Espa ol Spanish Francais French Hebrew Italian Japanese Polish Portuguese Russian Ukrainian Vietnamese YkpaiHcbkKa Vi t Note The keyboard language selection list offers several more regional keyboard setups to switch with the default English typing Please refer to the usage FAQ for more tips Setting Up eJ IFFY 60 4 Restart your computer after eJIFFY installation Press lt DEL gt or click the BIOS Setup button on the post screen to enter the BIOS setup page after boot up CMOS Setup Utility Copyright C 1985 2007 American Hegatrends Inc Standard CHOS Setup H I B HB Intelligent BIOS Advanced Setup Load Default Settings Advanced Chipset Setup k Supervisor Password Integrated Peripherals gt User Password gt Power Management Setup Save
17. may cause the system to be unstable Using BIOS 39 Configure DRAM Timing by SPD Enabled This item allows users to enable or disable the DRAM timing defined by the Serial Presence Detect electrical User please note that if setting this item to auto the following two items are not available CPU VOLTAGE Normal This item allows users to adjust the CPU voltage Memory Voltage 1 90V This item allows users to adjust the DDR memory voltage Press Esc to return to the main menu setting page i m l lAN Lp if SS rs l Ly V2 1 Ix LZ SN I X f 40 Load Default Settings This option opens a dialog box to ask if you are sure to install optimized defaults or not You select OK and then Enter the Setup Utility loads all default values or select Cancel and then Enter the Setup Utility does not load default values Supervisor Password This page helps you install or change a password CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc Supervisor Password Help item Supervisor Password Not Installed Change Supervisor Password Press Enter Install or Change the password tl lt gt Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings Supervisor Password Not Installed This item indicates whether a supervisor password has been set If the password has been installed nstalled displays If not Not Installed
18. section Integrated Peripherals for details CAS Setup Utility Copyright l Ue Integrated Peripherals Onboard SATA Hode RAT nhoard AUDIO Function Enabled Intel GLAM Function Enabled Intel GLAM Hoot RUA Disabled Realtek GLAN Function Enabled Realtek GLAN Boot ROA Disabled RAID Serial Port Address JFB IRUM AHCI mBoard IR Disabled USB Functions Enabled Legacy USB Support Enabled m Chip SATAZ Controller IDE Mode Tles fove Enter Select Ualue Fl0 Saee ESC Exit Fi General Help F3 Uptimized Defaults 3 Enter the Intel Matrix Storage Manager option to set up your RAID configuration 4 Create an Intel Matrix Storage Manager driver disk for Windows OS installation See section Creating a RAID driver disk for details 5 Install the Intel Matrix Storage Manager driver after the Windows OS had been installed Intel MatrixStorage Manager RAI DConfi gurati ons 52 Entering Intel Matrix Storage Manager RAID BIOS util ity 1 During POST press lt Ctrl I gt to enter the Intel Matrix Storage Manager RAID BIOS menu Intel R Hatrlx Storage Manager option BUA vrb Copyright C 2803 87 Intel Corporation RAID Uolumes Mone defined Physical Disks Port Drive Model Serial 8 Size Type Status Vol ID 4 Maxtor 7H588F8B HELID3FLH 465 86B 9 31358832843 SQHGELEY 465 B6B Press to enter Configuration Utility 2 The main Intel Matrix Storage Manager RAID BIOS menu appears 3 Use the arr
19. the notches in the DIMM slot 5 Install the DIMM module into the slot and press it firmly down until it seats correctly The slot latches are levered upwards and latch on to the edges of the DIMM 6 Install any remaining DIMM modules Installing the Motherboard Table A DDR2 memory module QVL Qualified Vendor List The following DDR2 800 667 memory modules have been tested and qualified for use with this motherboard Size Vendor Module Name DDR2 667 AD29608A88 3EG M20A D5 G3H31 6611C 52 Apacer 78 91G92 9K5 APOGEE AU51082 667P 005 Corsair 64M8CFE PS1000 545 Infinity 0547W 64M8 PC5300 Micron MTA4HTF6464AY 667E1 PSC AL6E8E 63J 6E 1 Samsung K4T51083QC 8D23JK TT TMM6208 G8MS30B A DATA M20AD5G31417 611052 78 01G90 9K5 Apacer Elpida 1GB AM4B5708GEWS7E 0637F Micron MT8HTF12864AY 667E1 PSC AL7E8E 63J 6E 1 Aeneon AET860UD00 30DB0 8X Hynix HYMP125U64AP8 Y5 AB A Lead Max Lead Max LD5P S1G 831 PSC AL8ES8F73C 6E1 HYS64T256020E U 38 C2 A DATA Twinmos A DATA M2OAD6GS3H316011E53 Infinity 04751208 CZ5U2D KHX6400 D2ULK2 1G Kingston Micron MT 8HT F646 4AY 80E D4 Aeneon AE T760UD00 25DCO 8X Apacer 78 01 GAO 9K5 Infinity 04701 G16CZ5U2G KH X6400 D2ULK2 2G KV R800D2N5 1G Hexon NCPT7AUDR 25M48 Aeneon AE T860UD00 25DC08X Apacer 78 A1GA0 9K4 Micron MT16HTF 2566 4AY 800E 1 PSC AL8E 8F73C 8E 1 Qimonda HY S64T256020EU 25F C2 Kingston
20. will appear And If you make no choice it will enter the normal OS automatically after ten seconds BXD EA ors Setting Up eJ IFFY 62 Feature Icons The following illustration shows the main feature icons that eJIFFY provides on the menu BYRD PARo eWeb Firefox for web browsing webmail and watching flash video ePix Photo viewing ePal On line chat tool to use the most popular IMs in the world MSN ICQ AIM etc Shows ePal on line connection status Shut Down Restart Ends your session and turns off the computer Ends your session and restart the computer Click once to connect the storage disk to your computer Click for the second time to remove your storage disk safely please refer to the FAQ for more usage information Shows the network connection status Language Control Panel Switch Keyboard Languages Setting Up eJIFFY Usage FAQ Language Control Panel Besides setting English as the default interface eJIFFY offers multi language displays and keyboard settings for language switch Open the language control panel to select a preferable language setting Keyboard Language Setup Stepl Click to open the language control panel Display Language Keyboard Language Step 2 Click Keyboard Language icon to open the keyboard selection list which offers several regional keyboard settings besides default English keyboard Step 3 Click the selected keyboard l
21. you for infor mation Some options marked with a triangle P lead to submenus that enable you to change the values for the option Use the cursor arrow keys to scroll through the items in the submenu In this manual default values are enclosed in parenthesis Submenu items are denoted by a triangle P The default BIOS setting for this motherboard applies for most conditions with optimum performance It is not suggested to change the default values in the BIOS setup and the manufacture takes no responsibility to any damage caused by changing the BIOS settings BIOS Navigation Keys The BIOS navigation keys are listed below FUNCTION Scrolls through the items on a menu Modifies the selected field s values F9 Load a default optimized setting F10 Saves the current configuration and exits setup F1 Displays a screen that describes all key functions For the purpose of better product maintenance the manufacture reserves the right to change the BIOS items presented in this manual The BIOS setup screens shown in this chapter are for reference only and may differ from the actual BIOS Please visit the manufacture s website for updated manual Using BIOS 28 Standard CMOS Setup This option displays basic information about your system CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc Date Time Alarm gt SATA1 gt SATA2 gt SATA3 gt SATA4 gt SATA5 gt SATA6 Standard CMOS Setup
22. Example AMINF340 EXE 040706 ROM When the installation is complete remove the bootable device from the computer and restart your computer If your motherboard has a Flash BIOS jumper reset the jumper to protect the newly installed BIOS from being overwritten The computer will restart automatically This concludes Chapter 3 Refer to the next chapter for information on the software supplied with the motherboard Using BIG Chapter 4 Using the Motherboard Software About the Software DVD ROM CD ROM The support software DVD ROM CD ROM that is included in the motherboard pack age contains all the drivers and utility programs needed to properly run the bundled products Below you can find a brief description of each software program and the location for your motherboard version More information on some programs is available in a README file located in the same directory as the software Before installing any software always inspect the folder for files named README TXT or something similar These files may contain important information that is not included in this manual 1 Never try to install all software from folder that is not specified for use with your motherboard 2 The notice of Intel HD audio installation optional The Intel High Defi nition audio functionality unexpectedly quits working in Windows Server 2003 Service Pack 1 or Windows XP Professional x64 Edition Users need to download and install the update packages from
23. Hard Drives To install the Serial ATA SATA hard drives use the SATA cable that supports the Serial ATA protocol This SATA cable comes with a SATA power cable You can connect either end of the SATA cable to the SATA hard drive or the connector on the motherboard T SATA cable optional SATA power cable optional Installingthe Motherboard Refer to the illustration below for proper installation 1 Attach either cable end to the connector on the motherboard 2 Attach the other cable end to the SATA hard drive 3 A Attach the SATA power cable to the SATA hard drive and connect the other end to the power supply fe This motherboard does not support the Hot Plug function Installing a Floppy Diskette Drive FDD Floppy Disk Connector Connect the single end of the of the floppy connector to the onboard floppy connector firstly and then connect the remaining plugs on the other end to the floppy drives correspondingly You must orient the cable connector so that the pin 1 color edge of the cable corresponds to the pin 1 of the I O port connector Installingthe Motherboard 20 Connecting I O Devices The backplane of the motherboard has the following I O ports PS2 mouse PS2 keyboard PS2 Mouse PS2 Keyboard Serial Port COM eSATA Port USB Ports LAN Port Audio Ports i Serial port eSATA port ports ports Use the upper PS 2 port to connect a PS 2 pointing device
24. LR CMOS jumper Refer to CLR CMOS jumper in Chapter 2 for Checking Jumper Settings in this user manual When completed follow up with a Load Optimised Default in the BIOS setup 2 Check the CPU cooler fan for dust Long term accumulation of dust will reduce its effectiveness to cool the processor Clean the cooler or replace a new one if necessary 3 Check that the 12V power amp ATX connectors are fully inserted into the motherboard connectors Make sure the latches of the cable and connector are locked into place 4 Remove the hard drive optical drive or DDR memory to determine which of these component may be at fault Maintenance and care tips Your computer like any electrical appliance requires proper care and maintenance Here are some basic PC care tips to help prolong the life of the motherboard and keep it running as best as it can 1 Keep your computer in a well ventilated area Leave some space between the PC and the wall for sufficient airflow 2 Keep your computer in a cool dry place Avoid dusty areas direct sunlight and areas of high moisture content 3 Routinely clean the CPU cooler fan to remove dust and hair 4 In places of hot and humid weather you should turn on your computer once every other week to circulate the air and prevent damage from humidity 5 Add more memory to your computer if possible This not only speeds up the system but also reduces the loading of your hard drive to prolong its li
25. Preface Copyright This publication including all photographs illustrations and software is protected under international copyright laws with all rights reserved Neither this manual nor any of the material contained herein may be reproduced without written consent of the author Version 2 0 Disclaimer The information in this document is subject to change without notice The manufac turer makes no representations or warranties with respect to the contents hereof and specifically disclaims any implied warranties of merchantability or fitness for any particular purpose The manufacturer reserves the right to revise this publication and to make changes from time to time in the content hereof without obligation of the manufacturer to notify any person of such revision or changes Trademark Recognition Microsoft MS DOS and Windows are registered trademarks of Microsoft Corp MMX Pentium Pentium II Pentium III Celeron are registered trademarks of Intel Corporation Other product names used in this manual are the properties of their respective owners and are acknowledged Federal Communications Commission FCC This equipment has been tested and found to comply with the limits for a Class B digital device pursuant to Part 15 of the FCC Rules These limits are designed to provide reasonable protection against harmful interference in a residential installa tion This equipment generates uses and can radiate radio frequency ene
26. a CPU heatsink and cooling fan make sure that you DO NOT scratch the motherboard or any of the surface mount resis tors with the clip of the cooling fan If the clip of the cooling fan scrapes across the motherboard you may cause serious damage to the motherboard or its components On most motherboards there are small surface mount resistors near the processor socket which may be damaged if the cooling fan is carelessly installed Avoid using cooling fans with sharp edges on the fan casing and the clips Also install the cooling fan in a well lit work area so that you can clearly see the motherboard and processor socket Before installing the Processor This motherboard automatically determines the CPU clock frequency and system bus frequency for the processor You may be able to change the settings in the system Setup Utility We strongly recommend that you do not over clock processors or other components to run faster than their rated speed i Warning I Over clocking components can adversely affect the reliability of the system and introduce errors into your system Over clocking can perma nently damage the motherboard by generating excess heat in components that are run beyond the rated limits 2 Always remove the AC power by unplugging the power cord from the power outlet before installing or removing the motherboard or other hard ware components This motherboard has an LGA775 socket When choosing a processor consider
27. anguage e g French and press OK Keyboard language Check Language Language ay pall Arabic Deutsch German English UK English UK English US English US Espanol Spanish Francais French nav Hebrew Italiano Italian E 2888 Japanese Nederlandse Dutch Polska Polish Portugu s Portuguese Pycckun Russian Turkce Turkish YkKpaiHcbka Ukrainian vi t vietnamese cancel ok Setting Up eJIFFY a Of to enable all possible language inputs you want to apply and click Nm s SCIM Input Method Setup TTA e Frontend The installed input method services Global Setup Mame Enable Hotkeys Filters gt IMEngine b amharic ii Global Setup b Bengali bel Anthy b Gujarati Fal Chewing ip Hiriei f Smart Pinyin b Japanese Generic Table b Korean ie Panel b Malayalam GTK Nepali b Purmaba Expand ganap n Collapse awa Disable All E elect Filters Edit Hotkeys of es E vou can enable disable input methods and set hotkeys for input methods here Ble Edt yww Hatory Bookmarks Dos Help lt Q Q Wren ren q00ge com tnrsenchtqaECSbiewuthbboe uthGkaqutivieacomal L 1 Mh Moat vated v q e Googe M x w Welcome to ECS The Electrochemical Society t DIELA C The Society for ohd State and Jectrocherrwt ai scence and Technology www slactrochem org AGT Marla ECS Web Sae IELA 1
28. bled This item allows users to enable or disable the EIST Enhanced Intel Speedstep Technology function This item shows only if the CPU supports EIST Intel Virtualization Technol Enabled When enabled a VMM can utilize the additional hardware capabilities provided by Vandor Pool Technology Quick Power on Self Test Enabled Enable this item to shorten the power on testing POST and have your system start up faster You might like to enable this item after you are confident that your system hardware is operating smoothly Using BIOS Boot Up Numlock Status ON This item defines if the keyboard Num Lock key is active when your system is started APIC Mode Enabled This item allows you to enable or disable the APCI Advanced Programmable Inter rupt Controller mode APIC provides symmetric multi processing SMP for sys tems allowing support for up to 60 processors 1st 2nd 3rd Boot Device Hard Drive CD DVD 1st FLOPPY DRIVE Use this item to determine the device order the computer used to look for an operating system to load at start up time The devices showed here will be different depending on the exact devices installed on your motherboard Removable Drives Press Enter Scroll to this item and press Enter to view the following screen CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc Removable Drives Removable Drives Help Item 1st Drive 1st FLOPPY DRIVE Specifies the boo
29. city using the selected disks Entering a lower capacity allows you to create a second volume on these disks Mame Volumet RAID Level RAIDBUStripe Disks Select Disks Strip Size 128KB Capacity GB Create Volume 54 4 When done press lt Enter gt to confirm the creation of the RAID set A dialogue box appears to confirm the action Press lt Y gt to confirm other Wise press lt N gt e Manager option RUA vr b 0 1011 TCH i5 7 Intel Corporation All Rights Reserved Vo lume RAID Leve RAMAL tripe Disks 5 Strip Size 128MB Capacity 331 5 6B elect igk Are you sure you want to create this volume YH Press ENTER to create the specified volume ThiChamge TAB Mext E3C Previoas Mena EHTER Select Pressing Y deletes all the data in the HDDs 5 The following screen appears displaying the relevant information about the RAID set you created RAID Volumes l Hame Level Strip H Be Fin we FARA p SIZE status Hootable 1 08 Physical Disks Port Brive Model Serial 8 size Type StatuztUg IB Maxtor it Tu EI t Oe BAS Users please be noted that RAID 0 Stripe is set to accelerate the data access and RAID 1 Mirror is set to provide the data backup If you want to set RAID 0 you need to set the 2nd Boot Device item in the BIOS to Intel Volume0 See section Advanced Setup for details LAS setap Utd ity Lopur ight EP ITE m Bduanced se
30. clear CMOS data at factory by the manufacturer You simply need to Load Default Settings to reset the default CMOS values Note Changes to system hardware such as different CPU memories etc may also trigger this message futo Detecting 4th Slave IDE Hard Disk 4th Slave ST3120827AS 3 42 Ultra DMA Mode S M A R T Capable and Statu CHOS Settings Wrong CHOS Date Time Not Set ress F1 to Run SETUP CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc p gt Standard CMOS Setup p M I B MB Intelligent BIOS p gt Advanced Setup Load Default Settings p Advanced Chipset Setup p Supervisor Password p Integrated Peripherals ssword p Power Management Sett xit Setup p PCI PnP Setup out Saving p PC Health Status OK Cancel l l lt gt Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default Settings v02 61 C Copyright 1985 2008 American Megatrends Inc Using BIOS When you start the Setup Utility the main menu appears The main menu of the Setup Utility displays a list of the options that are available A highlight indicates which option is currently selected Use the cursor arrow keys to move the highlight to other options When an option is highlighted execute the option by pressing Enter Some options lead to pop up dialog boxes that prompt you to verify that you wish to execute that option Other options lead to dialog boxes that prompt
31. e Motherboard 17 Installing a Hard Disk Drive CD ROM SATA Hard Drive This section describes how to install IDE devices such as a hard disk drive and a CD ROM drive About IDE Devices Your motherboard has one IDE interface An IDE ribbon cable supporting two IDE devices is bundled with the motherboard You must orient the cable connector so that the pinl color edge of the cable corresponds to the pin 1 of the I O port connector IDE IDE Connector This motherboard supports six high data transfer SATA ports with each runs up to 3 0 Gb s To get better system performance we recommend users connect the CD ROM to the IDE channel and set up the hard drives on the SATA ports IDE devices enclose jumpers or switches used to set the IDE device as MASTER or SLAVE Refer to the IDE device user s manual Installing two IDE devices on one cable ensure that one device is set to MASTER and the other device is set to SLAVE The documentation of your IDE device explains how to do this About SATA Connectors Your motherboard features six SATA connectors supporting a total of six drives SATA refers to Serial ATA Advanced Technology Attachment is the standard inter face for the IDE hard drives which are currently used in most PCs These connectors are well designed and will only fit in one orientation Locate the SATA connectors on the motherboard and follow the illustration below to install the SATA hard drives Installing Serial ATA
32. e features on the motherboard are implemented by cabling connectors on the motherboard to indica tors and switches on the system case Make sure that your case supports all the features required Secondly this motherboard supports one floppy diskette drive and two enhanced IDE drives Make sure that your case has sufficient power and space for all drives that you intend to Install Most cases have a choice of I O templates in the rear panel Make sure that the I O template in the case matches the I O ports installed on the rear edge of the motherboard This motherboard carries an ATX form factor of 305 x 244 mm Choose a case that accommodates this form factor Installing the Motherboard in a Case Refer to the following illustration and instructions for installing the motherboard in a case Most system cases have mounting brackets installed in the case which correspond the holes in the motherboard Place the motherboard over the mounting brackets and secure the motherboard onto the mounting brackets with screws Ensure that your case has an I O template that supports the I O ports and expansion slots on your motherboard Installingthe Motherboard BATAN XU L LL E FEN tust NE TT T i amp the motherboard Checking Jumper Settings This section explains how to set Jumpers for correct configuration of the motherboard Setting Jumpers Use the motherboard jumpers to set system configuration options Jumpers with mo
33. fe span 6 If possible ensure the power cord has an earth ground pin directly from the wall outlet This will reduce voltage fluctuation that may damage sensitive devices 69 SOINDYTD 01 peau Oia dn1 s SOW gunies SOI Ajipouu saye 1463581 pue SOND 112 9 qeisun JO 3Je3s 03 eJ WAISAS uu qo d AAH nssl 92IAep JeJeudiJad S9A VINY 3261000 16J J 63s2J pue SOND 419 VIAM 1261000 lt e dsip seu JoWUOW JI 29U ulo qoJd pueog pa3221ep 1ou YDA ON sd q Yous g pue d q 8uo T J S9A 9Jn iej A1ouu uu JO payasul 4e3s9J pue 1Je3saJ p A 19doud you Aow w WNIA sdaaq 140us JI U93J95 1SOd 1e YEH 195205 PM 03 128uuoo JO U91IMS Sd uo WINE Jd od HED od ON SOA SOA VIAM PeU lt uje qoJd pueog J p2129UUuO SI ip4eog 10 nSd YUM ue qoJd Mp samod AZT fid J PUNES G n AU sey 1olluoui JI 33uD ON ON SOA 29u pue SOND Y19 SOA uo pauJnj S u23IMs NSd pue BUIYJOM SI MSd HUN Aiddns 180g 1I 99 m Iddns 1 9949 ON pessn d s p109 wamod jy Hels 01 S IeJ d NG passaid s uoyng JeMog JIVYIMO Sunoous qno4 dIseg 70 Memo Trouble Shooting
34. gy providing both AHCI and RAID 0 1 5 and 10 configuration There is an advanced full set of I O ports in the rear panel including PS 2 mouse and keyboard connectors one serial port one eSATA port six USB ports one LAN port and audio jacks for microphone line in and 8 ch line out Introducingthe Motherboard Feature Processor This motherboard uses an LGA775 type of Intel Yorkfield Wolfdale Core 2 Duo that carries the following features Accommodates Intel Intel Yorkfield Wolfdale Core 2 Duo proces Sors Supports a system bus FSB of 1333 1066 800 MHz Chipset The P45 Northbridge NB and ICHIOR Southbridge SB chipsets are based on an innovative and scalable architecture with proven reliability and performance P45 NB ICH10R SB Memory Supports 36 bit host bus addressing allowing the CPU to access the entire 64 GB of the memory ad dress space 2 GB s point to point Direct Media Interface DMI to ICH10 1 GB s each direction Two PCI Express x16 slots intended for Graphics Interface are fully compliant to the PCI Express Base Specification Revision 2 0 Supports 512 Mb and 1 Gb DDR2 and 512 Mb 1 Gb and 2 Gb DDR3 DRAM technologies for x8 and x16 devices Enhanced DMA Controller interrupt controller and timer functions Compliant with PCI Express Base Specification revi sion 1 1 Compliant with PCI v2 3 specificaiton Compliant with SATA 3 0 Gb s Host Controller Integra
35. he system can automatically resume at a fixed time based on the system s RTC realtime clock Use the items below this one to set the date and time of the wake up alarm You must use an ATX power supply in order to use this feature Press Esc to return to the main menu setting page PCI PnP Setup This page sets up some parameters for devices installed on the PCI bus and those utilizing the system plug and play capability CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc PCI PnP Setup Init Display First Help Item Allocate IRQ to PCI VGA Select which graphics controller to use as the primary boot device l lt gt Move Enter Select 4 Value F10 Save ESC Exit F1 General Help F9 Load Default settings Init Display First PCI Use this item to select which graphics controller to use as the primary boot devices Allocate IRQ to PCI VGA Yes Press Esc to return to the main menu setting page Using BIOS 36 PC Health Status On motherboards support hardware monitoring this item lets you monitor the parameters for critical voltages temperatures and fan speeds CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc PC Health Status Help Item System Hardware Monitor Smart Fan Function Press Enter System Temperature 92 C 89 F CPU FAN Speed 2576 RPM SYS FAN Speed N A CPU Core 1 040V VDIMM 1 792 V PECI Mode Offset to
36. ion Event Timer support Press Esc to return to the main menu setting page 33 Integrated Peripherals This page sets up some parameters for peripheral devices connected to the system CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc Integrated Peripherals Onboard SATA Mode Enhanced Help Item SATA Configuration IDE Onboard LAN Function Enabled Onboard LAN Boot ROM Disabled Onboard AUDIO Function Enabled Disabled Serial Port1 Address 3F8 IRQ4 Compatible Options USB Functions Enabled Enhanced Legacy USB Support Enabled On Chip SATA2 Controller AHCI IDE Mode lt Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings Onboard SATA Mode Enhanced Use this item to select the mode of the Serial ATA SATA Configuration IDE Use this item to show the Serial ATA Configuration options OnBoard LAN Function Enabled Use this item to enable or disable the onboard LAN function OnBoard LAN Boot ROM Disabled Use this item to enable or disable the booting from the onboard LAN or a network add in card with a remote boot ROM installed Onboard AUDIO Function Enabled Use this item to enable or disable the onboard Audio function Serial Port1 Address 3F8 IRQ4 Use this item to enable or disable the onboard COMI serial port and to assign a port address USB Functions Enabled Use this item to enable or disable the USB function Legacy USB Supp
37. k the pins on the CPU socket for damage or bent A bent pin may cause failure to boot and sometimes permanent damage from short circuit 5 Check the 12V power connector is connected to the motherboard 6 Check that the 12V power amp ATX connectors are fully inserted into the motherboard connectors Make sure the latches of the cable and connector are locked into place b Power is on fans are running but there is no display Make sure the monitor is turned on and the monitor cable is properly connected to the PC 2 Check the VGA adapter card if applicable is inserted properly 3 Listen for beep sounds If you are using internal PC speaker make sure it is connected a continuous 3 short beeps memory not detected b 1 long beep and 8 short beeps VGA not detected 67 68 c The PC suddenly shuts down while booting up 1 The CPU may experience overheating so it will shutdown to protect itself Ensure the CPU fan is working properly 2 From the BIOS setting try to disable the Smartfan function to let the fan run at default speed Doing a Load Optimised Default will also disable the Smartfan Start up problems after prolong use After a prolong period of use your PC may experience start up problems again This may be caused by breakdown of devices connected to the motherboard such as HDD CPU fan etc The following tips may help to revive the PC or identify the cause of failure 1 Clear the CMOS values using the C
38. le named README TXT or something similar This file may contain important information to help you install the software correctly Some software is installed in separate folders for different operat ing systems such as Windows XP Vista 7 Always go to the cor rect folder for the kind of OS you are using In install the software execute a file named SETUP EXE by double clicking the file and then following the instructions on the screen The EXIT button closes the Auto Setup window Utilities Tab Lists the software utilities that are available on the disk Information Tab Displays the path for all software and drivers available on the disk Running Setup Follow these instructions to install device drivers and software for the motherboard 1 Click Setup The installation program begins 3 hana atap Package usnlbwara Toren P TX 0014 P45T A Inroserup Program Tas ba Pesa a Foris 200 0071 Yafricomsn be Uer Irria erid whined Fan a ui thaj Tie Soule ened oll Fan all ma Ia gl epa Tarpeia rich Horat fe The following screens are examples only The screens and driver lists will be different according to the motherboard you are installing The motherboard identification is located in the upper left hand corner Using the Motherboard Software 45 2 Click Next The following screen appears Auto Setup Package software Version 2 00 0009 Select Features Choose the features Setup will Install Se
39. lect the features you want to install clear the features vou do not want to install m Description Intel R Chipset Software Installation Utility Version 5 0 0 1011 Release Date 2004 05 28 Space Required on C 40785 K Space Available on C 29053888 K InstallShield lt Back Cancel 3 Check the box next to the items you want to install The default options are recom mended 4 Click Next run the Installation Wizard An item installation screen appears Welcome to the InstallShield R Wizard for Intel R Chipset Software Installation Utility Welcome to the Intel R Chipset Software Installation Utility This utility will enable Plug amp Play INF support for Intel R chipset components lt Back Nest gt Cancel 5 Follow the instructions on the screen to install the items Drivers and software are automatically installed in sequence Follow the onscreen instructions confirm commands and allow the computer to restart a few times to complete the installation Usingthe Motherboard Software 46 Windows Vista 7 will appear below UAC User Account Control message Ly after the system restart You must select Allow to install the next driver Continue this process to complete the drivers installation Manual Installation Insert the disk in the DVD ROM CD ROM drive and locate the PATH DOC file in the root directory This file contains the information needed to locate the d
40. led Disabled Auto Detect DIMM PCI CIK Enabled Enabled Spread Spectrum Enabled Memory Current Type CL5 Trcd5 Trp5 Tras16 DRAM Frequency Auto Configure DRAM Timing by SPD Enabled CPU VOLTAGE Normal Memory Voltage 1 90V tl lt gt Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings Manufacturer Intel This item displays the information of current manufacturer of the CPU installed in your computer Ratio Actual Value 8 This item shows the actual ratio of the CPU installed in your system CPU Frequency Setting 333MHz This item is used to set the CPU Frequency Over clocking Function Disabled This item decides the CPU over clocking function frequency installed in your sys tem If the over clocking fails please turn off the system power And then hold the PageUp key similar to the Clear CMOS function and turn on the power the BIOS will recover the safe default Auto Detect DIMM PCI Clk Enabled When this item is enabled BIOS will disable the clock signal of free DIMM PCI slots Spread Spectrum Enabled If you enable spread spectrum it can significantly reduce the EMI Electro Magnetic Interference generated by the system Memory Current Type This item is used to show the current memory type DRAM Frequency Auto This item enables users to adjust the DRAM frequency The default setting is auto and we recommend users leave the setting unchanged Modify it at will
41. m is set to Instant Off then the power button causes a software power down If the item is set to Delay 4 Sec then you have to hold the power button down for four seconds to cause a software power down PWRON After PWR Fail Power Off This item enables your computer to power off automatically restart or return to its previous status after abnormal power lost Resume By Ring Disabled The system can be turned off with a software command If you enable this item the system can automatically resume if there is an incoming call on the Modem You must use an ATX power supply in order to use this feature Resume By PCI PCI E Lan PME Disabled The system can be turned off with a software command If you enable this item the system can automatically resume if there is an incoming call on the PCI Modem or PCI LAN card You must use an ATX power supply in order to use this feature Use this item to do wake up action if inserting the PCI card Resume By PS2 KB S3 Disabled This item enables or disables you to allow keyboard activity to awaken the system from S3 mode Using BIG 35 Resume By PS2 MS S3 Disabled This item enables or disables you to allow mouse activity to awaken the system from S3 mode Resume By USB S3 Disabled This item allows you to enable disable the USB device wakeup function from S3 mode Resume on RTC Alarm Disabled The system can be turned off with a software command If you enable this item t
42. may have to manually configure the card before installation Installingthe Motherboard Follow these instructions to install an add on card 1 Remove a blanking plate from the system case corresponding to the slot you are going to use 2 Install the edge connector of the add on card into the expansion slot Ensure that the edge connector is correctly seated in the slot 3 Secure the metal bracket of the card to the system case with a screw For some add on cards for example graphics adapters and network adapters you have to install drivers and software before you can begin using the add on card Installingthe Motherboard 16 Connecting Optional Devices Refer to the following for Information on connecting the motherboard s optional devices r T e P z ee Ef Li iT ra p E i ae ye ee T E CP EM pim I n Yi gt i l um mmi SATA1 oe I Gd SATA2 j l SATA3 saf SATA4 BATAN PH mud SATAS mdi SATA6 SPDIFO G CREE CD IN F AUDIO ruses r usg2 r usai F AUDIO Front Panel Audio header This header allows the user to install auxiliary front oriented microphone and line out ports for easier access Pin Signal Name Pin Signal Name Cs porrm 4 PRESENCE 7 sess 8 KEY SPDIFO SPDIF out header This is an optional header that provides an S PDIF Sony Philips Digital Interface output to digital multimedia device thro
43. n and heatsink installation procedures may vary with the type of CPU fan heatsink supplied The form and size of fan heatsink may also vary 2 DO NOT remove the CPU cap from the socket before installing a CPU 3 Return Material Authorization RMA requests will be accepted only if the motherboard comes with the cap on the LGA775 socket Installing the Motherboard Installing Memory Modules This motherboard accommodates four memory modules It can support four 240 pin DDR2 800 667 The total memory capacity is 16 GB DDR2 SDRAM memory module table Memory module Memory Bus DDR2 667 333 MHz DDR2 800 400 MHz You must install at least one module in any of the four slots Each module can be installed with 4 GB of memory total memory capacity is 16 GB Do not remove any memory module from its antistatic packaging until you are ready to install it on the motherboard Handle the modules only by their edges Do not touch the components or metal parts Always wear a grounding strap when you handle the modules Installation Procedure Refer to the following to install the memory modules 1 This motherboard supports unbuffered DDR2 SDRAM only 2 Push the latches on each side of the DIMM slot down 3 A Align the memory module with the slot The DIMM slots are keyed with notches and the DIMMs are keyed with cutouts so that they can only be installed correctly 4 Check that the cutouts on the DIMM module edge connector match
44. ng Flowchalrt 69 vi Memo Chapter 1 Introducing the Motherboard Introduction Thank you for choosing the P45T A motherboard This motherboard is a high performance enhanced function motherboard designed to support the LGA775 socket Intel Yorkfield Wolfdale Core 2 Duo processors for high end business or personal desktop markets The motherboard incorporates the Intel Eaglelake P45 Northbridge NB and Intel ICHIOR Southbridge SB chipsets The Northbridge supports a Front Side Bus FSB frequency of 1333 1066 800 MHz using a scalable FSB Vcc CPU The memory controller supports DDR2 memory DIMM frequencies of 800 667 It supports four DDR2 sockets with maximum memory size of 16 GB High resolution graphics via two PCI Express x16 slots intended for Graphics Interface are fully compliant to the PCI Express Base Specification Revision 2 0 It supports the ATI CrossFireX Technology that allows you to install GPU graphics cards The ICHIOR Southbridge supports two PCI slots which are PCI v2 3 compliant It implements an EHCI compliant interface that provides 480 Mb s bandwidth for twelve USB 2 0 ports six USB ports and three USB 2 0 headers support additional six USB ports One onboard IDE connector supports two IDE devices in Ultra ATA 133 100 66 33 mode The Southbridge supports six SATA ports with maximum transfer rate up to 3 0 Gb s each It supports Intel Matrix Storage Technolo
45. of switch and LED headers commonly found on ATX or Micro ATX cases Refer to the table below for informa tion F PANEL Pin Signal Function Pin Signal Function HD LED P HarddiskLED 2 FP PWR SLP MSGLED HD LED N HarddiskLED 4 FP PWR SLP MSG LED RST SW N Reset Switch PWR SW P Power Switch RST SW P ResetSwitch 8 PWR SW N Power Switch MSG LED dual color or single color Hard Drive Activity LED Connecting pins 1 and 3 to a front panel mounted LED provides visual indication that data is being read from or written to the hard drive For the LED to function properly an IDE drive should be connected to the onboard IDE interface The LED will also show activity for devices connected to the SCSI hard drive activity LED connector Power Sleep Message waiting LED Connecting pins 2 and 4 to a single or dual color front panel mounted LED provides power on off sleep and message waiting indication Reset Switch Supporting the reset function requires connecting pins 5 and 7 to a momentary contact switch that is normally open When the switch is closed the board resets and runs POST Power Switch Supporting the power on off function requires connecting pins 6 and 8 to a momen tary contact switch that is normally open The switch should maintain contact for at least 50 ms to signal the power supply to switch on or off The time requirement is due to internal de bounce ci
46. on RAID ALL DISK DATA WILL BE DELETED Tl Select ESC Preulous Mena DEL Delete Uolume Pressing Y deletes all the data in the HDDs ntel Matrix Storage Manager RAI DConfigurati ons 56 Resetting disks to Non RAID An HDD that has been previously configured as part of another RAID set fe in another platform is called a broken RAID HDD When you install a broken RAID HDD you cannot select this disk when configuring a RAID set through the Intel Matrix Storage Manager option If you still want to use this broken RAID HDD as part of the RAID set configured through the Intel Matrix Storage Manager you may do so by resetting the disk to Non RAID You will however lose all data and previous RAID configu rations To reset disks to Non RAID 1 In the main Intel Matrix Storage Manager RAID BIOS menu highlight Reset Disks to Non RAID using the up down arrow key then press lt En ter gt 1 Create RAID Volume 2 Delete RAID Volume 2 Use the space bar to select the HDD to reset to Non RAID 3 A dialogue box appears to confirm the action Press lt Y gt to confirm otherwise press lt N gt Pressing lt Y gt deletes all the data in the HDDs Exiting Setup When you have finished highlight Exit using the up down arrow key then press Enter to exit the Intel Matrix Storage Manager RAID BIOS utility A dialogue box appears to confirm the action Press Y to confirm otherwise press N
47. onnect the auxiliary case power supply connector to ATX12V Connect the case switches and indicator LEDs to the F_ PANEL Connect the case speaker cable to SPK CPU FAN1 NOOR G N 4 ALA ATX_POWER y ni SPK 10 2 F_PANEL Connecting 24 pin power cable The ATX 24 pin connector allows you to connect to ATX v2 x power supply With ATX v2 x power supply users please note that when installing 24 pin power cable the latches of power cable and the ATX_POWER match perfectly Installing the Motherboard 22 Connecting 4 pin power cable The ATX12V power connector is used to provide power to the CPU When installing 4 pin power cable the latches of power cable and the ATX12V match perfectly 4 pin power cable CPU FAN1 SYS FAN1 Cooling FAN Power Connector Pin Signal Name Function 1 GND System Ground 4 Control CPU FAN conmo Users please note that the fan connector supports the CPU cooling fan of LIA 2 2A 26 4W max at 12V CASE FAN Case cooling FAN Power Connector Pin Signal Name Function 1 System Ground 2 Power 12V ATX POWER ATX 24 pin Power Connector Pin Signal Name Pin Signal Name Installingthe Motherboard ATX12V ATX 12V Power Connector Pin Signal Name wawa SPK Internal speaker header Signal Name Key wa Installingthe Motherboard 23 24 Front Panel Header The front panel header F PANEL provides a standard set
48. ort Enabled Use this item to enable or disable support for legacy USB devices On Chip SATA2 Controller AHCI IDE Mode This item allows you to enable or disable the onchip Serial ATA controller Press lt Esc gt to return to the main menu setting page Using BIOS Power Management Setup This page sets up some parameters for system power management operation CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc Power Management Setup ACPI Suspend Type S3 STR Help Item Soft off by PWR BTTN Instant Off PWRON After PWR Fail Power Off Selectthe ACPI Resume by Ring Disabled state used for Resume By PCI PCI E Lan PME Disabled System Suspend Resume by USB S3 Disabled Resume By PS2 KB S3 Disabled Resume By PS2 MS S3 Disabled Resume on RTC Alarm Disabled l lt Move Enter Select 4 Value F10 Save ESC Exit F1 General Help F9 Load Default settings ACPI Suspend Type S3 Use this item to define how your system suspends In the default S3 the suspend mode is a suspend to RAM i e the system shuts down with the exception of a refresh current to the system memory Soft off by PWR BTTN Instant off Under ACPI Advanced Configuration and Power management Interface you can create a software power down In a software power down the system can be resumed by Wake Up Alarms This item lets you install a software power down that is con trolled by the power button on your system If the ite
49. ow keys to move the color bar and navigate through the items Intel R Matrix Storage Manager option ROM v7 6 80 1811 CHIR RAIDS All Rights Reserved a Reset Disks to Non RAID Exit RAID Uolumes fone def ined Physical Disks Port Drive Model Serial 3 Size Type Status Un ID xtor 7H388FB HBIDJFLH 465 868 Th Select ESC I Exit LENTER Select Menu 53 Creating a RAID set 1 In the main Intel Matrix Storage Manager RAID BIOS menu highlight Create RAID Volume using the up down arrow key then press Enter Create RAID Lolume Reset Risks to S CU 2 Belete BAID Uslome Exit 2 When the RAID Level item is highlighted use the up down arrow key to select the RAID set that you want to create Hame Uoluseg RAID Level HIEI Disks Select Dish Strip Size 120KB Capacity 931 5 GB Create Ualume Home UalumeQ RAID Level Disks Select Strip Sige Wea Capacity 465 8 GB Create Volume When more than two HDDs are installed in your computer the Disks item eo will be selectable Then users can select the HDD that you want to belong to the RAID set Please be noticed that selecting a wrong disk will result in losing the original data of the HDD Hame oluse RAID Level B Stri Disks 3 1 Strip Size Capacity Create Unlume 3 Key in the RAID volume capacity Use the up down arrow to choose the Capacity The default value indicates the maximum capa
50. pecifications and software items are subject to change without prior notice 2 Due to chipset limitation we recommend that motherboard be oper ated in the ambiance between 0 and 50 C Introducing the Motherboard Specifications CPU LGA775 socket for Intel Yorkfield Wolfdale Core 2 Duo porcessors FSB 1333 1066 800 MHz Chipset Intel Eaglelake P45 amp ICH10R North Bridge Intel Eaglelake P45 South Bridge Intel ICH10R Memory Dual channel DDR2 memory architecture 4 x 240 pin DDR DIMM socket support up to 16 GB Supports DDR2 800 667 DDRII SDRAM Expansion 2 x PCI Express x16 slots Slots 2 x PCI Express x1 slots 2 x PCI slots otorage Support by Intel ICH10R 6 x Serial ATAII devices Supports RAIDO 1 5 10 Support by JMicron JMB361 2 x Ultra DMA 133 100 66 device 4 x 240 pin DDR DIMM socket support up to 16 GB 1 x e SATAII 3 0 Gb s device Audio RealTek ALC883 7 1ch High Definition audio CODEC LAN Gigabit LAN Athlos L1 PCle GigaLAN controller Rear Panel I O 1 x PS 2 keyboard amp PS 2 mouse connectors 6 x USB ports 1 x e SATA port 1 x COM port 1 x RJ 45 LAN connector 1 x Audio port 1x Line in 4x Line out 1x Optical SPDIF Out Internal I O 1 x 24 pin ATX Power Supply connector amp 8 pin 12V con Connectors amp nector Headers 1 x IDE connector 6 x Serial ATA connectors 3 x USB 2 0 headers support additional 6 USB po
51. rcuitry After receiving a power on off signal at least two seconds elapses before the power supply recognizes another on off signal This concludes Chapter 2 The next chapter covers the BIOS Installingthe Motherboard Chapter 3 Using BICS About the Setup Utility The computer uses the latest American Megatrends Inc BIOS with support for Windows Plug and Play The CMOS chip on the motherboard contains the ROM setup instructions for configuring the motherboard BIOS The BIOS Basic Input and Output System Setup Utility displays the system s configuration status and provides you with options to set system parameters The parameters are stored in battery backed up CMOS RAM that saves this information when the power is turned off When the system is turned back on the system is configured with the values you stored in CMOS The BIOS Setup Utility enables you to configure Hard drives diskette drives and peripherals Video display type and display options Password protection from unauthorized use Power Management features The settings made in the Setup Utility affect how the computer performs Before using the Setup Utility ensure that you understand the Setup Utility options This chapter provides explanations for Setup Utility options The Standard Configuration A standard configuration has already been set in the Setup Utility However we recommend that you read this chapter in case you need to make any
52. re than one pin are numbered When setting the jumpers ensure that the jumper caps are placed on the correct pins jumper is SHORT If you remove the jumper i Te cap or place the jumper cap on just one pin the jumper is OPEN SHORT OPEN The illustrations show a 2 pin jumper When the jumper cap is placed on both pins the This illustration shows a 3 pin jumper Pins NI and 2 are SHORT Installingthe Motherboard Checking Jumper Settings The following illustration shows the location of the motherboard jumpers Pin 1 is labeled USHPWR R USBPWR R1 a_i CLR CMOS pa USBPWR F1 OFORO USBPWR FZ Jumper Settings 1 2 NORMAL 2 3 CLEAR CLR CMOS 3 pin CLEAR CMOS Before clearing the CMOS make sure to turn the system off Rear USB PS2 USBPWR RI 2 3 pin power Select Jumper Front Panel USB Power Select Jumper USBPWR F1 2 To avoid the system instability after clearing CMOS we recommend users to enter the main BIOS setting page to Load Default Settings and then Save amp Exit Setup 2 Make sure the power supply provides enough 5VSB voltage before se lecting the 5VSB function 3 It is required that users place the USBPWR F1 2 amp USBPWR RI 2 cap onto 2 3 pin rather than 1 2 pin as default if you want to wake up the computer by USB PS2 KB Mouse Installingthe Motherboard 10 Installing Hardware Installing the Processor W Caution When installing
53. reading or writing more data during each transfer LBA Large Mode Auto Use this item to set the LAB Large mode to enhance hard disk performance by optimizing the area the hard disk is visited each time Block Multi Sector Transfer Auto If the feature is enabled it will enhance hard disk performance by reading or writing more data during each transfer PIO Mode Auto Use this item to set the PIO mode to enhance hard disk performance by optimizing the hard disk timing DMA Mode Auto DMA capability allows user to improve the transfer speed and data integrity for compatible IDE devices S M A R T Auto The S M A R T Self Monitoring Analysis and Reporting Technology system is a diagnostics technology that monitors and predicts device performance S M A R T software resides on both the disk drive and the host computer 32Bit Data Transfer Enabled Use this item to enable or disable 32Bit Data Transfer Press Esc to return to the Standard CMOS Setup page IDE BusMaster Enabled This item enables or disables the DMA under DOS mode We recommend you to leave this item at the default value Drive A 1 44 MB 37 This item defines the characteristics of any diskette drive attached to the system Only one floppy diskette drive is supported Press Esc to return to the main menu setting page Using BIOS UT Advanced Setup This page sets up more advanced information about your system
54. requirements of the Canadian Interference causing Equipment Regulations Cet appareil num rique de la classe B respecte toutes les exigences du R glement sur le mat riel brouilieur du Canada Aboutthe Manual The manual consists of the following Chapter 1 Introducing the Motherboard Chapter 2 Installing the Motherboard Chapter 3 Using BIOS Chapter 4 Using the Motherboard Software Chapter 5 ATI CrossfireX Technology Support Chapter 6 Intel Matrix Storage Manager RAID Configurations Chapter 7 Setting Up eJIFFY Chapter 8 Trouble Shooting Preface Describes features of the motherboard Go to page 1 Describes installation of motherboard components Go to page 7 Provides information on us ing the BIOS Setup Utility Go to gt page 25 Describes the motherboard software Go to page 43 Describes the ATI CrossfireX V Technology Go to gt page 47 Describes the Intel Matrix Storage Manager RAID Con figurations Go to v page 51 Describes the eJIFFY setting up Go to page 57 Provides basic trouble shoot ing tips Go to page 67 TABLE OF CONTENTS Preface i Chapter 1 1 Introducing the Motherboard 1 TAD INC psec uu E E qussataqawwawawpasqhiwanpaqakqwyaapaqawiahuqatqaq 1 las lU mas 2 SDECIHICOUOBS u LLULLU SS ett annara Motherboard Component s 5 Chapter 2 Installing the Motherboard 7 Safety PRC
55. rgy and if not installed and used in accordance with the instructions may cause harmful inter ference to radio communications However there is no guarantee that interference will not occur in a particular installation If this equipment does cause harmful interference to radio or television reception which can be determined by turning the equipment off and on the user is encouraged to try to correct the interference by one or more of the following measures Reorient or relocate the receiving antenna Increase the separation between the equipment and the receiver Connect the equipment onto an outlet on a circuit different from that to which the receiver is connected Consult the dealer or an experienced radio TV technician for help Shielded interconnect cables and a shielded AC power cable must be employed with this equipment to ensure compliance with the pertinent RF emission limits govern ing this device Changes or modifications not expressly approved by the system s manufacturer could void the user s authority to operate the equipment Preface Declaration of Conformity This device complies with part 15 of the FCC rules Operation is subject to the following conditions This device may not cause harmful interference and This device must accept any interference received including interfer ence that may cause undesired operation Canadian Departmentof Communications This class B digital apparatus meets all
56. rivers for your motherboard Look for the chipset and motherboard model then browse to the directory and path to begin installing the drivers Most drivers have a setup program SETUP EXE that automatically detects your operating system before installation Other drivers have the setup program located in the operating system subfolder If the driver you want to install does not have a setup program browse to the operating system subfolder and locate the readme text file README TXT or README DOC for information on installing the driver or software for your oper ating system Utility Software Reference All the utility software available from this page is Windows compliant They are provided only for the convenience of the customer The following software is fur nished under license and may only be used or copied in accordance with the terms of the license These software s are subject to change at anytime without prior notice Please refer to the support disk for available software This concludes chapter 4 Usingthe Motherboard Software 47 Chapter 5 ATI CrossFireX Technology Support This motherboard supports the ATI CrossFireX Technology that allows you to install multi graphics processing units GPU graphics cards Follow the installation procedures in this section Requirements 1 You should have a CrossFireX Ready motherboard a CrossFireX Edi tion graphics card and a CrossFireX ready graphics card
57. rts 1 x Clear CMOS header 1 x Front panel header 1 x Front panel audio header 1 x CD in header CPUFAN SYSFAN connectors 1 x Reset buttom 1 x Power on buttom System BIOS AMI BIOS with 8Mb SPI ROM Supports Plug and Play STR STD Hardware monitor PCI interrupt selection ACPI amp DMI CPU FSB adjustment in crease of 1MHz Supports ACPI revision 1 0 specification Form Factor ATX Size 305mm x 244mm Introducingthe Motherboard Motherboard Components Table of Motherboard Components LGA775 socket Intel Yorkfield W olfdale Core 2 1 CPU Socket Duo processors Serial AT A connectors PCI Express x1 slots This concludes Chapter 1 The next chapter explains how to install the motherboard Introducingthe Motherboard Memo Introducingthe Motherboard Chapter 2 InstallingtheMotherboard Safety Precautions Follow these safety precautions when installing the motherboard Wear a grounding strap attached to a grounded device to avoid dam age from static electricity Discharge static electricity by touching the metal case of a safely grounded object before working on the motherboard Leave components in the static proof bags they came in Hold all circuit boards by the edges Do not bend circuit boards Choosing a Computer Case There are many types of computer cases on the market The motherboard complies with the specifications for the ATX system case Firstly som
58. t sequence from the available devices l lt gt Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings Press Esc to return to the Advanced Setup page Boot Other Device Yes When enabled the system searches all other possible locations for an operating system if it fails to find one in the devices specified under the First Second and Third boot devices ECS eJIFFY Function Disabled Use this item to enable or disable the ECS eJIFFY Function eJIFFY is ECS unique software program for the quick access to the internet without entering O S Please refer to Chapter 7 to know more about eJIFFY Press Esc to return to the main menu setting page 34 32 Advanced Chipset Setup This page sets up more advanced information about your system Handle this page with caution Any changes can affect the operation of your computer CMOS Setup Utility Copyright C 1985 2008 American Megatrends Inc Advanced Chipset Setup Memory Remap Feature Enabled Help Item HPET Enabled ENABLE Allow remapping of overlapped PCI memory above the total physical memory DISABLE Do not allow remapping of memory tl lt gt Move Enter Select Value F10 Save ESC Exit F1 General Help F9 Load Default settings Memory Remap Feature Enabled This item allows users to enable or disable memory hole remapping HPET Enabled This item enables or disables HPET High Precis
59. ted USB 2 0 Host Controller supporting up to twelve USB 2 0 ports Supports Intel Matrix Storage Technology providing both AHCI and RAID 0 1 5 and 10 configuration Supports DDR2 800 667 DDR2 SDRAM with Dual channel architecture Accommodates four unbuffered DIMMs Up to 4 GB per DIMM with maximum memory size up to 16 GB Audio RealTek ALC883 7 1ch High Definition audio CODEC Onboard LAN Gigabit LAN Athlos L1 PCle GigaLAN controller Introducingthe Motherboard Expansion Options The motherboard comes with the following expansion options Two PCI Express x16 slots for Graphics Interface Two PCI Express x1 slots Two 32 bit PCI v2 3 compliant slots One IDE connector supporting up to two IDE devices One floppy disk drive interface Six 7 pin SATA connectors This motherboard supports Ultra DMA bus mastering with transfer rates of 133 100 66 33 Mb s Integrated I O The motherboard has a full set of I O ports and connectors Two PS 2 ports for mouse and keyboard One Serial port One eSATA port Six USB ports One LAN port Audio jacks for microphone line in and 8 ch line out BIOS Firmware The motherboard uses AMI BIOS that enables users to configure many system features including the following Power management Wake up alarms CPU parameters CPU and memory timing ECS M I B BIOS The firmware can also be used to set parameters for different processor clock speeds W 1 Some hardware s
60. the performance requirements of the system Performance is based on the processor design the clock speed and system bus frequency of the processor and the quantity of internal cache memory and external cache memory Installingthe Motherboard CPU Installation Procedure The following illustration shows CPU installation components A Read and follow the instructions shown on the sticker on the CPU cap B Unload the cap Use thumb amp forefinger to hold the lifting tab of the cap Lift the cap up and remove the cap completely from the socket C Open the load plate Use thumb amp forefinger to hold the hook of the lever pushing down and pulling aside unlock it Lift up the lever Use thumb to open the load plate Be careful not to touch the contacts D Install the CPU on the socket Orientate CPU package to the socket Make sure you match triangle marker to pin 1 location E Close the load plate Slightly push down the load plate onto the tongue side and hook the lever CPU is locked completely F Apply thermal grease on top of the CPU G Fasten the cooling fan supporting base onto the CPU socket on the motherboard H Make sure the CPU fan is plugged to the CPU fan connector Please refer to the CPU cooling fan user s manual for more detail installation procedure 1 To achieve better airflow rates and heat dissipation we suggest fe that you use a high quality fan with 3800 rpm at least CPU fa
61. the Microsoft Download Center before installing HD audio driver bundled in the Driver disk Please log on to http support microsoft com default aspx scid kb en us 901105Zappliesto for more information Auto installing under Windows XP Vista 7 The Auto install DVD ROM CD ROM makes it easy for you to install the drivers and software for your motherboard If the Auto install DVD ROM CD ROM does not work on your system you can still install drivers through the file manager for your OS for example Windows Explorer Refer to the Utility Folder Installation Notes later in this chapter The support software DVD ROM CD ROM disc loads automatically under Windows XP Vista 7 When you insert the DVD ROM CD ROM disc in the DVD ROM CD ROM drive the autorun feature will automatically bring up the install screen The screen has three buttons on it Setup Browse CD and Exit k Mamnboand Setup ity EH rues UE ininereten Bes ELITEGROUP If the opening screen does not appear double click the file setup exe in the root directory Usingthe Motherboard Software 43 Drivers Tab Setup Click the Setup button to run the software installation program Select from the menu which software you want to Install Browse CD The Browse CD button is the standard Windows command that allows you to open Windows Explorer and show the contents of the support disk Before installing the software from Windows Explorer look for a fi
62. to return to the Intel Matrix Storage Manager RAID BIOS menu I7 Chapter 7 Setting Up eJIFFY Introduction eJIFFY is a fast boot program under Linux Instead of waiting Windows O S to start execution eJIFFY is ready to provide users the instant enjoyment on web browsing photo review and online chat just within several seconds after boot up B X gusto Note eJIFFY is ECS optional feature utility corresponding to the DVD activation and BIOS setup Please check the hard copy user s guide or product color box to see if the model has embodded eJIFFY feature eJIFFY icon on color box Cc Version 5 0 Setting Up eJIFFY 58 Installation and BIOS Setup DVD Activation Finish the DVD utility setup and then set the BIOS to complete eJIFFY activation 1 Insert ECS software utility DVD and enter below Utilities screen Click eJIFFY feature item to install P Mainboard Setup Utility Drivers E Information Utilities Adobe Reader eJIFFY B Select utility amp Click to install 2 Follow the onscreen instructions to finish eJIFFY setup Setup eJIFFY Welcome to the eJIFFY Setup Wizard This will install JIFFY v1 1 on your computer It is recommended that you close all other applications before continuing Click Next to continue or Cancel to exit Setup i Cancel Setting Up eJIFFY 3 After setting up eJIFFY under Windows you can switch eJIFFY display keyboard language
63. tup Help Iten Limit CPUID Harta l Disab lied Enhanced Halt CLE Enabled Specifies the boot i Bit Disabled sequence fron t he irtualization Tech Enab led aval lable dew ices EISI Enabled Quick Power on Self Test Enabled A device enclosed in Boot Up unlock Status n parenthesis has been APIC Mod Enabled disabled in the Ist Boot Device CD DUD correspomd ing Lupe 2nd Boot Bey ice Inte Unlunet SET Jrd Boot Device st FLOPPY PRIVE Hard Disk Drives Press Enter Remoeable Drives Press Enter Boot Other Device The fiowe Enter Select Ualoe F I8 Saue ESC Exit Fl General Help Fo Optinized Defaults Intel Matrix Storage Manager RAI DConfigurations 55 Deleting a RAID set 1 In the main Intel Matrix Storage Manager RAID BIOS menu highlight Delete RAID Volume using the up down arrow key then press Enter IL ItLLA 1 Create RAID Volume Reset Disks to Mon RAID z 1 lain THAT l laua j wi p D Kale MERE MM i g Ex L t 2 Use the space bar to select the RAID set you want to delete Press the Del key to delete the set 3 A dialogue box appears to confirm the action Press Y to confirm otherwise press N Inte 1L Matrix Storage Manager option HUM v 5 8 1011 ICH98 wHAIDS Copyright C 2663 87 Intel Corporation All Rights Reserved Drives Capacity Status Bootable fire you sure you want to delete Volume Y N Deleting a volume will reset the disks ta n
64. ty and exit the Setup Utility When the Exit Without Saving dialog box appears select OK to discard changes and exit or select Cancel to return to the main menu If you have made settings that you do not want to save use the Exit Without Saving item and select OK to discard any changes you have made Using BIOS 41 42 Updating the BIOS You can download and install updated BIOS for this motherboard from the manufacturer s Web site New BIOS provides support for new peripherals improve ments in performance or fixes for known bugs Install new BIOS as follows 4 If your motherboard has a BIOS protection jumper change the setting to allow BIOS flashing If your motherboard has an item called Firmware Write Protect in Ad vanced BIOS features disable it Firmware Write Protect prevents BIOS from being overwritten Create a bootable system disk Refer to Windows online help for information on creating a bootable system disk Download the Flash Utility and new BIOS file from the manufacturer s Web site Copy these files to the bootable device Turn off your computer and insert the bootable device in your com puter You might need to run the Setup Utility and change the boot priority items on the Advanced BIOS Features Setup page to force your computer to boot from the bootable device first At the C or AA prompt type the Flash Utility program name and the file name of the new bios and then press Enter
65. uage Language ay pal Arabic Deutsch German English UK English UK English US English us Espa ol Spanish Fran ais French nav Hebrew Indonesia Indonesian Italiano Italian H 258 Japanese 330 Korean Nederlandse Dutch Polska Polish Portugu s Portuguese Pycckun Russian Inu Thai T rkce Turkish YkpaiHcbka Ukrainian Viet Vietnamese ial BAZ Chinese Simplified SN Chinese Traditional cancel Bok Note Details about eJIFFY please refer to eJIFFY in disk Setting Up eJ IFFY 66 Memo Setting Up eJIFFY Chapter 8 Trouble Shooting Startup problems during assembly After assembling the PC for the first time you may experience some start up problems Before calling for technical support or returning for warranty this chapter may help to address some of the common questions using some basic troubleshooting tips a System does not power up and the fans are not running 1 Disassemble the PC to remove the VGA adaptor card DDR memory LAN USB and other peripherals including keyboard and mouse Leave only the motherboard CPU with CPU cooler and power supply connected Turn on again to see if the CPU and power supply fans are running 2 Make sure to remove any unused screws or other metal objects such as screwdrivers from the inside PC case This is to prevent damage from short circuit 3 Check the CPU FAN connector is connected to the motherboard 4 For Intel platforms chec
66. ugh optical fiber or coaxial connector Pin Signal Name Function EE E SPDIF SPDIF digital output VA 5V analog Power 3k Nb L4 GND Gone Installingthe Motherboard F USB1 3 Front Panel USB headers The motherboard has six USB ports installed on the rear edge I O port array Addi tionally some computer cases have USB ports at the front of the case If you have this kind of case use auxiliary USB connector to connect the front mounted ports to the motherboard Pin Signal Name Function Front Panel USB Power L2 usw _ Front Panel USB Power USB Port 0 Negative Signal EAT N USB Port 1 Negative Signal 5 USB FP Pot USB Port 0 Positive Signal USB Port 1 Positive Signal Ground 8 GND Ground Re Nopin Please make sure that the USB cable has the same pin assignment as indicated above A different pin assignment may cause damage or system hang up SATA1 6 Serial ATA connectors These connectors are used to support the new Serial ATA devices for the highest date transfer rates 3 0 Gb s simpler disk drive cabling and easier PC assembly It elimi nates limitations of the current Parallel ATA interface But maintains register com patibility and software compatibility with Parallel ATA Pin Signal Name Pin Signal Name 3 pm 4 Goma 5 RX 6 Re 27 Ground J l y CD IN Analog Audio Input connector Pin Signal Name Function CD In left channel Installing th
Download Pdf Manuals
Related Search
Preface preface definition preface synonym prefaced meaning preface pronunciation preface of a book preface vs introduction preface vs prologue preface to lyrical ballads preface for project preface vs foreword preface geely preface adalah preface coffee preface hall prefaces crossword preface to leaves of grass preface to oregon revised statutes preface ohio state
Related Contents
Pystol Label - ePestSolutions メンテナンス作業における注意点と工具豆知識 - Dataman Programmers Ltd. 00 HUBERMAN.book Samsung 932BEPLUS User Manual 「装甲車輪 ゴローダーGT」をお買い上げのお客様へ Previews of FLAAR Report Series on Evaluations of Printers Plena A - Port. Rev.2 3 - Speedway Sales & Service Victory II Copyright © All rights reserved.
Failed to retrieve file