Home

current price list - Jaycee Electronics Ltd

image

Contents

1. 30 meter 1 2 wave end fed Zepp antenna 40 meter 1 2 wave end fed Zepp antenna Waistpack for 9 different tools 15 meter 2 element colinear array antenna 17 meter 2 element colinear array antenna 20 meter 2 element colinear array antenna 30 meter 2 element colinear array antenna 40 meter 2 element colinear array antenna Instrument case with universal foam insert Spare universal foam insert for MFJ 6404 24 piece nuts screws driver with light Gardner bender forged crimp tool to install powerpoles without soldering Adaptor SO 239 to SO 239 PL 258 Adaptor PL 259 to PL 259 PL PL Adaptor right angled PL 259 to BNC socket Adaptor BNC plug to two banana plug sockets Adaptor N plug to SO 239 NC 1465 Adaptor NMO to SO 239 Adaptor BNC plug to SO 239 NC 1520 Shortwave regenerative receiver kit Shortwave regenerative receiver ready built Micro ATV transmitter 1 channel not UK standard Micro ATV transmitter 4 channels not UK standard ATV transmitter 4 5 Watts not UK standard 15m QRP CW transceiver 5 Watts 12 Volts 21 000 21 200MHz 17m QRP CW transceiver 5 Watts 12 Volts 18 068 18 110MHz 20m QRP CW transceiver 5 Watts 12 Volts 14 000 14 075MHz 30m QRP CW transceiver 5 watts 12 Volts 10 100 10 150MHz 40m QRP CW transceiver 5 Watts 12 Volts 7 000 7 150MHz 6 band CW transceiver 80 40 30 20 17 15m 5W 12V comes with 1 band of your choice 80m band module for MFJ 9200 40m band modul
2. KSKK Standard brass straight key without wooden base kit 69 95 KT 1 Standard brass straight key with steel base assembled 108 95 MPO Morse practice oscillator assembled 29 95 MPOK Morse practice oscillator kit 15 95 KPKT Touch paddle key and keyer ki 39 95 HKA KT1 Conversion kit to change a HKA to a KT 1 41 95 KENWOOD NEXEDGE PMR TRANSCEIVERS AND ACCESSORIES KVT 11 Image encoder for wireless image system 359 95 KAS 11 Image viewer software for wireless image system 92 95 NXR 800E4 Digital amp FM base repeater 400 430 amp 440 470MHz 5 25W 30ch c w mount DC cable handle 2 469 95 KMC 9C Control station desktop microphone for NXR 800 62 95 KMC 30 Hand microphone standard for NXR 800 30 95 KMC 35 Hand microphone heavy duty for NXR 800 38 95 KXK 3M2 High stability TCXO 1 per site only required for 6 25KHz tuning for NXR 800 699 95 KES 5 External speaker for NXR 800 36 95 KPG 109DM Programming software for NXR 800 49 95 KPG 110SM Programming software for trunking network for NXR 800 234 95 KSL 1TR Trunking software licence per repeater for NXR 800 769 95 KSL 2NW Multi site network software licence per repeater for NXR 800 1 399 95 NXR 710E Digital and analogue FM base transceiver VHF 136 174MHz 5 50W 30ch clw mount DC cable handle 2 149 95 NXR 810E Digital and analogue FM base transceiver UHF 400 470MHz 5 40W 30ch cw mount DC cable handle 2 149 95 KTI 3 Network interface uni
3. ui ui ui ui Medium duty rotator Medium duty rotator with variable presets Heavy duty rotator with variable presets Heavy duty rotator with variable presets Azimuth elevation rotator system Heavy duty Azimuth rotator with presets Lower mast clamps for RC5 1 3 High gain compact and light weight trap beam for 7 21 28MHz Spare connector plug for Create rotators control cable input Spare rotary 17 degree potentiometer 5 K Ohm for Create rotators Spare cog gear for R30 50 1300 MHz 10 12dBi gain Log periodic type N type 21 ele 2m boom 3 95 3 95 3 95 3 95 3 95 3 95 3 95 3 95 3 95 5 95 3 95 3 95 3 95 3 95 3 95 4 95 4 95 4 95 4 95 4 95 2 95 2 95 2 95 2 95 2 95 2 95 2 95 2 95 2 95 2 95 2 95 2 95 2 95 2 95 2 95 2 95 0 99 0 99 0 99 2 95 2 95 0 99 0 99 0 99 0 99 2 95 0 99 0 99 0 99 0 99 0 99 0 99 0 99 0 99 0 99 0 99 0 99 0 99 0 99 2 95 2 95 2 95 0 99 0 99 2 95 2 95 0 99 0 99 0 99 0 99 0 99 0 99 0 99 0 99 0 99 0 99 0 99 7 95 2 95 2 95 2 95 0 99 0 99 3 95 2 95 2 95 2 95 0 99 0 99 0 99 0 99 1 95 1 95 5 99 7 99 2 95 0 50 0 50 0 75 0 75 0 99 0 99 429 95 519 95 729 95 1 029 95 1 249 95 1 189 95 99 95
4. amp 399 95 14 95 30 95 175 95 31 95 37 95 18 95 18 95 18 95 18 95 84 95 19 95 124 95 28 95 63 95 79 95 84 95 10 95 31 95 18 95 8 95 46 95 72 95 27 95 57 95 PMR transceiver 136 174MHz VHF 16 channel c w BC 193 BC 06 BP 265 MB 124 amp antenna 165 95 PMR transceiver 400 470MHz UHF 16 channel c w BC 193 BC 06 BP 265 MB 124 amp antenna 165 95 175 95 E 8 95 31 95 5 95 31 95 8 95 8 95 8 95 8 95 27 95 27 95 57 95 8 95 126 95 27 95 2 95 74 95 8 95 73 95 27 95 57 95 C3 eC e r I C3 C C3 CO CC CH C CCC C3 OCE C3 eC r e I C3 EC CT CC Tee PIPP T r C C3 C3 C3 C3 C e D C3 T SPOS SPOSFOS SESS e Te e e CC CT C3 TOC Te Te e r C C3 C3 e e C C1 C3 C3 HM 166L HS 94 HS 95 HS 97 MB 93 MB 94 MB 96F MB 96N OPC 478 OPC 478UC OPC 656 UT 108 UT 109R UT 110R UT 124R VS 1L CS F3020 SM F3020 IC F34GS IC F34GT IC F44GS IC F44GT AD 106 BC 06 BC 119N F34 44 BC 121N F34 44 BC 145 BC 157 BC 160 BP 231 BP 232N FA SC24V FA SC25U FA SC55V FA SC57US FA SC72U FA SC57VS FA SC73US HM 46L HM 128 HM 131 HM 153L HM 158LA HM 159L HM 166L HS 94 HS 95 HS 97 MB 93 MB 94 MB 96 MB 96N MB 103 OPC 478 OPC 478UC OPC 656 UT 109 UT 110 UT 113 UT 124 EARPIECE 003 VS 1L CS F33 SM F34 44 IC F5
5. erial for DJ X2000 belt clip for DJ G5 X10 X2000 belt clip for DJS 41C belt clip for DJ V17 Nicad pack 3 6V 700mAh for DJ S41 DJ SR1 Nicad pack 6V 700mAh for DJ V5 Nicad pack 9 6V 600mAh for DJ V5 Battery pack for DJ C5 NiMH battery for DJ S40CQ 3 6V 500mAh black NiMH battery for DJ S40CQ 6V 500mAh NiMH battery for DJ S40CQ 3 6V 1500mAh Battery pack for DJ S45CQ Ni MH battery for DJ X2000 needs EDC 133E AC charger for EDC 97 2 pin EDC 97 now EDC 133 Charger for DJ C1 4 5 Was EDC 77 Quick charger for DJ C1 4 5 Was EDC 77 DJ S40 DJ S446 DJ X3 Drop in battery charger for DJ S40CQ needs EDC 148 Charger for EBP 56N Trickle charger Adaptor UK fast UK trick Adaptor AC ada AIC ada DC cabl Quick cl charger for DJ S45CQ le charger for DJ V17 its DJV range ptor for EDC 144 ptor for EBP 12N le with filter for DJ 190 491 491 G5 V5 X10 X2000 V17 arger 120V A C for DJ X10 X2000 Charger for DJ C1 C4 C5 X2 2 pin Mobile DC cable for DJ F S X 580 AC quich Dry cell k charger for DJ 193 195 496 493 was EDC 97 case for DJ X2000 DC DC converter for DJS 11 41 R1 Charger tray for Lithium ION battery for DJ C1 4 5 Spare dry cell case for DJ S40CQ 3 x AA black Junction box for DR 610 2 remote cables needed Adaptor cable for audio accessory of DJ C1 4 5 Modular pin cable for EMS 14 DTMF el CTCSS Addition Smartru Digital v Digital s H
6. 3 TOO GOGO Oa KOG K KO OOO OO EOG OGO OOE OOO TOO TOO K T OOO OOO OOO KOG OOO OOO KOG KO OOO OOO E ECC G CC DH C3 CCI C3 C3 DOG CG3 ECC MLS 100 YH 77STA ATAS 120A ATBK 100 ATAS 25 FC 30 FC 40 YA 007FG TCXO 9 YF 1225 YF 122C YF 122CN SCU 17 CT 62 CT 39A YSK 857 MMB 82 79019925 79101530A FT 817ND FT 817BHIDSP MD 200A8X MD 100A8X MH 31A8J MH 36E8J MLS 100 YH 77STA ATAS 25 TCXO 9 YF 1228 YF 122C YF 122CN FNB 85 PA 48U PA 48C SCU 17 CT 62 CT 39A CSC 83 YHA 63 CP6863001 6000397 79023003 YAESU REPEATER amp ACCESSORIES DR 1XE MH 48A6JA MH 42C6J FVS 2 HRI 200 CT 174 CT 175 High Power external speaker for FT 857 Open air type stereo headphones for FT 857 Active tuning mobile aerial for FT 857 Antenna base kit for ATAS 120 Manual tuning mobile aerial for FT 857 External automatic ATU for FT 857 Auto ATU with 200 memories for end fed wire or long whip Mobile whip 7 54MHz for FC 40 High stability crystal 0 5ppm for FT 857 Collins SSB filter 2 3 kHz 4 7kHz for FT 857 Collins CW filter 500Hz 2KHz for FT 857 Collins CW filter 300Hz 1KHz for FT 857 USB interface unit for FT 857 CAT interface cable for FT 857 Packet interface cable for FT 857 Separation kit for FT 857 Spare Mobile mount bracket for FT 857 now Part number RA0476100 Spare DC power cord for FT 857 WDC HF6 Spare short cable between head and main unit of FT 857D 1 8 430MHz 5 Watts all mode Ni MH battery charger amp DC
7. 14 95 16 95 20 95 32 95 36 95 46 95 54 95 36 95 25 95 22 95 24 95 54 95 49 95 34 95 28 95 22 95 99 95 26 95 32 95 32 95 32 95 31 95 27 95 29 95 27 95 29 95 389 95 379 95 Mobile whip for HF 200W manual screwdriver aerial 7 30MHz 40 30 20 17 15 12 10 needs MDC730HX 96 95 Coil for HF 200W manual screwdriver aerial 7 30MHz 40 30 20 17 15 12 10 needs MD200 219 95 80m 3 5MHz mobile whip 120W 1 4m long PL 259 40m 7 7 2MHz mobile whip 200W 1 4m long PL 259 30m 10MHz mobile whip 220W SSB 1 4m long PL 259 69 95 62 95 62 95 DVVVVVVVVVVOVVCOVVNNNVVNVVNNNVVVVVVVVVVCNNVVVVVVCNNOSF SSF T GOGO GOGO GGO GOGO GOGO GOGO GQGOGOGOOGOGOGOGOGOGOO AAADDADAADAADAADAAIAIAIANAND La alaa aaa a OOG G HF20FX HF16FX HF15FX HF12FX HF10FX HF6FX HF80CL HF40CL HF20CL HF15CL HF16CL HF15CL HF10CL HF6CL OPE 750 SR 780 AZ 504 AZ 504FX AZ 504FXH AZ 504SP AZ 505 AZ 505N AZ 505SP AZ 506 AZ 506SP AZ 506FX AZ 506FXH AZ 507R AZ 507RSP AZ 507FX AZ 510 AZ 805M AZ 505N AZ 510FX AZ 510N AZ 910 lt Q 14CX 73A E L LL Z 0 ET L L N fo a R2C P TRY2E R22L R22LH R 77AM R 770H R 770HB R 770HSP R 770R R 770S R 770RB R 770RSP R 780R R 2000N R 7700 R 7900 RHM 10 RHM 8B RHV 5 SG 2000 SG 7000 SG 7100R SG 7200 SG 7400 SG 7500 SG 7700 SG 7900 SG 9500M SG 9500N SG 9600 SG 9700 SGM 507 SGM 505 SGM 803N SGM 80
8. 2 50 1 95 4 95 2 50 1 50 4 95 4 95 0 99 hr M M M M m m 469 95 329 95 259 95 849 95 239 95 349 95 439 95 TO e K e e T K T T T K T T K T T T K T T K O TOHO OOO reread T e e K T Te T e REE REE REE REE REE REE REE REE REE REE REE REE REE REE REE REE REE REE REE REE REE TK e e K e T T K T T K T T e K T T HHH QAAANQ9N9N90 MINI 32 AW HF 3 element beam antenna 10 12 15 17 20m 1kW SSB 6 boom element length 19 6875 449 95 C MINI 33 AW HF 3 element beam antenna 10 12 15 17 20m 1kW SSB 6 boom element length 19 6875 539 95 C MP 33 N HF 3 element beam antenna 10 15 20m 2kW SSB 499 95 C MP 33 NW HF 3 element beam antenna 10 12 15 17 20m 2kW SSB 649 95 C RV 6C HF vertical antenna 10 12 15 17 20 40m 2kW SSB 21 feet long 379 95 C C SR WARC KIT Conversion kit adds 12 and 17 meters to MP 33 TA 32 M TA 33 M TA 34 M 249 95 C C TA 30 KR Conversion kit adds 30 meters to MP 33 and TA Senior antennas 279 95 C C TA 40 KR Conversion kit adds 40 meters to MP 33 and TA Senior antennas 299 95 C MOTOROLA XT 420 PMR 446 transceiver with battery amp Charger 16ch 159 95 C XT 420NC PMR 446 transceiver with battery 16ch no charger 139 95 C XT 460 PMR 446 transceiver with battery amp Charger amp LCD display 16ch 169 95 C PMLN6385 6 way charger for XT 420 460 219 95 A 11ACH4040M1A Earpiece microphone for
9. 22 Main Road Hockley Essex S55 405 UK Opening Hours 9 00 17 30 Monday Saturday Orderline 01702 206835 Enquiries 01702 204965 Fax 01702 205843 E mail sales wsplc com Web www wsplc com R Se mae Jaycee Electronics Ltd Aa ERa 20 Woodside Way A Glenrothes LS Fife KY7 5DF UK Opening Hours 9 15 17 00 Tuesday Friday 9 00 16 00 Saturday Orderline 01592 756962 Enquiries 08455 050128 Fax 01592 610451 E mail jayceecoms aol com Web www jayceecoms com P Over 7 000 Products Online Call Now 01702 206835 MAIL ORDER INFORMATION The following will speed your order or enquiry giving you the security you expect when dealing with a firm that has been in business for over 40 years Here is a list of just some of our staff who are there to help you DIRECTOR PETER WATERS G30JV DIRECTOR JEFF STANTON M3JJS GENERAL MANAGER STEVE HOY G7JPU AMATEUR RADIO SALES JUSTIN JOHNSON GOKSC AMATEUR RADIO SALES SIMON WILKINSON M5AEJ AMATEUR RADIO SALES HUW LILLYWHITE 2E0HTL AMATEUR RADIO SALES DAN THOMAS M6FRX CUSTOMER SERVICE MANAGER KRIS WISE M6KTW SERVICE MANAGER STEVE DAVIES M1EZE W amp S AMATEUR RADIO CLUB GOPEP Our full address is Waters amp Stanton Ltd Spa House 22 Main Road Hockley Essex SS5 4QS UK TELEPHONE 01702 206835 or 01702 204965 FAX 01702 205843 Email sales wsplc com The first telephone number has an answering machine in use outside of office hours Sho
10. 24 95 44 95 27 95 69 95 69 95 99 95 79 95 19 95 29 95 59 95 29 95 31 95 34 95 32 95 34 95 46 95 39 95 32 95 48 95 rrrrrrrrrrTradnerFaannrnandrndnnoFrrFaoaYrrradorrrrrrrarrradraoa CPCI C PCO CF PCT I a OFC C1 C1 ee ee C1 CC CT P P PE P I ae P 6 CT CH E C1 C3 C1 PE PERPE PDP I ee ee ee e T ERW 5A Eprom writer for DJ 680 ESC 15 Leatherette case for DJ F S X1 ESC 18Z Leatherette case for DJ 180 280 therett ESC 23 Leatherette case for DJ G1 ESC 34 Leatherette case for DJ C5 ESC 27 Leatherette case for DJ S11 41 R1 ESC 35 Leatherette case for DJ V5 and EBP45 46 ADFM78 Spare mobile mounting bracket for DR M03 06 NBPA 1 Nirad pack for DJ S11 41 R1 UA 38 Spare DC lead for DR 130 430 UA 52 Spare DC cable for DX 70 AMERITRON LINEARS amp ACCESSORIES AL 1500XCE Linear Amplifier 10 160m 1 5kW 1 x 3CX1500 AL 1500XQCE Linear Amplifier 10 160m 1 5kW 1 x 3CX1500 with QSK 5 installed ALS 1306X Linear Amplifier solid state HF amp 6m 1200W PEP output and 220V mains PSU AL 1200XCE Linear Amplifier 10 160m 1 5kW 1 x 3CX1200 AL 1200XQCE Linear Amplifier 10 160m 1 5kW 1 x 3CX1200 with QSK 5 installed AL 82XCE Linear Amplifier 10 160m 1 5kW 2 x 3 500Z AL 82XQCE Linear Amplifier 10 160m 1 5kW 2 x 3 500Z with QSK 5 installed AL 800XCE Linear Amplifier 10 160m 1 25kW 1 x 3CX800A7 AL 800HXCE Linear Amplifier 10 160m 1 5kW 2 x 3CX800A7
11. 30 95 41 95 69 95 47 95 91 95 50 95 33 95 129 95 48 95 61 95 39 95 244 95 229 95 244 95 229 95 244 95 UHF handy 400 430MHz 12 5 20 25KHz 1 4W 128 CH needs aerial battery charger no keypad 229 95 VHF short antenna 146 162MHz for TK 2170 3170 VHF short antenna 162 174MHz for TK 2170 3170 VHF short antenna 136 150MHz for TK 2170 3170 VHF antenna 146 162MHz for TK 2170 3170 VHF antenna 162 174MHz for TK 2170 3170 VHF antenna 136 150MHz for TK 2170 3170 UHF short antenna 440 490MHz for TK 2170 3170 UHF short antenna 400 450MHz for TK 2170 3170 UHF antenna 440 490MHz for TK 2170 3170 UHF antenna 400 450MHz for TK 2170 3170 Ni Cd battery 1200mAh for TK 2170 3170 Ni MH high capacity battery 2000mAh for TK 2170 3170 Dry cell case 6 x AA for TK 2170 317 Rapid charger for TK 2170 3170 for TK 2170 3170 Regular charger for KNB 25A and KNB 26N for TK 2170 3170 6 way charger for KNB 35L 26N 25A TK 2170 3170 Optional wall hanging bracket for KSC 256T for TK 2170 3170 Nylon case with belt clip for TK 2170 3170 Leather case with metal clip for TK 2170 3170 Leather case with swivel for TK 2170 3170 Clip microphone with D type earpiece for TK 2170 3170 Spare belt clip for TK 2170 3170 Acoustic tube earpiece for connection to speaker mic for TK 2170 3170 Headset with VOX PTT for TK 2170 3170 Over the head heavy duty headset with boom microphone for TK 2170 3170 Headset boom mic less VOX for TK 2170 3170
12. 31 95 284 95 23 95 61 95 19 95 26 95 23 95 22 95 37 95 19 95 4 95 809 95 799 95 799 95 28 95 61 95 6 95 6 95 23 95 22 95 4 95 144 95 374 95 579 95 564 95 564 95 28 95 61 95 209 95 21 95 23 95 22 95 37 95 12 95 4 95 31 95 284 95 31 95 199 95 219 95 299 95 14 95 8 95 24 95 5 95 13 95 19 95 34 95 9 95 11 95 11 95 52 95 52 95 16 95 16 95 10 95 1 599 95 21 95 8 95 145 95 17 95 54 95 15 95 3 95 14 95 25 95 20 95 999 95 19 95 8 95 145 95 14 95 54 95 15 95 3 95 14 95 20 95 OQDI PPKP CTC C CTC C C D D Dw Ep OOOD P m pop C CTC H p Ca CC C a O ET O SSS e C C nC C D e EC T T 00 T T 0 T T T T T T C1 CC TK O KO T OD T e K OD O T K C3 CP 500 Marine GPS chart plotter 12 colour TFT screen 3000 waypoints 50 routes with external aerial 1 299 95 79101553 Power cable for CP 500 15 95 8002251 Mounting bracket for CP 500 63 95 UXOGPL10SD GPS antenna for CP 500 145 95 8002252 Protective dust cover for CP 500 17 95 ACVC10 DVD or VCR adaptor cable for CP 500 14 95 VGAC10 VGA adaptor cable for CP 500 25 95 CPF 3001 Chart plotter fish finder needs transducer 7 inch colour screen 729 95 79101553 Power cable for CP 300 15 95 HBS27BX Mounting bracket with knob for CP 300 16 95 UXOGPL10SD GPS antenna 145 95 8002235 Protective dust cover for CP 300 15 95 ACVC1
13. 35 95 35 95 35 95 35 95 35 95 35 95 35 95 35 95 32 95 35 95 35 95 35 95 35 95 35 95 35 95 35 95 4 95 12 95 12 95 37 95 21 95 8 95 16 95 21 95 21 95 21 95 21 95 21 95 21 95 29 95 4 95 9 95 4 95 4 95 4 95 3 95 7 95 7 95 7 95 4 95 54 95 109 95 9 95 9 95 9 95 10 95 7 95 6 95 6 95 6 95 6 95 5 95 5 95 10 95 10 95 6 95 5 95 5 95 5 95 5 95 5 95 5 95 5 95 18 95 10 95 6 95 7 95 5 95 39 95 59 95 69 95 229 95 69 95 89 95 42 95 T K T T K T T T 3 T T K K T T K T T T K T T K T T T K T T K K T T K T T T K T T e K T T K T T T K T T K T T T K T T T T T T 3 C3 T T p P Te oe P I E E E Re De OC C09 0 E PE ETC e P A E C1 TE COE C3 3 C3 d HOKA CODE300 32 Windows 32 bit software based demodulator decoder and analyser version 3 06 CODE300 32EXTEND Software based demodulator decoder analyser runs 2 copies for 4 channel input CODE300 32P CODE3 32P CODE300 UPG P UPDATE 3 05 HIGH SIERRA BRONZE GY CINCH ELDORADO BK ELDORADO GY EZ TUNE I BOX EZ TUNE K BOX EZ TUNE K BOX HP HS 160 HS 200 HS 202CL HS 214CL HS 800 PRO HS UNIVERSAL MASTER MSQD SADDLE SPURS STAKE HOLE WHIP HS 103 PC Windows 32 bit software based demodulator decoder and analyser with Perseus control Lite version of code300 32P with Perseus control no remote contr
14. 359 95 25 95 25 95 10 95 349 95 Te K e e e T T e K T e e T T T K T T K e T T K T T T e e e K T T T e T T K K T T K T T T K T e K K T T K T T e e T T e T e T K T T K K T e e e T T e T T K e e T e T T e K T T e T e T K T T T T T T e T G TGO GGO 0000 CLP5130 2N 105 1300 MHz 11 13dBi gain Log periodic type N type 17 ele 1 4m boom 730V 1A V type dipole with rigid radials 40 20 15 10 6m AFA 30 2 element beam for 30m CV 48 80 40m antenna AD 385 80m switch box for CV 48 248 A 18 24MHz 3 4 element beam antenna 318 14 21 28MHz 3 element beam antenna CUSHCRAFT MULTIBAND HF ANTENNAS XT 10 15 amp 20m 7 element yagi 2KW 5 48m long 12 5 13dB gain X 740 40m add on kit for X7 A 3S 10 15 amp 20m 3 element yagi 8dB gain 2KW 4 27m long A 743 7 MHz 10 MHz add on kit for A3S A4 S 10 15 amp 20m 4 element yagi 8 9dB gain 2KW 5 48m long A 744 7 MHz 10 MHz add on kit for A4S CAP KIT A4S AAS replacement cap kit CAP KIT A3S A3S replacement cap kit A3 WS 12 amp 17m 3 element yagi 8dB gain 2KW 4 27m long A 103 10 MHz add on kit for A3 WS ASL 2010 13 5 32MHz 8 element log periodic 6 4dBd gain 5 48m long MA 5B 10 12 15 17 20m 3 element mini beam with balun R 6000 6 10 12 15 17 amp 20m vertical 5 8m long R 9 80 6m 9 band vertical 1 5kW 31 5 tall R 8 40 6m vertical 1 5kW 8 7m long R8 GK Guy kit for R 8 or R 9 vertical R8 TB Tilt base for access for R 8 or R 9 vertical MA 5VA 10
15. 64 95 7 95 10 95 6 95 14 95 54 95 28 95 144 95 249 95 81 95 22 95 86 95 139 95 104 95 43 95 63 95 68 95 62 95 69 95 79 95 119 95 199 95 149 95 99 95 79 95 42 95 55 95 64 95 9 95 29 95 59 95 9 95 7 95 9 95 16 95 16 95 7 95 11 95 7 95 23 95 32 95 19 95 29 95 39 95 11 95 34 95 39 95 54 95 29 95 54 95 34 95 29 95 69 95 49 95 59 95 94 95 99 95 74 95 92 95 34 95 59 95 62 95 54 95 36 95 21 95 59 95 18 95 19 95 59 95 51 95 19 95 19 95 24 95 12 95 12 95 14 95 14 95 19 95 19 95 19 95 12 95 12 95 19 95 19 95 14 95 14 95 12 95 8 95 9 95 9 95 12 95 9 95 12 95 9 95 52 95 45 95 45 95 45 95 29 95 29 95 21 95 21 95 21 95 21 95 19 95 16 95 21 95 CI a a E AAARNAAAFAA0 PPP PrP Pr PSP SPOSISF OIA oo O DOF SFOFVVIVVVVIGINAAAAANADTDAAADAAAAD PP PS y CIS CI LY eS PO ee PP E EE Pe PP ee AT 10 Portable 10m whip with BNC AT 6 Portable 6m telescopic whip with BNC AT 4 BNC Portable 4m rubber duck type flexible whip antenna with BNC 19 5cm long AT 4 SMA Portable 4m rubber duck type flexible whip antenna with SMA plug 21cm long AT 2 Portable 2m whip with BNC plug AT 70 Portable 70cm whip with BNC
16. 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 93 95 93 95 93 95 239 95 139 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 56 95 19 95 199 95 60 95 ATAT C C CE EE EE E C C CE E E E E ETC COT Tip C E C C3 CTC CE C EC CECI CC CC C CT C3 EEE EEE CT C3 CTC CE E CC EC CC CTC CE EE EEE CC CT CCC E EC E CTC CC CC C EEE EEE CTE C C CTC E C C EFE CF 300 Dummy load N type socket 50 Ohm 300W max DC 1 2GHz PR 145A 2M 100 Watt mast head pre amplifier 16db gain 0 9db NF PRH 145A 2M 500 Watt mast head pre amplifier 20db gain 0 9db NF PR 430A 70cms 100 Watt mast head pre amplifier 15db gain 1 2db NF PRH 430A 70cms 500 Watt mast head pre amplifier 20db gain 1 3db NF PR 2B 2m 70cms dualband 100W mast head pre amplifier 16d gain PR 162A 162M 100 Watt mast head pre amplifier 16db gain 0 9db NF PL 259 PT 105A 5 Amp 13 5V DC stabilized power supply PT 107A 7 Amp 13 5V DC stabilized power supply PT 114A 10 Amp 13 5V DC power supply with interface for external emergency battery PM 110A 10 Amp 13 5V DC power supply with built in speaker and tra
17. 77 95 111 95 hr h Mh Mh m m m m m m m m m m m Mrmr mmm mmm mm mm m m m QDIOFOIDDODSSFSSSKSSFKSFSESFIIVIIDIIIAIAIAAIAADADADDSEESFADIVWVIVIVIFSDIDDIDDDADAADAADAADAADDIDADADDDDADAADAADAADADAADADDADADAADAADAADAADADIDDSSSEYSEOQVSFOVIVIVFSOVYSYSYSYSYSYSYSYSYKSYKSKrKrKrKrKrryryrrrrrrrorry 726 731 751B 752D 762 784B 801 802B 802R 802BX 805 812B 813 815D 816 817C 818 822 826B 828 834 834H 835 836 836H 842 844 850B 852 853 853H 854 856 860 862 864 867 868B 869 870 872 873 874 886B 890UK 901B 902B 902H 903 904 904H 906 907 908 909 910 911 911H 912 913 914 915 916B 916BN 917 918 919 921 923 924 925 926B 927 928 929 931 933 934 935B 936B 9391 939K 939Y 941E 941EK 945E 948 949E 956 959C 962D 969 971 974B 974HB 976 986 989D 991B 993B 993BRT 993RC 994B 994BRT 998 998RT 1020C 1022 1024 1025 1026 1040C 1045C 1046 1048 1106 Plug in audio filter for MFJ 9020 Tunable RF filter for accurate SWR and impedance 1 8 30MHz SSB CW audio filter with tunable peak and notch filter All mode dual tuneable audio filter Step attenuator gives you 81dB attenuation in 1dB steps Super tunable DSP filter General purpose field strength meter Field strength meter 100KHz to 500MHz Remote sensing head for 802 MFJ 802 amp MF
18. AM 8 PM AM 8 GM AM 8 WM AM 10 5 GM AM 12 GM AM 10 5 PM AM 12 PM AM 10 5 WMP AM 12 WMP AM 10 5 WMMT AM 12 WMMT AM 10 5 WMWT AM 12 WMWT 20m XTAL 14 050 14 100MHz for Mizuho radios 20m XTAL 14 300 14 350MHz for Mizuho radios 80m XTAL 3 500 3 525MHz for Mizuho radios 80m XTAL 3 525 3 550MHz for Mizuho radios 80m XTAL 3 550 3 575MHz for Mizuho radios 80m XTAL 3 725 3 750MHz for Mizuho radios 80m XTAL 3 750 3 775MHz for Mizuho radios 80m XTAL 3 775 3 800MHz for Mizuho radios 6m XTAL 50 050 50 100MHz for Mizuho radios 40m XTAL 7 075 7 100MHz for Mizuho radios Square shaped long mast 2m tall 26 5cm wide with 6 5cm 2 5 hole on the top Triangular shaped short mast 1 5m tall 31cm wide with 6 5cm 2 5 hole on the top Freestanding 15m 90 x 90mm steel mast with remote winch FULLY INSTALLED 10m tilt over steel box section mast free standing or wall mounting 12m tilt over steel box section mast free standing or wall mounting 10m tilt over steel box section mast wall mounting state 18 24 Or 36 stand off required 12m tilt over steel box section mast wall mounting state 18 24 Or 36 stand off required Wireless remote controlled winch for elevation needs car battery amp solar panel 8m post mounted manual tilt over heavy duty aluminium mast with base plate 8m ground mounted manual tilt over heavy duty aluminium mast with post needs concrete base 8m wall mounted manual tilt over heavy duty aluminium ma
19. FT 857D HF 6m 2m 70cm all mode transceiver including DSP 100W amp YSK 857 MD 200A8X Desk microphone for FT 857 MD 100A8X Desk microphone for FT 857 MH 31A8J Spare hand mic for FT 857 MH 36E8J DTMF hand microphone for FT 857 MH 59A8J Remote control DTMF hand microphone for FT 857 109 95 31 95 1 049 95 114 95 919 95 899 95 3 999 95 3 299 95 189 95 99 95 34 95 39 95 69 95 14 95 399 95 399 95 399 95 169 95 109 95 25 95 329 95 1 099 95 129 95 29 95 1 899 95 189 95 99 95 34 95 39 95 69 95 399 95 399 95 399 95 169 95 109 95 129 95 39 95 14 95 79 95 269 95 29 95 1 099 95 189 95 99 95 34 95 39 95 69 95 14 95 399 95 399 95 399 95 169 95 39 95 109 95 109 95 269 95 29 95 1 139 95 189 95 99 95 29 95 49 95 69 95 299 95 79 95 209 95 269 95 12 95 16 95 29 95 499 95 189 95 99 95 29 95 49 95 29 95 69 95 299 95 79 95 209 95 269 95 109 95 16 95 7 95 m m m 189 95 99 95 29 95 49 95 29 95 69 95 119 95 299 95 79 95 209 95 239 95 269 95 189 95 9 95 9 95 9 95 09 95 29 95 12 95 109 95 209 95 119 95 89 95 14 95 18 95 629 95 189 95 99 95 29 95 49 95 49 95
20. hm low loss airspaced coax per metre 100m drum of 75 Ohm twin feeder 75 Ohm twin feeder per metre 100m drum of 75 Ohm coaxial cable per metre mil spec 6 15mm diameter 75 Ohm coaxial ca 100m drum of 300 ble per metre mil spec 6 15mm diameter per metre Ohm ribbon 300 Ohm ribbon per metre 100m drum of 300 300 Ohm slotted ri 100m drum 450 OI 450 Ohm low loss Ohm slotted ribbon bon per metre m low loss ladder line ladder line per metre 1KW 100m drum of Satellite TV coax 75 Ohm Satellite TV coax 7 100m drum of sing Single core screen 100m drum of two 100m drum of four TV FM white 75 Ol Red black 1 5 amp 100m drum of redi Red black 2 5 amp 100m drum of redi Re 100m drum of redi Red black 10 amp 100m drum of redi I m L m I m I Red black 15 amp 100m drum of redi Red black 25 amp 5 Ohm per metre e core screened cable ed per metre core each screened cable wo core each screened per metre core each screened cable Four core each screened per metre 100m drum of TV FM white 75 Ohm coax cable m coax per metre 100m drum of TV FM brown 75 Ohm coax cable TV FM brown 75 Ohm coax per metre 100m drum red black 1 5 amp DC power cable DC power cable per metre lack 2 5 amp DC power cable DC power cable per metre black 6 amp DC power cable black 6 amp DC power cable per metre lack 10 amp DC power cable DC power cable per metre lack 15 amp DC power cable DC power c
21. 19 95 25 95 25 95 28 95 25 95 19 95 19 95 19 95 18 95 18 95 24 95 17 95 24 95 PPPE T K T T e K T T K T T T K T T K T T K K T T K T T oll D T T K T T T K T TO HOO T e K T T K K T T K T TO HOO LOLS LOLS OOO lee OOO lokeisigigii iv ie le ie ke kok ek el eS eo 2k KK K T T T TOO e T K T T S E E ee ee E E E eS ee A Se 2 E 2 Se ee ee Ee ee ee eS ee eS ee 2 eS ee ee E 296K 296R 296Y 297 299 301 302 310 310S 332B 332S 333BM 333BS 335BM 335BS 335BT 336S 336M 336T 340 341M 341S 3415S 342T 342S 343 344 345S 345T 347 348S 348T 382 383 385B 388 389 390 392B 3931 393K 393Y 393MI 393MK 393MY 401D 402 403 403P 407D 412 413 414 415B 416 417 418 422D 422DX 434B 441 442 442X 447 451 451X 452 452X 461 462B 464 490 490X 492 492X 495 550 551 552 554 554X 557 561 561K 564 564B 616 618 624E 633 640 643 644 645 652 653 654 655B 662 700A 700A4 700B 700B4 700C 700C4 700D 700D4 700P9 701 702B 704 705 706 711B 714 722B PTT lock and volume control for Kenwood Speaker mic with PTT lock and volume control for VX 7R Speaker mic with PTT lock and volume control for VX 5R Desk microphone with flexible boom Deluxe desk top microphone with equaliser Speaker microphone ear bud 3 5mm plug Speaker microphone ear speaker
22. 19 95 TOO FOF K ODO K KFS K 99 TOG TK T K K WO DG K K K K K K OH H T K K K K C3 Frarrrrandrorrarrao FrrrrarrarndndgFIdDSFFOYFSESESrYSrSrKrrrroarroor yS FEP 4 Ear phone stereo for BH 1A for VX 8DE FGPS 2 GPS antenna unit for VX 8DE needs CT 136 or MH 74A7A FNB 101LI Spare rechargeable Lithium lon battery pack 7 4V 1100mAh for VX 8DE FNB 102LI Rechargeable Lithium lon battery pack high capacity 7 4V 1800mAh for VX 8DE MH 74A7A Speaker microphone waterproof FGPS 2 optional GPS antenna can be attached for VX 8DE PA 46U Battery charger for bluetooth needs CD 40 for BH 1A and BH 2 for VX 8DE 3 pin UK new style PA 46C Battery charger for bluetooth needs CD 40 for BH 1A and BH 2 for VX 8DE 2 pin Euro new style NC 86U Spare charger and battery charger for CD 41 for VX 8DE 3 pin UK old style NC 86C Spare charger and battery charger for CD 41 for VX 8DE EURO 2 pin old style PA 44U Spare charger and battery charger for CD 41 for VX 8DE 3 pin UK new style PA 44C Spare charger and battery charger for CD 41 for VX 8DE 2 pin EU new style YHA 64 Spare aerial for VX 8DE RA1053600 Spare belt clip for VX 8DE VX 6E 2m 70cm wide band receive handheld transceiver 5W CD 15A Desk top rapid charger for VX 6E needs PA 48 2 5 hours was CD 15 CN 3 Antenna connector adaptor SMA BNC for VX 6E CSC 91 Soft case for VX 6E CT 91 Microphone adaptor for VX 6E SDD 13 Cigar lighter DC cable for VX 6E E DC 6 External DC cable for VX 6E FBA
23. 279 95 POA m rrr AAAA Z HR 15 95 22 95 42 95 249 95 149 95 124 95 124 95 124 95 124 95 16 95 15 95 449 95 799 95 469 95 479 95 479 95 369 95 549 95 PE CC CCC CC CCA 9 OOOO OGOGO eC C3 CE3 GH eC GC C3 ehe 5 e EC CCC DP DEP PED TE HE e C ee e h T e A C e h C e e CC CTET PSP OOS OE CC ET CC C3 E CC C3 e OOO SFY BBD GGG MQ 34SR MQ 26 MQ 26SR MQ 36SR MQ 26 1AFS BLUE MQ 26 1AFS RED MQ 12 TGM UPGRADE KITS MQ 3KT MQ 4KT B 246 KT B 245 6KT MQ 24SR KIT MQ 34SR DIR KIT MQ 34SR KIT MQ 26SR KIT MQ 36SR DIR KIT MQ 36SR KIT MQ 3KT SR MQ 4KT SR THAMWAY TX 2200A TIGERTRONICS L USB 4R L USB 8R L USB RJ 11 L USB RJ 45 L USB 5PD L USB 8PD L USB 6PMD L USB 13PDI L USB 13PDK L USB K3 L USB KX3 L USB HTW L USB HTY L USB NC L CAB 4R L CAB 8R L CAB RJ11 L CAB RJ45 L CAB 5PD L CAB 8PD L CAB 6PMD L CAB 131 L CAB 13K L CAB K3 L CAB KX3 L CAB NC LMODERI LMOD8RK LMOD8RY LMOD6PM LMOD8PD LMODSPD LMOD13 LMOD13K LMODK3 LMODKX3 LMODHT LHEAD L ASSY ANNNDNHDHDHNHHNHNHNHHDHDHHHHHHHHDHHDHHHHHHHDHDHDHDHDHHHDVD TOOLS YO 26A HT 336C HT 568 749 939 RHSD H 601 UBT AS PLNP PEC MATT CSIK MSSR SS 033MKII PFDS IMP MET 600 442 600 035 600 005 TRANSISTORS 2SC1971 2SC1947 2SC1946A M57727 SAV7 SAV 17 Mini beam 6 10 15 20m 3 elements MQ 24SR with director Mini beam 6 10 12 15 17 20m 2 elements 1 2kW PEP Mini beam 6 10 1
24. 49 95 ERW 4C Programing cable for DJ X3 39 95 C EME 20 Microphone and earphone 29 95 WCN 3 Aerial adaptor SMA to BNC for DJ X3 4 95 A EMS 59 Speaker microphone 24 95 EDH 31S Dry cell case for DJ X3 3 x AA silver 9 95 A ESC 41 Soft leatherette case 18 95 EBP 52NS NiMH battery for DJ X3 3 6V 500mAh silver 24 95 A DJ 175E 2m FM transceiver with battery and charger Listed 149 95 99 95 EDC 105 Drop in battery charger for DJ X3 needs EDC 148 14 95 A EME 12 Headset single headphone VOX PTT for DJ 175E 52 95 EDC 148 AC wall charger for DJ X3 9 95 A EME 13 Headset inner ear type for DJ 175E 52 95 EA 81 Spare antenna for DJ X3 14 95 A EMS 59 Speaker microphone for the DJ 175E 24 95 G TK OOO OOO OOO G E3 CCC CC E CC OOF OD OO EE C C3 C CC I T I I CT CC CEE EC E L L P PC CT C CCC CE EE C L L PP P P I C C C EAC EME 15 EME 21A ESC 49 RW 4C RW 7 A 165 BP 72N BP 71 DC 154EUK DC 164 DC 165 BC 17 A 98 A 84 DH 30 BP 50N BP 51N BP 56N DC 16B DC 37 DC 43 DC 88 DC 148 DC 94 DC 133E EMS 59 EME 11 EME 12 EME 13 EME 15 ESC 36 ERW 4C ERW 4C WCN 3 EDC 128 EBP 58N EMS 60 EME 24 EME 25 EME 18 EDH 32 EA 116 ESC 38 0 0 0 0 0000000000 00000 mm m Tie pin microphone for DJ 175E Heavy duty speaker microphone for DJ 175E Leatherette case for DJ 175E Comput Comput Spare a er interface cable for DJ 175E serial er interface cable for DJ 175E USB erial for DJ 175E Spare Ni MH 7 2V 700mA
25. CP 19R Cigarette lighter cable DC DC convertor built in for ID 51E OPC 254L DC power cable with 1 end bare wires L shaped plug with in line fuse for ID 51E OPC 2144 Speaker microphone plug adaptor cable to regular 2 pin type for ID 51E HM 153LS Durable type earphone microphone for ID 51E HM 166LS Lightweight type earphone microphone for ID 51E HM 186LS Compact type speaker microphone for ID 51E HM 75LS Remote control speaker microphone for ID 51E OPC 2144 Speaker microphone plug adaptor cable to regular 2 pin type for ID 51E SP 13 Earphone for ID 51E needs OPC 2144 HS 94 Headset earpiece type for ID 51E needs OPC 2006LS HS 95 Headset with boom microphone for ID 51E needs OPC 2006LS HS 97 Earphone with throat microphone for ID 51E needs OPC 2006LS OPC 2006LS Speaker microphone plug adaptor cable to single pin 4 pole plug type for ID 51E OPC 2218LU Cloning cable USB for ID 31E MB 127 Spare alligator type belt clip for ID 51E LC 179 Soft leatherette carry case for ID 51E SJ 1 Silicone leather jacket for ID 51E AD 92SMA Antenna connector adaptor SMA plug to BNC socket for ID 51E FA S270C Spare flexible aerial for ID 51E CT 17 CI V level converter RS 232 computer interface for ID 51E IC E80D ACCESSORIES BC 139 Desktop fast charger including BC 06 charges in 2 5 hours for IC E80D BC 167D 2 pin 220V charger 12V 0 5 Amp charges in 6 hours for IC E80D BC 167 3 pin 220V charger 12V 0 5 Amp charges in 6 hours for IC E80D BP 216 Dry
26. 108 137 amp 137 174MHz BNC 200mems 3 x AA batteries not supplied no DC socket 59 95 WEP 300MKI Over the ear earpiece 3 5mm mono jack plug Black for UBC 30XL 3 95 AR 33XLT Handheld 88 108 118 137 amp 137 175MHz 99 memories Ni MH batteries and charger 59 95 UNIDEN BEARCAT ACCESSORIES FOR OLDER SCANNERS BP 3300 Replacement nicad pack for UBC 3300XLT 4 8V 1500mAh 19 95 BP 2500 3000 Replacement nicad pack for UBC 2500 3000XLT 6V 600mAh 27 95 SC 220 Leatherette case for UBC 120 220XLT 17 95 VALVES 380 0811A 811A valve 29 95 3 500Z 8802 Valve 269 95 GOGOGOGOGOGOGOGOGOGOOGOGOGOGOO aa CT CC EE I pP re CT r C r EC CACICA CT C EEE EET EY C3 O T e OD K T T C T e K D K T e T K T T e e T D T T K T T OH H T K T O H T O T C3 d r 572B T160L 6146B 8298A 12BY7A Valve Valve sold singularly but come in matched pairs Valve VECTRONICS ANTENNA TUNERS VC 300D ATU with SWR power meter 1 8 30MHz 300W digital display VC 300DLP ATU with SWR power meter and built in dummy load 300W 1 8 30MHz VC 300M Mobile ATU with SWR power meter 1 8 30MHz 300W HFT 1500 1 8 30MHz roller inductor 2KW ATU SWR power meter 6 ant switch VEC 603 200 Watt 6m tuner VEC 621 200 Watt 144 220MHz tuner with meter VEC 624 200 Watt 440MHz meter tuner VECTRONICS DUMMY LOADS DL 300M Dummy load DC 150MHz 300W 500hm less than 1 5 1 at 1450MHz DL 300MN Dummy load DC 150MHz 300W 500hm less than 1 5 1 at 1450MHz N DL 650M Dummy load DC 650MHz1500W 50 Ohm l
27. 167 95 35 95 39 95 23 95 39 95 51 95 43 95 8 95 Te E CC C E PC CT f CH CH C3 E e PPD TCC C3 C3 Pb CI C1 C1 E C E A EC T E PEOROOG PCT C e C C C3 CC E C3 C3 CTET CTET PC I C G E T CC E PE P EE I T P E E E MMB 85 Mobile mounting bracket NC 38 Charger for FT 11 41 51 amp FNB 21 38 NC 50 Rapid charger for FNB 25 26 27 28 25A NC 55C Charger for FT 11 41 51 amp FNB 31 NC 76U Spare Overnight charger for VX 246 R0145630 Spare metal stand for FT 840 FT 847 FT 900 RA0143700 Spare belt clip for VX 5R RA0504500 Spare belt clip for VX 2E 8100830 Plug and cable only for Yaesu hand microphone 6 pin modular 8100380 Plug and cable only for Yaesu hand microphone 8 pin modular 8101121 Spare cable from base of MD 200A8x to rig 8002051 Spare mobile mounting bracket for FT 2800M SP 8 Large base station extension speaker 79021810 Spare DC lead for FT 2800M 79101493 Spare control lead between FC 20 and FT 847 79101501 cable 79101491 cable 79019399 DC power cord for FRG 100 79021925 DC power cord for FT 100 Part number now P1091081 79101536 CT cable 79101337B Lead between FT 1000MP and FL 7000 VAC 400U Rapid charger for VX 246 VAC 6400U Six way charger for VX 246 VX 400 YA 30 HF broadband aerial 2 30MHz 150 Watts PEP 25m long YA 007FG HF fibreglass antenna for FC 40 YA 31 HF dipole antenna YHA 59 Aerial for VX 1R YHA 60 Aerial for VX 5R YHA 62 Spare aerial
28. 260 2911 QS 200 QS 400 QS 900S Travel Paddle CW paddle key with 3 5mm stereo out key socket Omnidirectional folded dipole external aerial for DAB radios 36 8mm diameter ferrite rings TVI AFI Directional 3 element beam external aerial for DAB radios Directional 5 element beam external aerial for DAB radios Static discharge protector Cigarette lighter plug to cigar lighter socket and USB socket Cigarette lighter plug to 4 x cigar lighter sockets Cigarette lighter plug to 3 x cigar lighter sockets Cigarette lighter plug to 2 x cigar lighter sockets Copper plated steel earth rod 4 long with clamp Solid copper earth rod 4 long with clamp High pass TVI filter Aerial combiner for putting 1 x HF amp 1 x VHF UHF aerial into 1 scanner BNC Preamplifier for wideband scanner 24 2300MHz 10 to 22dB gain variable Preamplifier for wideband scanner 0 1 1300MHz maximum 25dB gain 2 x BNC sockets Preamplifier for wideband scanner 25 2000MHz 6 20dB gain USB printer cable Computer lead 9 pin D plug to 9 pin D socket Computer lead 9 pin D plug to 25 pin D socket Computer lead 9 pin D socket to 9 pin D plug wires crossed Computer lead 9 pin D socket RS232 to USB PC camera camcorder PDA MP3 Icom lead USB A to mini USB 4pin B 2m long PC camera camcorder PDA MP3 Icom lead USB A to mini USB 5pin B 2m long Cable 1 4 inch stereo jack plug to 1 4 inch stereo jack plug 2m long Serial cable 2m long 25pin male D 9 pin D female Mobile mou
29. 46 95 29 95 24 95 21 95 27 95 24 95 25 95 56 95 28 95 22 95 27 95 27 95 27 95 2 95 29 95 12 95 24 95 10 95 22 95 21 95 21 95 32 95 16 95 11 95 22 95 22 95 21 95 26 95 49 95 21 95 26 95 26 95 16 95 19 95 42 95 36 95 24 95 31 95 15 95 15 95 22 95 25 95 25 95 26 95 26 95 39 95 22 95 22 95 22 95 21 95 14 95 15 95 15 95 14 95 8 49 7 99 13 95 149 95 199 95 109 95 79 95 109 95 46 95 74 95 29 95 44 95 219 95 129 95 199 95 399 95 84 95 89 95 239 95 94 95 79 95 94 95 96 95 139 95 219 95 25 95 33 95 29 95 32 95 35 95 6 95 6 95 59 95 164 95 42 95 39 95 39 95 55 95 68 95 84 95 89 95 74 95 79 95 39 95 69 95 15 95 18 95 24 95 19 95 39 95 164 95 26 95 26 95 CCC CCC CC OOOO C3 TE T OOO T O T T T T T T T T TOH 0 T T T T OH T T T T T T T T T T T T T CT CTC CC E C CCI C CH CCC CT C3 TE e e e e eC CT C CCC C3 C3 C3 GDG C CEE CET O T MS 800S Hand held speaker microphone single pin 4 pole straight plug 26 95 MS 800L Hand held speaker microphone 2 pin right angled plug for Icom Standard Yaesu Alinco 26 95 MS 800V Hand held speaker mic
30. 599 95 AM 708E Desk microphone with compressor VU meter 2 inputs variable level needs lead 169 95 C EDX 2 Auto ATU for DX SR8E for wire antenna 289 95 AM 308E Desk microphone with amplifier needs lead black 84 95 C EDS 17 Front control remote kit 5m long for DX SR8E 49 95 AM 508E Desk mic with amplifier and compressor for sideband needs lead black 99 95 C EMS 14 Desk top microphone for DX SR8E 89 95 PS 3 Powers Adonis base microphones 3V from 12V no more batteries 19 95 A DM 330MW Switch mode 25 Amp continuous for DX SR8E 99 95 HX 7100 Mobile mic with gooseneck headrest fitting PTT amp UP DOWN needs lead 119 95 C EMS 53 Spare hand microphone for DX SR8E 34 95 D 87S2 Microphone conversion cable 2m long from Yaesu FTM 10 to 8 pin round 49 95 A UA0083 Spare DC cable for DX SR8E same as WDC HF4 29 95 D 80 Adonis microphone lead for Adonis microphones 8 pin round to bare end 15 95 A EBC 7 Spare microphone hanger for DX SR8E 4 95 P 8AP Adonis microphone lead with pre amp for older ICOM rigs wired 8 pin Icom plug 34 95 A EA HFM1 HF whip mobile antenna and mount for DX SR8E 82 95 D 8Ml Adonis microphone lead wired with RJ 45 modular Icom plug 19 95 A D 881 Adonis microphone lead wired with 8 pin round Icom plug 19 95 A ALINCO VHF UHF MOBILE TRANSCEIVERS ACCESSORIES D 6MY Adonis microphone lead wired with RJ 11 small modular Yaesu plug 22 95 A DR 135DX UK 10m all mode mobile transceiver 1 12W FM AM CW 0 25W LSB USB 199 95
31. 70MHz yagi 139 95 70 50 YAG 8 Dual band 8 element 4 4 50 amp 70MHz yagi 2 10m long 5KW 50MHz 8 88dBi gain 70MHz 8 40dBi gain 199 95 70 50 YAG 9 Dual band 9 element 4 5 50 amp 70MHz yagi 3 50m long 5kW 50MHz 9 25dBi gain 70MHz 10 53qBi gain 249 95 70 50 YAG 11 Dual band 11 element 6 5 50 amp 70MHz yagi 4 90m long 5kW 50MHz 11 09dBi gain 70MHz 10 46dBi gain 299 95 70 50 YAG 12 Dual band 12 element 6 6 50 amp 70MHz yagi 5 40m long 5kW 50MHz 10 95dBi gain 70MHz 11 84dBi gain 339 95 70 50 YAG 13 Dual band 13 element 7 6 50 amp 70MHz yagi 6 4m long BON 50MHz 11 57dBi gain 70MHz 4 1 06dBi gain 379 95 70 50 YAG 14 Dual band 14 element 7 7 50 amp 70MHz yagi 6 5m long 5KW 50MHz 11 60dBi gain 70MHz 12 04dBi gain 449 95 70 50 YAG 18 Dual band 16 element 8 8 50 amp 70MHz yagi 8 05m long 5kW 50MHz 12 30dBi gain 70MHz 12 21dBi gain 479 95 50 28 DIP 2 Dual band 2 element 1 1 50 amp 28MHz rotatable dipole 5kW 79 95 50 28 YAG 8 Dual band 8 ele 4 4 28 amp 50MHz yagi 4 00m long SkW 28MHz 8 70dBi gain 50MHz 8 82dBi gain 299 95 50 28 YAG 9 Dual band 9 ele 4 5 28 amp SOMHz yagi 5 20m long BON 28MHz 8 91dBi gain 50MHz 10 61dBi gain 379 95 50 28 YAG 12 Dual band 12 ele 5 7 28 amp 50MHz yagi 8 20m long 5KW 28MHz 10 35dBi gain 50MHz 11 79dBi gain 579 95 50 28 YAG 14 Dual band 14 ele 6 8 28 amp 50MHz yagi 11 55m long BON 28MHz 11 28dBi gain 50MHz 11 82dBi gain 799 95 50 28 YAG 15 Dual band 15 ele 6 9 28
32. E DC 21 VR 120D CT 35 CSC 76 FNB 79MH E DC 15 PA 30U CA 34 8100999 RA014370D DTMF decoder unit for FT 270E Spare belt clip for FT 270E Hand held scanner 100KHz 1300MHz dual receive Computer data software manager and USB cable for VR 160 Spare 1000mAh Lithium lon battery for VR 160 Spare charger for VR 160 3 pin UK new style Spare charger for VR 160 2 pin Euro new style Dry cell case for VR 160 Spare aerial for VR 160 Soft case for VR 160 belt loop on soft case as VR 160 does not have a belt clip Antenna connector adaptor SMA BNC for VR 160 DC adaptor with cigar lighter plug 12 24V for VR 160 Wide band hand held scanning receiver 100kHz 1300MHz Listed 153 95 Clone cable set to set for VR 120 Soft case for VR 120 Ni cad battery pack for VR 120 Cigar lighter DC cable for VR 120 AC adaptor 230V for VR 120 3 pin UK Charger sleeve for VR 120 Spare aerial for VR 120 Spare belt clip for VR 120D YAESU PMR TRANSCEIVERS amp ACCESSORIES VX 160EV VX 160EU VX 180EV VX 180EU ATV 8A ATV 8B ATV 8C ATU 6A ATU 6DS ATU 6C ATU 6D FNB 83 FNB V94 FNB V67LI VAC 10C VAC 10U VAC 810C VAC 810U VAC 6010C VAC 6010U VAC 6810C VAC 6810U VCM 3 VCM 1 MH 37A4B MH 45B4B MH 450S MH 360S VC 25 LCC 160 LCC 160S LCC 180 LCC 180S CT 27 CT 42 FIF 10 CT 106 CE 44 CN 3 FBA 25A VX 351EV VX 351EU VX 354EV VX 354EU ATV 8A ATV 8B ATV 8C ATU 6A ATU 6B ATU 6DS ATU 6C ATU 6D FNB V95LI FNB V96LI VAC
33. Earphone microphone for DJ C7E C6 Curly cord earphone for DJ C7E C6 Earphone for DJ C7E C6 Cigar lighter cable for DJ C7E C6 Spare aerial for DJ C7E Leatherette case for DJ C7E C6 ALINCO ACCESSORIES FOR OTHER RIGS MAINLY OLD BC 10 EA 18 EA 25 EA 50 EA 50A EA 54 EA 57 EA 58 EA 59 EA 61 EA 62 EA 63 EA 68 EA 70 EA 78 EA 94 EBC 3 EBC 16 EBC 22 EBP 25N EBP 45N EBP 46N EBP 49N EBP 52N EBP 53N EBP 54N EBP 60 EBP 62 DC 102 DC 103 DC 104 DC 105 DC 111E DC 132 DC 136 DC 138 DC 143 DC 147 DC 152 DC 18 DC 36 DC 60 DC 77K DC 8B DC 133E DH 16 DH 18 DH 26 DH 31B DS 1 DS 7 DS 8 EJ 10U EJ 16U EJ 23U EJ 38D EJ 39D EJ 40U EJ 43U EME 2 EME 4 EME 10K EMS 1Z EMS 5 EMS 49 EMS 50 EMS 52 EMS 54 EMS 61 EMS 62 EMS 64 0 0 0 0000000000000000 000 m m Drop in Spare Spare Spare Spare Aerial telescopic Aerial low band Aerial hi Spare Spare Spare Spare Spare Spare charger for DJ S11 41 R1 will only charge NBPA 1 aerial for DJ S1 F1 aerial for DJ 180 182 aerial for DJS 41C aerial for DJ SR1 ip for DJ 680 146 410MHz TNC fitting 180 190 191 193 195 J 180 190 191 193 195 X10 amp DJ X2000 C1 C4 S 11 C1 C4 C5 v5 0000 i rt c g gee og igh band aerial for aerial for aerial for wire for aerial for aerial for c s D F QO SZ QOO Short high band aerial for DJ 193 195 Spare ai Spare Spare Spare
34. G A P 5 8th wave base station vertical antenna 21 long SO 239 fitting Base loaded 13cms coil mobile whip antenna 3 8th thread 148cms Base loaded 30cms coil mobile whip antenna 3 8th thread 135cms Base loaded 24cms coil mobile whip antenna 3 8th thread 91 5cms Truckers favourite helical type mobile whip antenna 3 8th thread 92cms Truckers favourite helical type mobile whip antenna 3 8th thread 122cms Base loaded open coil design mobile whip antenna 3 8th thread 158cms Base loaded 54cms coil mobile whip antenna 3 8th thread 189cms 7 magnetic mount with rubber skirt 3 8th socket 4m cable amp PL 259 plug 5 magnetic mount with rubber skirt 3 8th socket 4m cable amp PL 259 plug 3 5 magnetic mount with rubber skirt 3 8th socket 4m cable amp PL 259 plug Fully adjustable hatch back mount 3 8th socket 4m cable amp PL 259 plug Roof mount 3 8th socket SO 239 cable socket drill hole in vehicle body Boot lip mount 3 8th socket 4m cable amp PL 259 plug Gutter mount 3 8th socket 4m cable amp PL 259 plug 2 way rail mirror mount 3 8th socket 4m cable amp PL 259 plug Flat bar mirror mount 3 8th socket 4m cable amp PL 259 plug Complete snail mount replacement 4m cable kit 3 8th socket to PL 259 Heavy duty shockspring 3 8 thread DV reverse banjo for 3 8ths moun DV base plug connector winkle to fit on DV lead right angled DV base mount body fixing banjo type to DV socket DV banjo adaptor for use with DV mount banjo to 3 8th th
35. Glass mount dual band mobile whip 2m 70cm 50 Watts with coax 6m J pole aerial omni directional full size 1 2 wave Glass mount 2m aerial 50 Watts with coax Midget rubber duck aerial 2m 70cm 2 5 inches long 6w SMA male Midget rubber duck aerial 2m 70cm 2 5 inches long 6w SMA female 2m groundplane 49 95 64 95 69 95 79 95 69 95 89 95 01 95 17 95 59 95 74 95 78 95 01 95 09 95 19 95 64 95 64 95 64 95 12 95 12 95 12 95 43 95 43 95 43 95 62 95 56 95 21 95 204 95 18 95 38 95 38 95 47 95 22 95 47 95 65 95 75 95 74 95 111 95 162 95 101 95 64 95 75 95 121 95 154 95 162 95 101 95 121 95 121 95 23 95 23 95 23 95 23 95 23 95 23 95 23 95 24 95 01 95 01 95 74 95 96 95 204 95 32 95 63 95 43 95 53 95 69 95 84 95 479 95 19 95 79 95 22 95 39 95 48 95 31 95 79 95 92 95 22 95 32 95 ta ta tam m LT m m m m M tD M M M M M M 120 95 89 95 80 95 33 95 1 95 1 95 6 95 6 95 21 95 21 95 9 95 27 95 27 95 9 95 9 95 24 95 24 95 24 95 28 95 28 95 21 95 21 95 21 95 33 95 16 95 21 95 21 95 27 95 37 95 38 95 32 95 32 95 50 95 32 95 41 95 18 95 18 95 32 95 mmm m m m m QF FIODDSFSFODSFOQDVODSSYSYSKSYKYKSYKSKSKSKSKSrK
36. Headet with PTT for TK 2170 3170 Boom microphone with D type earpiece and PTT for TK 2170 3170 Single headset with boom microphone no PTT for TK 2170 3170 2 wire palm microphone kit for TK 2170 3170 3 wire mini lapel microphone kit for TK 2170 3170 Palm size speaker microphone for TK 2170 3170 Speaker microphone for TK 2170 3170 Serial to USB adapter with driversfor TK 2170 3170 PC programming software for TK 2170 3170 Programming interface cable serial for TK 2170 3170 Programming interface cable USB for TK 2170 3170 Ss 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 28 95 33 95 18 95 38 95 28 95 319 95 16 95 11 95 14 95 16 95 37 95 6 95 26 95 41 95 194 95 41 95 23 95 30 95 41 95 47 95 91 95 50 95 33 95 61 95 33 95 48 95 101 95 OOO K TOO KKO K T T TO TOK K K K K T T T T T T OOO OOO OOO OOO K K TOOT TOOT K K K K OOO T T T T TK T T T T T K OOO OOO OOO OOO K OOO KK OOO KK TOO TK 2140E TK 3140E TK 3140E3 KSC 25T KSC 256T KMB 30M KNB 55L KNB 56N KNB 57L KNB 25A KNB 26N KBP 5 KCT 44 KEP 1 KHS 11BL KHS 12BL KHS 14 KHS 15 OH KMC 41 RA 22M RA 22M2 RA 22M3 RA 23M RA 23M2 RA 23M3 RA 14M RA 14M2 RA 14M3 RA 15M RA 15M3 RA 16M RA 16M2 RA 16M3 RA 17M RA 17M3 LH 115 CT 53U PG 36A PG 74DM2 K 2180E K 3180E RA 22M RA 22M2 RA 22M3 RA 26M RA 26M2 RA 26M3 RA 23M R
37. In the unlikely event of your parcel going astray we will send another package and make the claim ourselves Please bear in mind that we can usually send many different pieces of equipment for just one postage charge So you can save money by ordering more than one item Unless we advertise differently postage packing and insurance charges are coded in the price list as follows CODE A Packet post for goods up to 2Kg or 30 value 4 00 CODE B Recorded delivery for goods up to 2Kg or 30 value 5 00 CODE C Next day for goods up to 2Kg or 500 value 8 50 CODE D Next day Mainland UK for goods up to 10kg 11 00 CODE E Next day Mainland UK 10kg max by Noon OPTIONAL 17 50 CODE F Next day Mainland UK 10kg max by 9 30am OPTIONAL 25 00 CODE G Saturday Mainland UK 10kg max by Noon OPTIONAL 25 00 CODE J UK Offshore Islands amp N Ireland 1 2 days delivery 13 00 CODE K Southern Ireland 2 3 days delivery 17 50 CODE Q Special case please contact us first 2 We treat each and every order as very important and try to despatch them the same day that they are received by us If however speed or time of delivery is important then please state this when placing your order If required customers may pay extra for one of the faster methods of delivery Please note that our parcels are collected around 4pm We know that you would rather buy from us and due to forces beyond our control such as exchange rate fluctuations amp man
38. OPC 478 OPC 478UC CS T90A LC 152A SP 13 VS 1 1C SM E90 Lightweight headset with VOX PTT TOT Soft carry case for IC E92D Spare belt clip Earphone Spare aerial for IC E90 UK mains PSU for BC 139 Desktop fast charger including BC 06 for IC E90 Cigarette lighter cable DC DC convertor built in for IC E90 Dry cell battery case 2 x AA for IC E90 Spare Li lon battery pack 7 4V 1300mAh for IC E90 Hand held speaker microphone for IC E90 Hand held speaker microphone with up down for IC E90 Earphone Microphone for IC E90 Speaker microphone for IC E90 Earphone microphone Lightweight headset with VOX PTT TOT Headset earpiece type for use with VS 1 IC and IC E90 Headset with boom microphone for use with VS 1 IC and IC E90 Earphone with throat microphone for use with VS 1 IC and IC E90 Cloning cable transceiver to transceiver for IC E90 Cloning cable PC to IC E90 Cloning cable for radio to PC USB cable for IC E90 Programming windows software for IC E90 Leatherette carry case for IC E90 Earphone for IC E90 VOXIPTT unit for IC E90 Service manual on CD for IC E90 ACCESSORIES FOR IC U82 AD 101 BC 119N 209 11 BC 121N 209 11 BC 144N BC 145 BC 145 001 BC 146 BC 157 BP 208N BP 210N HM 128L HM 131L HM 158LA HM 75A HM 166L HS 85 HS 94 HS 95 HS 97 MB 86 MB 96F MB 96N MB 103 OPC 474 OPC 478 OPC 478UC CS V82 SP 13 UT 118 VS 1L SM V82 U82 FA B2E FA B70C ICOM RECEIVERS IC R6 BC 0
39. amp 50MHz yagi 11 90m long BON 28MHz 11 31dBi gain 50MHz 13 01dBi gain 899 95 24 18 YAG 6 Dual band 6 element 3 3 24 amp 18MHz yagi 3 75m long 5KW 24MHz 8 70dBi gain 18MHz 8 82dBi gain 549 95 28 21 YAG 8 Dual band 8 element 4 4 21 amp 28MHz yagi 6 18m long 5KW 21MHz 8 92dBi gain 28MHz 8 16dBi gain 549 95 28 21 YAG 11 Dual band 11 ele 5 6 21 amp 28MHz yagi 11 46m long 5KW 21MHz 10 61dBi gain 28IMHz 10 96dBi gain 2 boxes 849 95 28 21 YAG 13 Dual band 13 ele 6 7 21 amp 28MHz yagi 13 64m long SkW 21MHz 11 38dBi gain 28IMHz 11 63dBi gain 2 boxes 1 199 95 TRI BAND 21 50 28 DIP 3 14 21 28 DIP 3 14 18 24 DIP 3 POWER SPLITTERS 432 PS 2 432 PS 4 144 PS 2 144 PS 4 70 PS 2 70 PS 4 50 PS 2 50 PS 4 28 PS 2 28 PS 4 INTEK H 520 AR 109 109 ANT INTERNET LABORATORIES INC 3 element 21 28 amp 50MHz rotatable 5kW 3 element 14 21 amp 28MHz rotatable 5KW 3 element 14 18 amp 24MHz rotatable 5kW 2 port 432MHz power divider 20cm long 50 Ohms frequency range 430 440MHz 4 port 432MHz power divider 20cm long 50 Ohms frequency range 430 440MHz 2 port 144MHz power divider 60cm long 50 Ohms frequency range 144 148MHz 4 port 144MHz power divider 60cm long 50 Ohms frequency range 144 148MHz 2 port 70MHz power divider 1 1m long 50 Ohms frequency range 70 70 5MHz 4 port 70MHz power divider 1 1m long 50 Ohms frequency range 70 70 5MHz 2 port 50MHz power divider 1 7m long 50 Ohms frequency range 50 50 5MHz 4 port 50MHz
40. amp ACCESSORIES VHF handy 144 174MHz 12 5 20 25KHz 1 5W 16 CH with aerial battery charger belt clip UHF handy 440 470MHz 12 5 25KHz 1 4W 16 CH with aerial battery charger belt clip F short antenna 146 162MHz for TK 2000T short antenna 162 174MHz for TK 2000T short antenna 136 150MHz for TK 2000T short antenna 440 490MHz for TK 3000T antenna 146 162MHz for TK 2000T antenna 162 174MHz for TK 2000T VHF antenna 136 150MHz for TK 2000T UHF antenna 440 490MHz for TK 3000T Spare Li ion battery 1130mAh for TK 2000 3000T Li ion battery 1520mAh for TK 2000 3000T Rapid charger for KNB 63 65L and TK 2000 3000T DC vehicle charger adapter needs KSC 35S for TK 2000 3000T 6 way charger for KNB 45L and TK 2000 3000T Water resistant bag for TK 2000 3000T Clip microphone with D type earpiece was EMC 6 for TK 2000 3000T Spare belt clip for TK 2000 3000T Headset with VOX PTT for TK 2000 3000T Single headset with boom microphone no PTT for TK 2000 3000T Single headset with boom microphone with PTT for TK 2000 3000T 2 wire palm microphone kit for TK 2000 3000T 3 wire mini lapel microphone kit for TK 2000 3000T Over the head heavy duty headset with boom microphone for TK 2000 3000T Headset boom mic less VOX for TK 2000 3000T Headet with PTT for TK 2000 3000T Boom mic with D type earpiece amp PTT for TH F7E was KHS 28F for TK 2000 3000T Speaker microphone for TK 2000 3000T Palm size speaker microphone for TK 2000 3000T Programmin
41. amp analogue handheld transceiver USB black 269 95 FT 2DE 2m 70cm 5W Digital analogue handheld transceiver wide band receive Back lit touch screen 349 95 SHC 24 Softcase for FT 2DE 12 95 CSC 97 Soft case for FT 1DE 16 95 MH 85A11U Hand speaker microphone with snapshot camera 99 95 MH 34B4B Speaker microphone 22 95 MH 37A4B Earpiece microphone 24 95 VC 25 VOX headset 50 95 CT 44 Microphone adaptor 7 95 FNB 101LI Spare rechargeable Lithium lon battery pack 7 4V 1100mAh 41 95 FNB 102LI Rechargeable Lithium lon battery pack high capacity 7 4V 1800mAh 55 95 CN 3 Antenna connector adaptor SMA BNC 8 95 SDD 13 Cigar lighter DC cable 24 95 E DC 6 External DC cable 5 95 FBA 39 Dry cell case for 3 x AA not supplied 19 95 CD 41 Rapid charger cradle 2 5 hours needs PA 44 16 95 PA 48U Spare charger 3 pin UK new style 11 95 PA 48C Spare charger 2 pin Euro new style 11 95 ACCESSORIES FOR VX 8GE CSC 95 Soft case for VX 8GE 14 95 FBA 39 Dry cell case for VX 8GE 3 x AA not supplied 19 95 FNB 101LI Spare rechargeable Lithium lon battery pack 7 4V 1100mAh for VX 8GE 41 95 FNB 102LI Rechargeable Lithium lon battery pack high capacity 7 4V 1800mAh for VX 8GE 55 95 MH 34B4B Speaker microphone for VX 8GE 22 95 MH 37A4B Earpiece microphone for VX 8GE 24 95 CD 41 Rapid charger cradle 2 5 hours for VX 8GE needs PA 44 16 95 CN 3 Antenna connector adaptor SMA BNC for VX 8GE 8 95 CT 44 Microphone adaptor for
42. 118 137MHz BNC plug to BNC socket needs 12v supply LNA DUAL AIR O n line low noise outdoor dual air band amplifier 112 170 amp 218 410MHz N plugs 12v LNA DUAL VU O n line low noise outdoor dual band amplifier 112 170 amp 218 512MHz N plugs 12v LNA WIDE O n line low noise outdoor wide band amplifier 25 2000MHz N plugs 12v LNA VHF n line low noise amplifier 137 174MHz BNC plug to BNC socket powered via coax LNA VHF B n line low noise amplifier 137 174MHz BNC plug to BNC socket needs 12v supply PWR I E Power injector for powering LNA AIR LNA VHF LNA 2000 and other similar 10KHz 1GHz max 90ma SP 1300 Combiner splitter either 1 or 2 ant s or 1 or 2 revr s 8 1300MHz 1xBNC plug 2xBNC socket DIAMOND ANTENNAS 13cm ALSO LOW POWER VIDEO amp LAN WHERE LEGAL M 2405 Mobile aerial 2400 2500MHz 27cm long terminated in N type plug P 2405S Desk top aerial 2400 2500MHz 19 1cm high 2m cable and SMA plug 4081 gain 2W H 2401LGIll Set top 2400 2500MHz 1 2 wave 2 14dBi right angle SMA plug 8 3cm long H 2401SG Set top 2400 2500MHz 1 2 wave 2 14dBi straight SMA plug 7 4cm long grey H 2401SB Set top 2400 2500MHz 1 2 wave 2 14dBi straight SMA plug 7 4cm long black ANT SS 388 Set top 2400 2500MHz 4dBi gain straight SMA plug 18 5cm long 2400 Y12 Mast mounted 2400 2500MHz 12dBi enclosed 12 element yagi N socket 42cm long 2400 15 Mast mounted 2400 2500MHz 15dBi enclosed 15 element yagi N socket 106cm long 2400 Y19 Mast mounted 2400 2500MHz 19dBi enclosed 19 element yagi N socke
43. 12 15 17 amp 20m compact vertical 500W MA 6VA 6 10 12 15 17 20m compact vertical 500W MA 160V 160m vertical monopole antenna 30 36 feet high adjustable 1 8 2MHz MA8040V 80m amp 40m Lightweight vertical antenna incl radial kit D 3 14 21 28 MHz 2KW 7 86m long D 3W 10 18 24 MHz 2KW 10 37m long D 4 7 14 21 28 MHz 2KW 10 92m long D 40 40m 2KW 12 88m long TEN 3 10m 3 element beam 8dBd gain 2 44m long XM 240 40m 2 element yagi 6 7m long 6 0dBi gain 1500W CUSHCRAFT VHF UHF ANTENNAS A270 6S 2m 70cms 3 element beam 7 8dB gain 0 85m long A270 10S 2m 70cms 5 element beam 10dB gain 1 9m long A6270 13S 6m 2m amp 70cm 13 element yagi AR 270 2m 70cms vertical 3 7 5 5dB gain 1 13m high dualband Ringo AR 270B 2m 70cms vertical 5 5 7 5dB gain 2 3m high dualband Ringo A13 B2 2m 13 element beam 15 8dB gain 4 57m long A26 B2 2m 26 element beam 18 8dB gain 4 75m long A26B2 VPK Stacking kit for 2 x A13B2 A26B2N VPK Stacking kit for 2 x A17B2 A17B2 2m 17 element beam 18dB gain N 9 45m long A124WB 2m 4 element beam AT19B 70cm 19 element beam 15 5dB gain 4 1m long AR X2B 2m vertical 7dB gain 4 3m high AR X2 2m vertical 5 5dB gain 2 8m high AR 2 2m vertical 3 75dB gain 1 2m high the original Ringo AR X450B 70cm Ringo ranger II AR 450 70cm Ringo ranger AR 6 6m vertical 3 75dB gain 3 1m high AR 10 10m vertical 3 75dB gain 5 36m high A50 3S 6m 3 element beam 8dB gain 1KW 1 8m long A50 5S 6m 5 element beam 10 5dB gain 3 7m long A50
44. 15 element 222MHz LFA yagi 6 50m long 4kW 16 63dBi gain 269 95 16 16 element 222MHz LFA yagi 7 1m long 4kW 17 22dBi gain 282 95 17 17 element 222MHz LFA yagi 7 55m long 4kW 17 50dBi gain 294 95 10 element 432MHz LFA LN yagi 1 74m long 3kW 14 40dBi gain 92 95 10 element 432MHz LFA SQ yagi 2 00m long 3kW 14 46dBi gain 92 95 11 element 432MHz LFA SQ yagi 2 29m long 3kW 14 87dBi gain 94 95 12 element 432MHz LFA SQ yagi 2 33m long 3kW 15 16dBi gain 99 95 13 element 432MHz LFA SQ yagi 2 58m long 3kW 15 39qBi gain 105 95 14 element 432MHz LFA SQ yagi 2 87m long 3kW 15 60dBi gain 119 95 15 element 432MHz LFA SQ yagi 3 17m long 3kW 15 72dBi gain 129 95 16 elemen FA SQ yagi 3 47m long 3kW 15 87dBi gain 139 95 17 element long 3kW 17 80dBi gain 159 95 18 elemeni long 3kW 18 03dBi gain 174 95 19 elemeni long 3kW 18 29dBi gain 185 95 20 elemen long 3kW 18 60dBi gain 195 95 21 elemen long 3kW 18 81dBi gain 205 95 22 elemen long 3kW 18 95dBi gain 215 95 23 elemen long 3kW 19 11dBi gain 225 95 24 elemen long 3kW 19 31dBi gain 235 95 25 elemen long 3kW 19 42dBi gain 245 95 26 elemen long 3kW 19 68dBi gain 255 95 27 elemen long 3kW 19 90dBi gain 275 95 28 elemen long 3kW 20 09dBi gain 285 95 29 elemen long 3kW 20 26dBi gain 295 95 30 elemen long 3kW 20 35dBi gain 309 95 432 LFA 34 LN 34 element 432MHz LFA LN yagi m long 3kW dBi gain 345 95 DUAL BAND 70 50 YAG 6 Dual band 6 element 50 amp
45. 2 5inches to clamp mast up to 55mm 2 25 inches Heavy duty tow hook mount SO 239 Heavy duty tow hook mount 3 8ths socket Heavy duty adjustable tripod 55cm high 105 width 67mm internal diameter folding legs 20 95 43 95 43 95 37 95 60 95 42 95 49 95 219 95 279 95 349 95 14 95 63 95 63 95 17 95 59 95 299 95 189 95 18 95 13 95 5 50 0 95 0 95 8 95 20 95 4 95 hp MP m mo 89 95 89 95 11 95 83 95 6 95 95 95 105 95 16 95 16 95 249 95 199 95 169 95 119 95 29 95 299 95 14 95 79 95 17 95 134 95 229 95 71 95 17 95 19 95 19 95 8 50 21 95 49 95 5 95 169 95 199 95 299 95 349 95 74 95 84 95 92 95 29 95 39 95 35 95 47 95 53 95 68 95 9 50 11 95 7 50 16 95 21 95 31 95 36 95 6 95 10 95 22 95 26 95 32 95 49 95 24 95 21 95 21 95 7 95 7 95 5 95 6 95 14 95 16 95 5 95 7 95 14 95 22 95 25 95 18 95 14 95 23 95 29 95 1 00 1 00 51 95 51 95 152 95 ORP e C C CIEC Ae G C EGG P ICC C3 CC T K e e e e C C3 T e K e O H T K e T T K vuu0000n0 OOO GOGO GO ECC C C E C3 I P CH I He EC CET C3 YS QUANSHENG G UV2 2m 70cm handheld transceiver DC 7 2V 2000mAh Li ion batter pack charger aerial belt clip 79 95 QS 1
46. 201 9 95 YSK 8900 Separation lead kit for FT 8800 32 95 MMB 60 Quick release mobile bracket for FT 8800 16 95 CT 39A Packet interface cable for FT 8800 14 95 MEK 2 Microphone lead extension kit for FT 8800 29 95 CT 69 Microphone adaptor 8 pin round socket to 6 pin modular plug RJ 11 for FT 8800 21 95 79022815 Spare DC lead for FT 8800 14 95 FT 7900E 2m 70cm 50 45W mobile TX 108 520 amp 700 999MHz RX NBFM NBAM manual auto mode select 189 95 SMB 201 Desktop cooling fan includes SAD 11C 34 95 MH 42B6JS Microphone for FT 7900 39 95 MH 48A6JA Spare Hand microphone with DTMF for FT 7900 34 95 MLS 100 High Power external speaker for FT 7900 29 95 SAD 11U C 220 240VAC PSU for SMB 201 9 95 YSK 7800 Separation lead kit for FT 7900 32 95 MMB 60 Quick release mobile bracket for FT 7900 16 95 CT 39A Packet interface cable for FT 7900 Listed 269 95 14 95 MEK 2 Microphone lead extension kit for FT 7900 29 95 MMB 36 Spare mobile mounting bracket for FT 7900 5 95 79022815 Spare DC power lead for FT 7900 amp FTM 350 amp FT 1500 14 95 FT 2900E 2m 75 Watt FM mobile transceiver Listed 134 95 129 95 MH 48A6JA Spare hand microphone with DTMF for FT 2900 39 95 MH 42B6JS Microphone for FT 2900 34 95 MLS 100 High Power external speaker for FT 2900 29 95 MMB 36 Spare mobile mounting bracket for FT 2900 5 95 79022815 Spare DC power lead for FT 2900 14 95 YAESU VHF UHF HAND PORTABLES FT 1DE B 2m BW 70cm 5W DIGITAL
47. 229 95 129 95 72 95 19 95 10 95 29 95 69 95 99 95 129 95 29 95 39 95 4 95 19 95 m m 82 95 129 95 29 95 31 95 529 95 TK KOKO Oaa aOR OK OK OK OK OOO K OOOO gt rrrrrrrrrrrrrrr gt Y SEAQAQVDASESAVQDOOOODODOOD PETAT CONNECTORS amp ADAPTORS PL 213BC PL 58BC PL 259 BI MULTIPACK 259S PL 259 MULTIPACK 259L NC 556 PL RG8 103 PL 259 PL CR PL259 S PL259 SRA PL RAS UPCR 174 UHF MINI CR SO BODY NC 545 LESC DSC 239 0 239 4 0 239 2 NC 554 BNC 15 MULTIPACK BNCS BNC SRA LBNC BPCR174 BNC CR 103 BNC 1510 1502 BNC SN BDSC LEN 103 N 21 BU NPCR174 SEN CR LN DU 2358 58 UG N SN LSMA SMAPCR174 103 SMA SMA CP NC PLUG NC CR SMA CSL SMA CSS FME PLUG FME SMA FTVP ITVP ITVS TV Y ITFS SKY S SKY P ITFP P807 ITVJ CA60 M SMA SMA SMAP SMAP SMA REV PL200 MINIUHF SO 239 MINIUHF BNC WCN 2 WCN 3 WCN 4 WCN 5 WCN 7 WCN 9 WCN 15 WCN 11 WCN 13 BNCF FBNC BNCP NC 1521 MFJ 7703 259NS PL PH PL 258 PL PL 1505 BNC BNC NC 1465 NBS 764 221 NSMA NC 1520 UG 349 29 UG 29 UG G 57 UG PL 5 8 BNC 5 8 JSG 58S JSG 58P RA 38 NC 1958 BNC 90 259 90 SO CAR NP TN TNS TNS BN TN TN SO 131 0974 130 0540 KES 15 130 0542 PL 259 plug with pressure sleeve cable clamp for RG 213 9mm L 259 plug with pressure sleeve cable clamp for RG 58 6mm L 259 plug with built in reducer for RG 58 ack of 10 PL 259 plugs with built
48. 25 Spare VHF rubber duck aerial for TH K2E amp TH K2ET W08 0959 15 Spare charger for TH K2 4 UK 3 pin plug KENWOOD MISCELLANEOUS ACCESSORIES MAINLY FOR OLDER RIGS J82 0113 05 FPC E59 0407 08 Interface connector only no cable for VC H1 IHS 01 Helmet headset for open face helmet T07 0774 05 Spare internal filter for TS 50S J29 0623 14 Spare belt clip for TH 22 28 J29 0624 03 Spare belt clip for TK 270 360 370 J29 0631 13 Spare belt clip for G 71 J29 0632 23 Spare mobile mounting bracket for TM G707 J29 0628 33 Spare mobile mounting bracket for TM 261 J29 0664 13 Spare fan shaped bracket for the head of TM D700 K29 5399 03 Knob for TS 2000 R31 0633 05 variable resistor for TS 2000 KAT 1 Was AT 300 Weatherproof auto ATU for TS 450 690 850 870 KBP 1 Dry cell case AA size KCT 20 KGP 1A amp 1B radio interface cable for TK 760G 860G KCT 29 KGP 1A amp 1B connection cable for TK 760G 860G KLH 73 Soft leather case KLH 94 Soft leather case for TK 3101 KMB 8M Mounting bracket for Kenwood TK 7629 KNB 7A Ni Cd pack 12V 800 mAh for TH 25 45 55 75 77 amp some PMR rigs was PB 8 KNB 11A Ni Cd pack 7 2V 800 mAh for TK 250 350 series KNB 12A Ni Cd pack 7 2V 1100 mAh for TK 250 350 series KNB 17A Ni Cd pack 7 2V 1500 mAh for TK 280 380 series KNB 20N Ni MH battery 7 2V 1600mAh was KNB 14 15 KNB 52N Ni MH battery 1400mAh was KNB 16 17 21 KPG 4 PC interface cable for some commercial rigs KPG 19 Programming interface for TK 715 KPG 43U
49. 2m 5 2dBi on 70cm 70W 0 73m long PL 259 2m 70cm 0 2 15dBi 3 8dBi 100W 0 53m PL 259 aaaaaa 2 59 95 59 95 54 95 56 95 54 95 64 95 59 95 59 95 59 95 59 95 59 95 59 95 59 95 59 95 7 95 54 95 32 95 42 95 44 95 29 95 34 95 36 95 39 95 36 95 42 95 44 95 44 95 44 95 44 95 52 95 42 95 39 95 42 95 54 95 39 95 54 95 59 95 23 95 89 95 164 95 36 95 179 95 24 95 36 95 34 95 46 95 49 95 59 95 28 95 38 95 32 95 36 95 34 95 42 95 39 95 44 95 69 95 49 95 59 95 199 95 119 95 129 95 79 95 64 95 62 95 79 95 69 95 69 95 89 95 99 95 89 95 99 95 82 95 89 95 62 95 59 95 2m 70 23cm 2m 1 4 wave 70cm 1 2 wave 23cm 2 x 5 8th wave 0 2 15 5 5dBi 60W 0 37m N type 69 95 2m 70 23cm 2m 1 4 wave 70cm 6 8th wavel23cm 3 x 5 8th wave 0 3 8dBi 7 2dBi 60W 0 57m long Ntype 59 95 DIAMOND MOBILE MOUNTS AND ACCESSORIES MCR II MAT 50 K 11 K 33 K 44 K 44L K110 K301 K311 K 400 K 401 K 402 K 413 K 413S K 415 K 501 K 512 K 515 K 540 K 550 K 550L K 600M K 702M K 707B K 707M K 707S K 3000 K9000 MRK SPB DP MRX SPM 35 DPK 4NM M DPK 4NM N K TRII CRM Universal clip mount for aerial of handheld radio multi angle 2 5m cable SMA plug to socket Magnetic earth sheet for 7 50MHz aerials gives superior earth contact to car Heavy du
50. 3 5mm plug Clip to mount aerial on top edge of car window BNC Clip to mount aerial on top edge of car window SMA 2 amp 3 4 inch magnetic mount with BNC socket and co ax for hand held aerial 2 amp 3 4 inch magnetic mount with SMA socket and co ax for hand held aerial 3 5 inch magnetic mount with NMO socket and co ax cable 3 5 inch magnetic mount with SO 239 socket and co ax cable 5 Magnetic Mount with NMO socket and 5m 50 Ohm co ax cable 5 Magnetic Mount with SO 239 socket and 5m 50 Ohm co ax cable 5 Magnetic Mount with 3 8ths stud socket and 5m 50 Ohm co ax cable Triple mag mount SO 239 socket coax and PL 259 Triple mag mount MNO socket coax and PL 259 Triple mag mount 3 8th socket coax and PL 259 Mirror luggage rack mount SO 239 socket 10 coax amp PL 259 Mobile mount cable NMO Mobile mount cable S0 239 to PL 259 Mobile mount cable S0 239 to SMA male 3 8th inch mirror mount SO 239 socket for coax feed Mirror mount SO 239 for antenna comes with coax and PL 259 Body mount for 3 8th type mobile aerial 3 8th inch vertical mount SO 239 socket for coax feed Trunk lip adjustable mount SO 239 base plus 4m cable with PL 259 plug Trunk lip adjustable mount 3 8ths stud base plus 4m cable with PL 259 plug HF stick mini dipole mount Heavy duty trunk lip adjustable mount SO 239 base plus 4m cable with PL 259 Heavy duty trunk lip adjustable mount 3 8ths stud base plus 4m cable with PL 259 Amplified desk top speaker Mobile amplifier
51. 3 elemen 3 elemen 4 elemen 4 elemen 5 elemen 5 elemen 6 elemen 6 elemen 7 elemen 8 elemen 9 elemen 3 elemen 4 elemen 5 elemen 6 elemen 3 elemen 4 elemen 5 elemen 6 elemen 7 elemen 8 elemen 9 elemen 10 elemen 11 elemen 12 elemen 13 elemen 14 elemen 15 elemen 16 elemen 17 elemen 18 elemen 19 elemen 20 elemen 21 elemen 22 elemen 28MHz LFA yagi 8 2m long 10 73dBi gain 5kW 28MHz OP DES yagi 8 45m long 11 01dBi gain 5kW 28MHz OWA yagi 10 62m long 11 50dBi gain 5kW comes in 2 boxes 28MHz OP DES yagi 12 20m long 12 13dBi gain 5kW comes in 2 boxes 28MHz OP DES yagi 17 5m long 13 2dBi gain SkW comes in 2 boxes t 2 x 5 5OMHz cross polarised MAP65 yagi 4 35m long SkW 10 63dBi gain t 2 x 6 5OMHz cross polarised MAP65 yagi 5 93m long SkW 11 18dBi gain t 2 x 7 5OMHz cross polarised MAP65 yagi 9 60m long SkW 12 90dBi gain 50MHz FLA Q yagi 0 41m long 5kW 6 8dBi gain rear mount 50MHz LFA2 yagi m long 5kW dBi gain rear mount 50MHz LFA2 yagi m long 5kW dBi gain rear mount 50MHz LFA2 yagi 0 73m long 5kW 6 67dBi gain 50MHz OWL yagi 1 2m long 5kW7 67dBi gain 50MHz LFA Q yagi 1 94m long 5kW 8 82dBi gain 50MHz LFA yagi 2 14m long 5kW 8 92dBi gain 50MHz OP DES yagi 2 6m long SkW 9 16dBi gain 50MHz LFA S yagi 2 80m long 5kW 9 21dBi gain 50MHz LFA LN yagi 3 30m long 5kW 9 4dBi gain 50MHz LFA Q yagi 3 34m long 5kW 10 42dBi gain 50MHz LFA HG yagi 3 90m long 5kW 10 67dBi gain 50MHz LFA S yagi 4 1m long 5kW 10 52dBi gai
52. 400W 7MHz 200W vertical rigid radials 200W 3 6m high 1 8m radials 3 6MHz optional radial element for CP 6 3 575 3 650MHz 1 8m long 3 7MHz optional radial element for CP 6 3 650 3 725MHz 1 8m long Discone 25 1300 MHz RX 50 144 430 904 1200MHz TX 1 7m high 15m RG 58U PL 259 s fitted Discone 100 1500 MHz RX 144 430 904 1200MHz TX 50W 0 84m high 10m RG 58 PL 259 s fitted Discone 100 1600 MHz RX 144 430 904 1200MHz TX 50W 0 90m high PL 259 Discone 25 3000MHz RX 50 20W 144 430 904 1200MHz 200W TX 1 7m long N type 3 5 3 805 amp 7 7 2 MHz 300W SSB PL 259 10 2m long dual band V type dipole 2m 70cm vertical fibre glass 2 15 5 5dBi gain 1 3m NO RADIALS NEEDED PL 259 type 6m 2m 70cm vertical fibre glass 1 5dBi 2 15dBi 5 5dBi gain 150W 1 42m long PL 259 type 2m 70cm 23cm vertical fibre glass 2 6dBi 5 8dBi 9 2dBi 100W 1 3m long N type 2m 70cm vertical fibre glass 3 5 5dB gain 1 3m PL 259 type 2m 70cm fibre glass 4 5 7 2dB gain 1 7m long PL 259 type 2m 70cm fibre glass 4 5 7 2dB gain 1 7m long N type 2m 70cm fibre glass 6 8dB gain 2 5m long N type 2m 70cm fibre glass 6 5 9dB gain 3 1m long PL 259 type 2m 70cm fibre glass 8 3 11 7dB gain 200W 5 2m long N type 2m 70cm fibre glass 8 3 11 7dB gain 350W 5 2m long PL 259 2m 70cm fibre glass 8 3 11 7dB gain 200W 5 2m long PL 259 2m 70cm fibre glass 9 3 13dB gain 200W 7 2m long PL 259 type 2m 70cm fibre glass 9 3 13dB gain 200W 7 2m long N type 6m 2m 70cm omni fibre glass 2 15dBi 6 2dB 8 4dB 2 5m 150W PL 259
53. 41 95 121 95 119 95 134 95 41 95 31 95 46 95 27 95 67 95 74 95 69 95 425 50 458 36 425 50 458 36 41 95 27 95 46 95 31 95 46 95 27 95 46 95 84 95 139 95 41 95 67 95 119 95 119 95 99 95 74 95 62 95 899 95 739 95 739 95 739 95 1 299 95 189 95 1 299 95 27 95 99 95 46 95 62 95 121 95 899 95 899 95 83 95 69 95 362 66 362 66 362 66 362 66 362 66 362 66 362 66 362 66 362 66 362 66 362 66 362 66 1 144 25 231 95 148 95 10 95 425 50 129 95 129 95 139 95 41 95 599 96 0 00 172 50 1 510 95 287 50 425 50 139 95 39 95 99 95 46 95 46 95 2 95 54 95 12 95 12 95 24 95 1 95 14 95 9 95 9 95 OOO TK KOKO KOK OOO K KOK K TOOT TOO OOO OOO KOET ANMAAAAAAAAAADBDAAAVAAAFAQAQQAQAQAOA OOO KOKO TOO KO TK T T T K T T F36 024 281 006 F310 005 310 008 F 34 004 N276 001 MB 002 N313 001 F3 003 1 015 FL335 001 F3G 015 815 007 N297 001 M31 201 N323 001 92 001 R10 002 62783 001 4088 07 M1V 012 F3G 012 F30 002 33 028 460 012 M401 011 C 020 N318 001 OPC 345 AD 54 AD 66 AD 67 AD 68 AD 87 AD 88 AD 89 AD 94 AD 95 AD 99 AD 113E AH 3 AQUAMATE 001 BC 03 BC 35E BC 110 BC 119N BC 121N BC 119N CM166 BC 119N 446S BC 119LM 446S BC 119N BP125 BC 121NIBP125 BC 121N 446S BC 121NICM
54. 5 feet long all mode 1 5KW AV 6160 6 160m aerial 43 feet high weighs 20 Ibs self supporting 1500 Watts AV 6110 160 80m high efficiency matching network AV 12AVQ 10 15 20m Vertical 1 5kW 13ft AV 14AVQ 10 15 20 40m Vertical 1 5kW 18ft AV 14RMQ Roof mounting kit baseplate mast amp radials for AV 18VS AV 14AVQ amp AV 12AVQ AV 18AVQ11 10 15 20 40 80m vertical 1 5kW 18 The original classic now improved AV 18HT 10 12 15 20 40 80m Vertical 1 5kW 53ft AV 18HTJR 10 15 20 40 80m 5kW Vertical 39 AV 18VS 10 12 15 17 20 30 40 80m vertical 1 5kW 18 Lightweight manual band selection AV 620 6 20m Vertical inc WARC 1 5kW 22 5 long AV 640 6 40m Vertical inc WARC 1 5kW 25 5 long AV 680 80 40 30 20 17 15 12 10 6m Vertical 1 5kW DX 77A 10 12 15 17 20 30 40m vertical 1 5kW 29 4 895 95 7 995 95 5 495 95 989 95 1 249 95 549 95 399 95 29 95 449 95 449 95 99 95 99 95 99 95 59 95 49 95 109 95 109 95 99 95 49 95 29 95 44 95 44 95 25 95 24 95 7 95 19 95 10 95 3 95 269 95 229 95 189 95 229 95 53 95 7 95 41 95 4 95 21 95 21 95 21 95 21 95 27 95 27 95 29 95 29 95 29 95 29 95 32 95 32 95 28 95 28 95 29 95 36 95 43 95 59 95 235 95 249 95 41 95 41 95 31 95 28 95 56 95 33 95 31 95 28 95 14 95 23 95 9 95 119 95 149 95 399 95 499 95 829 95 449 95 499
55. 5000 3000 1500 a knob on a console with programmable function buttons 109 95 ACC F3KF5K PWR Spare power cable for FLEX 3000 5000 27 95 MH 31B8 Hand mic for FLEX 5000A FLEX 1000 8 pin round 34 95 RX 2 Second receiver option for FLEX 5000A 679 95 5000 ATU 160 6m automatic ATU for FLEX 5000A 329 95 HRFIO Upgrade HRFIOI version 34 board for FLEX 5000A RX 2 and early FLEX 5000 179 95 PC DELTA KIT Set of 3 connecting leads for Delta 44 KIT and FLEX 1000 1 95 DELTA 44 M Audio Delta 44 professional 4 in 4 out audio card 24bit sampling rates up to 96KHz for FLEX 1000 149 95 PC DELTA Lead kit for SDR 1000 to Delta 44 sound card for FLEX 1000 2 95 PC AUDIO Lead kit to connect your 3 5mm stereo PC speaker s plug to Delta 44 sound card output for FLEX 1000 2 95 SDR ATU Automatic antenna tuning unit upgrade 160 6m for FLEX 1000 219 95 ELEVATOR Griffin Elevator stand for radio 34 95 SDR 100WPA 100W amplifier for FLEX 1000 462 95 FORCE 12 XR3 10 15 20m tri band beam antenna 6 element 5kW 6 7 5dB gain 3 1m boom element length 11 6 max 895 95 XR4 6 10 15 20m quad band beam antenna 8 element 5kW 6 7 5dB gain 3 5m boom element length 11 6 995 95 XR6 6 10 12 15 17 20m 6 band beam antenna 11 element 6kW 6 7 5dB gain 3 6m boom element length 11 6 1 095 95 XR3 C 10 15 20m tri band beam antenna 6 element 5kW 6 7 5dB gain 3 1m boom element length 8 9 max 895 95 XR4 C 6 10 15 20m quad band beam antenna 8 element 5kW 6 7 5dB gain 3 5m boom element l
56. 5510 5510M 5512 5512M 5535 5535M 5538 5606SR 5606TR 5803 5806 5809 5812 5818 5850 58100 5803X 5806X 5809X 5812X 5818X 5850X 58100X 5803H 5806H 5812H 5818H 5850H 58100H 6115 6117 6120 6130 6140 6200 6215 6217 6220 6230 6240 6404 6404F 7224 7602 7701 7702 7703 7704 7705 7706 7708 8100K 8100W 8704 8708 8709 9015 9017 9020 9030 9040 9200 9200 80M 9200 40M 9200 30M 9200 20M 9200 17M 9200 15M 9201 9213 Yaesu interface cable for MFJ 993 991 994 atu amp FT 1000MP FT 1000MPMKV FT 1000MPMKVFIELD Yaesu interface cable for MFJ 993 991 994 atu amp FT 2000 D FT DX9000 amp FT DX5000 Cable to connect MFJ 461 464 to PC serial port Multireader receive cable 3 5mm mono jack plug each end Code reader cable for MFJ 464 462 Cable for keyer to radio phono plug to 3 5mm plug with 1 4 phone plug adaptor Cable for paddle keyer lugs to 2 5mm 1 4 inch adaptor Receiver cable DC cable 2 open end TNC cable kit for MFJ 784 Open end cable with 5 pin din Open end cable with 8 pin din Open end cable with 13 pin Kenwood HF Open end cable with Yaesu FT 50 plug bl bl bl Open end cable with split connectors for Alinco etc Open end cable for Icom Yaesu Alinco handhelds Open end cable for Kenwood handhelds Cat 5 cable 7 feet with connector for short wave aerial Cat 5 cable 25 feet with connector for short wave aerial Open end cable f
57. 5W Li lon batt pack amp charger Charge adaptor for use with BC 119N 121N Spare battery charger for IC M23 Fast charger includes AD 123 and BC 145UK for IC M23 UK mains PSU for BC 145 fast charger 12V cigarette lighter lead for charging or 12V supply for IC M23 Spare Li lon battery pack 3 7V 1500mAh for IC M23 Spare antenna for IC M23 Spare aligator type belt clip for IC M23 Cloning cable adapter for C M23 Cloning cable Serial type PC to transceiver for IC M23 Cloning cable USB type PC to transceiver for IC M23 Service manual on CD for IC M23 Cloning software for IC M23 Handheld marine transceiver waterproof Li lon batt pack amp charger list Spare battery charger for IC M35 UK mains PSU for BC 162 fast charger Single desktop rapid charger BP 252 only Regular trickle charger for BP 252 requires BC 01 or CP 23L 12V cigarette lighter lead for charging or 12V supply was CP 17 Spare dry cell case 5 x AAA cells for IC M35 Spare Li lon battery pack 7 4V 980mAh for IC M35 Spare antenna for IC M35 Waterproof speaker microphone for IC M35 Spare belt clip for C M35 Cloning cable Serial type PC to transceiver for IC M35 Cloning cable USB type requires OPC 1655 for IC M35 Cable adaptor for use with OPC 478 UC for IC M35 Service manual on CD for IC M35 Cloning software requires OPC 478 UC and OPC 1655 dealers only for IC M35 Handheld marine transceiver waterproof Li lon batt pack amp charger Handheld marine transceiver wa
58. 718 SSB narrow filter 455KHz SSB 1 8KHz for IC 718 SSB wide filter 455KHz 3 3KHz for IC 718 Spare hand microphone600 Ohm 8 pin up down for IC 718 600 Ohm 8 pin deluxe base station desk microphone for IC 718 Carry strap kit for IC 718 ACC conversion cable for IC 718 Base station speaker large with audio filters for C 718 Base station speaker small for IC 718 DSP unit for IC 718 High stability crystal unit for IC 718 RS 232 computer interface for IC 718 Service manual on CD for IC 718 Spare DC lead 6 pin HF for IC 718 ICOM VHF UHF TRANSCEIVERS AND ACCESSORIES ID 5100E 2m 70cm 50w DSTAR mobile transceiver hand mic 3 5m extension cable mic hanger cloning software ID 5100E DELUXE 2m 70cm 50w DSTAR mobile transceiver MBF 1 MBA 2 MBR 100 UT 133 VS 3 OPC 2350LU USB data communication cable HM 154 Mobile hand microphone for ID 5100E HM 154T Mobile hand microphone for ID 5100E with keypad SP 30 Mobile extension speaker 20W rated input power 30W max for ID 5100E SP 35L Mobile speaker for ID 5100E MBA 1 Mobile mounting bracket for CD 5100 controller MBA 2 Mobile mounting bracket for ID 5100E controller MBF 1 Mobile mounting base for ID 5100E controller needs MBA 2 MBR 100 Trunion mount for main unit of ID 5100E OPC 1529R Data connection cable RS 232C type fight angled plug for ID 5100E OPC 2218LU Cloning cable USB for ID 5100E OPC 589 Microphone adaptor cable for ID 5100E to 8 pin round OPC 478UC
59. 79 95 94 95 249 95 249 95 249 95 249 95 269 95 m m led h band amp earmuffs with AD 1 IC BLUE 269 95 with AD 1 IC PINKE269 95 269 95 99 95 139 95 149 95 179 95 182 95 159 95 119 95 79 95 79 95 69 95 47 95 29 95 n C e e Ee pP I r L C C C FE SSE I CT C EEE EEE CC r CT E C E C CTC CC CC C EEE EEE CTC CET CE E C C ETC OOGO C C TOO OOO OOO HS 2 Deluxe PTT hand switch for all microphones LB 1R Illuminated Microphone Stand with WHITE LED In RED finish LB 1B lllumniated Microphone Stand with BLUE LED in BLACK finish AD 1 KX3 Cable for PRO SET to KX3 AD 1 C Cable for PRO SET right angle 3 16ths for Collins AD 1 D Cable for PROSET Drake 4 pin Foster AD 1 18 Cable for PROSET with capacitor for dynamic elements PRO models for Icom 8 pin round AD 1 IC8 Cable for PROSET no capacitor for use with IC elements for Icom 8 pin round AD 1 ICM Cable for PROSET no capacitor for use with IC elements for Icom 8 pin Modular IC 706 AD 1 IM Cable for PROSET with capacitor for dynamic elements PRO models for Icom 8 pin modular AD 1 K8 Cable for PROSET and Kenwood 8 pin round amp K3 AD 1 K4 Cable for PROSET and Kenwood 4 pin round AD 1 KM Cable for PROSET and Kenwood modular AD 1 T Cable for PROSET and 4 pin round Ten Tec AD 1 Y8 Cable for PROSET and Yaesu Ten Tec 8 pin round AD 1 Y4 Cable for PRO
60. 9 95 7 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 234 95 274 95 209 95 C3 CE3 rrroa T K E E I E E OOO CCC E E PE P I P I r P ee E A E E E T E e DD PE PE P e T P E E A E P e I E e P E EO CT CI CT CT EC Ce EC CE3 SP 2000 Y BHIDSP SP 8BHIDSP Yaesu SP 2000 speaker fitted with bhi NEDSP 1062 KBD DSP filter Yaesu SP 8 speaker fitted with bhi NEDSP 1062 KBD DSP filter BONITO SW RECEIVER RADIOJET 1102S PMS BON Pro Meteo Software RADIOCOM 6 Rig control 1 or 2 rigs extra interface req DSP filter and multimode tx rx SB RCHAM Additional radio interface for all radios except IC PCR100 amp IC PCR 1000 SB ICSWL Additional radio interface for original IC PCR100 amp IC PCR 1000 only RADIOCOM 4 5UNI Rig control 1 rig DSP filter and multimode decoder All radio exc PCR1500 2500 RADIOCOM 4 5PCR _ Rig control 1 rig DSP filter and multimode decoder PCR1500 amp PCR2500 ONLY RADIOCOM 6 UPG5 Radiocom 6 Update from Radiocom 5 x RADIOCOM 6 UPG4 Radiocom 6 Update from Radiocom 3 0 4 0 4 5 RADIOCOM 6 RX Radiocom 6 3 receive only software C A X cable set for Icom with 8 pin ACC IC 718 746 756 910 7200 7400 7600 7700 7800 etc C B X cable set for Icom with 13 pin ACC IC 706 IC 7000 C C RX cable set for Icom receivers IC R75 R9500 R7000 R7100 R8500 R10 YA A X cable set for Yaesu FT 1000MP FT 1000MKV FT 1000FIELD FT 920 FT 2000 FT 9000 YA B X cable set for Yaesu mini din to mini din FT 817 FT 857 FT 897 FT 900 FT
61. 9000EU H 67A8J zzss EE HEL E GA D VP 25 1770 lt lt 20 oo a YAESU AIRBAND A 230 A 310 A 720 IV 10 MH 44B4B NC 88C PA 48U PA 48C VAC 370U VAC 370C PA 23U PA 23C Q7000451 Inversion encryption unit for VX 2100 2200 MDC1200 GE STAR ANI encoder only unit for VX 2100 2200 RS 232 DB9 programming cable for VX 2100 2200 needs CT 29 RS 232 DB9 programming cable PC interface for VX 2100 2200 USB interface adaptor for use with CT 104A and VX 2100 2200 Programming cable for FIF 10A and VX 2100 2200 Programming software for VX 2100 2200 Mobile transceiver 501ch VHF 134 174MHz display mobile transceiver 501ch UHF 400 470MHz display Hand microphone for VX 4204 4207 Keypad microphone for VX 4204 4207 Heavy duty noise cancelling microphone for VX 4204 4207 Desktop microphone for VX 4204 4207 High Power external speaker for VX 4204 4207 High power external mobile type speaker for VX 4204 4207 Mobile mounting bracket for VX 4204 4207 LF 1 line filter DC for VX 4204 4207 Digital voice storage for VX 4204 4207 DTMF paging and encryption for VX 4204 4207 Rolling code encryption unit for VX 4204 4207 Inversion encryption unit for VX 4204 4207 MDC1200 GE STAR ANI encoder only unit for VX 4204 4207 MDC1200 GE STAR ANI encoder decoder unit for VX 4204 4207 RS 232 DB9 programming cable for VX 4204 4207 needs CT 29 RS 232 DB9 programming cable PC interface for VX 4204 4207 USB interfa
62. 95 24 95 8 95 41 95 37 95 10 95 4 95 8 95 234 95 234 95 244 95 244 95 254 95 254 95 7 95 7 95 7 95 7 95 7 95 8 95 7 95 24 95 29 95 47 95 26 95 26 95 254 95 254 95 22 95 48 95 44 95 64 95 21 95 284 95 23 95 61 95 109 95 18 95 24 95 24 95 16 95 41 95 37 95 39 95 4 95 8 95 259 95 31 95 31 95 31 95 31 95 24 95 29 95 47 95 26 95 26 95 254 95 254 95 22 95 48 95 44 95 64 95 21 95 284 95 23 95 61 95 109 95 29 95 21 95 29 95 16 95 41 95 37 95 39 95 4 95 8 95 139 95 139 95 156 95 156 95 28 95 33 95 51 95 61 95 28 95 25 95 2 95 1 95 9 95 31 95 284 95 CTC E PE d E 3 C C CT TET E E E a I G ECC CTC E GT E C C CEE EE a C3 C3 E CT CTET I C EC S E EEE CC Er E e e E E a GES O E CT CET ET CET E a E FVP 36 VME 100 CT 126 CT 29 FIF 10 CT 104A VX2100 VX 4204E VX 4207E MH 67A8J MH 75A8J MH 53A8J MD 12A8J MLS 100 MLS 200 MMB 85 LF 4 DVS 5 FVP 25 FVP 35 FVP 36 VME 100 VMDE 200 CT 126 CT 29 FIF 10 CT 104A VX4200 VX 5500L MH 53B7A MH 53C7A MLS 100 MLS 200 MMB 75 MMB 76 FVP 25 FVP 35 FVP 36 VME 100 FIF 7A CT 72 CT 70 CT 29 FIF 10 CT 105 VX5500 VXR 7000V EX50W VXR 7000V CGA VXR 7000U DGA MH 67A8J D 12A8J PC 7000 EU PC 7000 UK 126 szzg2o2ozzz 3 XR 9000V IXR 9000EV IXR
63. 95 274 95 18 95 18 95 8 95 36 95 33 95 219 95 62 95 86 95 61 95 48 95 159 95 159 95 30 95 36 95 38 95 57 95 62 95 8 95 28 95 26 95 23 95 36 95 33 95 17 95 61 95 39 95 61 95 264 95 264 95 264 95 30 95 36 95 38 95 57 95 62 95 8 95 28 95 16 95 40 95 23 95 33 95 17 95 174 95 61 95 61 95 33 95 309 95 309 95 274 95 199 95 30 95 36 95 38 95 57 95 62 95 43 95 18 95 16 95 8 95 40 95 23 95 36 95 194 95 33 95 17 95 174 95 62 95 86 95 61 95 61 95 OOO K TOOT OOO OOO EOR OE K K T T T T T T TK TK OOO OOO OK KK OOO KOKO KOKO KOK OOO KOK KOK OOO KO KPG 92D TK 7189E TK 8189E KMC 30 KMC 32 KMC 35 KMC 36 KMC 9C KAP 2 KCT 23M3 KCT 40 KCT 46 DI 03 ES 3 ES 5 GS 3 LF 2 MB 10 PS 10A RK 10 GS 1 CT 53U PG 46A PG 92D BABAAxAAaABAABaABAD A K 2000T K 3000T RA 22M RA 22M2 RA 22M3 RA 23M RA 26M RA 26M2 RA 26M3 RA 27M KNB 63L KNB 65L KSC 35ST KVC 22W KSC 356T KWR 1 EMC 12 KBH 18M KHS 1 KHS 7 KHS 7A KHS 8BL KHS 9BL KHS 10 OH KHS 21 KHS 22 KHS 29F KMC 45 KMC 21 PG 22A PG 22U CT 53U PG 137DM K 2302 K 3302 RA 22M RA 22M2 RA 22M3 RA 23M RA 23M3 RA 26M RA 26M2 RA 26M3 RA 27M RA 27M3 KNB 29N KNB 45L KSC 31T KSC 35ST KSC 316T KSC 356T KMB 30M KLH 120 KLH 131 KWR 1 EMC 12 EMC 6 KBH 10 KEP 2 KHS 1 KHS 10
64. 95 42 95 249 95 86 95 169 95 29 95 30 95 37 95 127 95 61 95 61 95 101 95 0 00 24 95 10 95 14 95 329 95 30 95 36 95 127 95 61 95 61 95 0 00 24 95 10 95 14 95 12 95 426 95 63 95 20 95 38 95 37 95 54 95 41 95 30 95 19 95 25 95 25 95 7 95 20 95 14 95 0 00 236 95 64 95 19 95 26 95 37 95 37 95 54 95 41 95 19 95 30 95 25 95 7 95 20 95 33 95 61 95 20 95 25 95 32 95 20 95 31 95 9 95 10 95 3 95 2 95 119 95 119 95 41 95 41 95 23 95 35 95 41 95 19 95 37 95 35 95 52 95 39 95 29 95 19 95 19 95 24 95 24 95 8 39 32 95 59 95 0 00 119 95 119 95 119 95 OOOO T OOO TGO T T T TWO OGO TOO TD TT T T 0 GOGO C i de E E EC EE E Leal alaa 1 a 0 0 E 1 aa 1 ala 0 0 L 1 E 1 1 E 11 1 0 L 0 1 0 E 1 1 11 BC 21E Spare wall charger for TH K2 4 17 95 49 95 64 95 20 95 26 95 37 95 37 95 54 95 41 95 30 95 19 95 25 95 25 95 7 95 20 95 33 95 61 95 10 95 14 95 7 95 12 95 15 95 20 95 3 99 33 95 54 95 24 95 10 95 2 95 3 95 9 95 9 95 21 95 5 95 20 95 499 95 9 95 33 95 33 95 14 95 14 95 12 95 49 95 26 95 30 95 34 95 29 95 52 95 62 95 48 95 10
65. 95 779 95 1 179 95 294 95 399 95 469 95 129 95 89 95 99 95 99 95 19 95 54 95 54 95 59 95 249 95 189 95 194 95 204 95 299 95 229 95 hh rr m m 269 95 499 95 289 95 299 95 309 95 329 95 385 95 579 95 399 95 449 95 449 95 579 95 699 95 699 95 899 95 999 95 1 099 95 1 599 95 69 95 89 95 69 95 62 95 129 95 99 95 148 95 129 95 175 95 149 95 199 95 169 95 179 95 299 95 189 95 209 95 299 95 399 95 349 95 399 95 549 95 599 95 179 95 229 95 289 95 299 95 314 95 49 95 79 95 39 95 49 95 53 95 59 95 63 95 75 95 79 95 99 95 29 95 49 95 74 95 89 95 19 95 34 95 59 95 74 95 89 95 04 95 34 95 64 95 94 95 227 95 249 95 269 95 299 95 325 95 385 95 405 95 429 95 455 95 479 95 509 95 539 95 559 95 ta tG mm m m m m AADAADADAADAADAAAAAAAAIQAIAIANYD DADDADADADDADADADAADAAADAADADAADADADADADAAAAAAIDADAAVDADANDVIAIAIAIAAYA CT CC CE E ETC COT ET EEOC CTC CTC CE3 CCC CECI C CH CCC CTC EEE EEE CTC CTC CCC 6 element 2 x 3 144MHz cross polarised MAP65 yagi 0 67m long SkW 8 67dBi gain 89 95 8 element 2 x 4 144MHz cross polarised MAP65 yagi 1 17m long 5kW 9 49dBi gain 115 95 10 element 2 x 5 144MHz cross polarised MAP65 ya
66. 99 90 0 0 3 00 3 00 1 95 14 95 1 50 10 99 0 50 1 95 6 95 1 95 1 95 1 95 7 95 2 95 1 95 5 95 5 95 7 95 3 95 3 95 3 95 3 95 1 95 17 99 1 95 3 95 2 95 1 95 3 95 3 95 3 95 3 95 3 95 3 95 6 00 3 95 3 95 3 95 5 95 5 95 3 95 4 95 3 95 2 95 5 95 2 95 2 95 2 95 5 95 5 95 1 95 3 95 1 00 1 00 1 95 3 95 2 95 2 95 2 95 2 95 1 50 2 95 2 95 3 95 3 95 3 95 1 95 4 95 4 95 4 95 4 95 5 95 5 95 7 95 4 95 7 95 5 95 5 95 3 95 3 95 2 95 2 95 8 95 3 95 3 95 3 95 5 95 3 95 3 95 3 95 4 95 3 95 8 95 3 95 3 95 3 95 4 95 3 95 4 95 4 95 3 95 3 95 5 95 3 95 4 95 4 95 3 95 4 95 3 95 3 95 3 95 3 95 3 95 3 95 3 95 T T T T K T T e K T T K T T T K T T K T T K K T T K T T T K T T K T T T K T T T K T T K T T T K T T K K T T K T T T K T T K K T T K T T T K T T K T T T K T T K e T T K T T T e T T K K T T K T T T K T T K T T T e T T T T T T K T SJS MJP ADP P001 ADP P002 F369 F963 ADP P003 ADP P004 AAD151 ADP P005 ADP P006 ADP S001 ADP S002 ADP S003 ADP S004 ADP S005 N 3 S0 3 S0 1 BNC 3 BNC 1 8PMILP PMILP PM PM PM PM PM PM PM PMS PMS PMS PMS PMS PMS PMS RJ 11 CR RJ 12
67. 99 95 27 95 WDBWFEFOFOODFONOONSFSFSFSESFOSFOONVINIOIDSSSESESESFPOSESPAIQFSFONIVDSESFOIVDIVDINDINAINDFNINDOSSESYSEYSSPYSPSrSFSFSFOIEFOOVSEOSESFSFPAINIIFSONINDESEONDNDINVININAINAINOSSSESEOYS eE DDC CCC O C C1 CTC C3 C1 DG OPC 1939 OPC 1132A OPC 1122 U MBR 100 SP 10 UT 108R UT 109R UT 110R CS F5020 SM F5022 6022 IC F5062 IC F6062 HM 148 HM 152 HM 152T SM 25 OPC 1122 OPC 1122U SP 10 PS 1508 001 PS 1508 008 UT 110R UT 119H UT 126H UT 96R OPC 607 OPC 608 OPC 609 RMK 3 CS F5062 SM F5062 IC F1710 IC F1810 IC F2710 IC F2810 HM 148 HM 152 HM 152T OPC 607 OPC 608 OPC 609 OPC 617 OPC 1122 PS 1508 001 PS 1508 005 RMK 2 UT 109 UT 110 SM 25 CS F1710 SM 1710 15 pin accessory cable DC power cable 3m standard Cloning cable USB Spare mobile mount for IC F5022 6022 Mobile extension speaker medium sized 5 Watts 4 Ohms DTMF decoder unit 40 pin type Scrambler unit inversion non rolling type voice scrambler 40 pin for IC F3022 4022 Scrambler unit inversion and rolling 40 pin type Programming software for IC F5022 6022 dealers only Service manual for IC F5022 6022 on PC CD ROM VHF FM transceiver with HM 152 OPC 1194A 136 174MHz UHF FM transceiver with HM 152 OPC 1194A 400 470MHz Heavy duty microphone Standard mobile microphone Mobile 10 key microphone Desk microphone Cloning cable dealers only Cloning cable dealers only USB type Mobile extension speaker 4W 8 Ohms 10 Amp power supply with choice of b
68. A A 1111 a ANDAAADAANDADAANDANDDODDO OOO DODO DODDODOD DODO DO DODD DO DODOODDODDODOODODODODDODODODODODODOOFAONDANQN0N000FF igithe WS Our tt ver Profsecfonal E RE 7 TT jGeatures se am E i jsum display ald ns ai Dates ae ue es ad mee 2 2 Otitdoor air huimidityAemperature receiving ai Eiis Benz es OA Wind speed andwind direction isplay S os e Wind chill and Dew point temperature display ae e Rainfall data in hr day week month amp total since last reset e Barometric pressure display A he e Upload weather data to internet automatically Ya a N e Lux Meter solar power index d S e High Visibility Colour LCD Display SN gt MicroSD Memory Card Stun X e Wi Fi Connection E WA SON 7 N Available Now AS 199 95 CEEE 4 far _ a 1 248 38 02 S da Aae n T E E
69. ATU optimising Rig to soundcard isolation interface kit 200 Watt antenna tuning kit HF Watt meter kit 20m CW QRP transceiver ki 30m CW QRP transceiver ki 40m CW QRP transceiver ki 80m CW QRP transceiver ki Utility audio amplifier kit Case for 1551 and 1552 T G M MINI BEAM ANTENNAS Rotatable dipole 10 15 17 20 40m 1 5kW PEP 21 5ft long 2 element beam 10 15 17 20 40m 1 5kW PEP 21 5ft long 10ft boom Mini beam 6 10 15 20m 2 elements 1 2kW PEP Mini beam 6 12 17 20m 2 elements 1 2kW PEP Mini beam 6 12 17 30m 2 elements 1 2kW PEP Mini beam either tune for 10 6m or 11 6m 2 elements Mini beam 6 10 15 20m 2 elements 1 2kW PEP Enhanced reflector 39 95 13 95 2 699 95 2 995 95 339 95 139 95 139 95 159 95 145 95 35 95 3 799 95 149 95 32 95 79 95 19 95 85 95 349 95 269 95 52 95 339 95 45 95 159 95 43 95 26 95 13 95 7 95 999 95 899 95 12 95 35 95 629 95 11 95 99 95 189 95 43 95 149 95 32 95 32 95 32 95 32 95 105 95 76 95 31 95 31 95 24 95 85 95 269 95 39 95 39 95 39 95 39 95 32 95 29 95 29 95 139 95 25 95 25 95 25 95 25 95 5 95 5 95 3 95 3 95 3 95 9 95 3 95 5 50 5 50 5 50 5 50 5 50 6 95 5 95 5 95 269 95 269 95 314 95 269 95 31 95 9 95 12 95 27 95 27 95 27 95 32 95 399 95 3 999 95 279 95 39 95 TBA POA
70. AWM 30B 1 8 30MHz 300 3000W SWR Power meter AWM 35B Power meter flat shape for mobile 3000 300 Watts scale AWM 35BH Power meter flat shape for mobile 1000 100 Watts scale CF 5X EBS 1 Add on electronic bias for AL 80A 82 1200 1500 EBS 1H Add on electronic bias for non Ameritron amplifiers GOP 100 Grid overload protection for all amplifiers ICP 240 nrush curent protector 240V MIA 1 n line fuse holder MIA 2 AGU in line fuse distribution block MIA 3 Remote power on off relay MIA 4 Battery post break out block MIA 5 Braided groud strip 13 QSK 5X Pin diode transmit receive switch QSK 5PC PCB QSK80A 80B 1500 1200 82 572 800 800H RCS 4X Remote 4 way coaxial switch 1 30MHz 2 5kW PL 259 220V RCS 4LX Remote 4 way coaxial switch 1 30MHz 2 5kW PL 259 220V lightning protection RCS 8VX Remote 5 way coaxial switch 1 30MHz 2 5kW PL 259 220V RCS 8VLX Remote 5 way coaxial switch 1 30MHz 2 5kW PL 259 220V lightning protection RCS 8VNX Remote 5 way coaxial switch 1 30MHz 2 5kW N type 220V RCS 8VNLX Remote 5 way coaxial switch 1 30MHz 2 5kW N type 220V lightning protection RCS 10X Remote 8 way coaxial switch 1 30MHz 5kW PL 259 220V RCS 10LX Remote 8 way coaxial switch 1 30MHz 5kW PL 259 220V lightning protection RCS 12X Automatic 8 position remote antenna switch 220V RCS 12CX Automatic remote antenna switch controller RCS 12LX Automatic 8 position remote antenna switch with lightning protection 220 V SDA 100 HF mobile screwdriver antenna 3 5 30MHz 1 2KW SDA 110
71. BC 119 121N adaptor pod BC 119N 121N adaptor for BP 202M Charger adaptor for BC 119 121 and IC T3 Spare bulkhead mount battery charge pod for BP 215 for IC M1EUROV Battery spacer 2 pin 220V charger 10 5V 1 5 Amp Automatic antenna tuner for HF transceiver Waterproof bag for IC T3 Charger replaces BC 77E Battery charger for IC 2E H2 H6 IC 02E IC 32E U16 H16 M12 M11 BP 2 3 5 7 8 Charger for IC M3EURO 2 pin 220V Desk top fast charger with BC 145 need adaptor s 6 way desk top fast charger need adaptors and PSU Fast charger including AD 50 AD 75 amp BC 145 1 5 hour for A22 3 Single fast charger for 1 x BP 202M includes AD 89 amp BC 14 Twin fast charger for 2 x BP 202M amp BC 06 Fast charger includes AD 102 amp BC 146 for IC M1 6 way charger including 6 x AD 102 adaptors and BC 124 for IC M1 6 way fast charger for IC 446S includes 6 x AD 89 and BC 124 6 way charger including AD 50 AD 75 amp BC 124 for A22 3 and NiCd batteries 2 pin 220V charger 2 pin 220V charger 12V 1 Amp 2 pin 220V charger 6V 1 AMP for IC R20 Battery charger for BP 228 Spare rapid charge pod for BC 145 2 pin 220V charger 12V 0 5 Amp Protective yellow canvas case with belt clip Belt clip for IC W31 IC W32 Belt clip for IC M1 M1V R10 Belt clip for IC R2 Desk top charger for M15E Wall charger for A22 3 Dry cell case 4 x AA cells for IC T22 Ni MH battery pack 9 6V 760mAh for IC T8 81 Spare 7 4V 1600mAh LI ON battery pack for IC M1EURO Spare battery pack 3 7V 1900mA
72. Combination pack of SDA 100 amp SDC 100 amp SWP 100 SDA 112 Combination pack of SDA 100 amp SDC 102 amp SWP 100 SDA 113 Combination pack of SDA 100 amp SDC 103 amp SWP 100 SDC 100B Digital controller for SDA 100 and others SDC 102 Programmable screw driver antenna controller SDC 1041 Auto screw driver antenna controller Icom SDM 100 Mount for SDA 100 SWP 100 6 feet stainless steel whip 3 8ths stud SRS 100 SDA 100 remote switch sensing kit for High Sierra SRS 1001 SDA 100 remote switch sensing kit for Hi Q PNP 35 Plug and play amplifier cable for FT 100 D PNP 5D Plug and play amplifier cable for FT 980 PNP 5M Plug and play amplifier cable for FT 847 PNP 7D Plug and play amplifier cable for TS 440 690 450 180 140 950 130 870 2000 50 PNP 7DK Plug and play amplifier cable for TS 930 PNP DB15Y Plug and play amplifier cable for FT DX3000 PNP 8D Plug and play amplifier cable for FT 1000 MP 990 767GX 920 990 747GX PNP 8DI Plug and play amplifier cable for 8 pin din Icom ACC jack PNP 8M Plug and play amplifier cable for FT 890 840 817 PNP 8MK Plug and play amplifier cable for 8 pin mini din TS 480 PNP 13D Plug and play amplifier cable for IC 706 380 0811A Spare 811A valves for AL 811X 380 0500GT Spare 3 500ZG valve 407 1072X Adaptor 12V AC 1 Amp 220V AC ANTENNA ANTHOLOGY WA 103 Broadband antenna 7 30MHz 1 8 30MHz receive 150W pep 8 5m approx length DA3HM Professional discone antenna 100 3000MHz 200W PL 259 ANTIFERENCE FM RADIO ANTENNAS AF RO
73. D 8MY Adonis microphone lead wired with RJ 45 large modular Yaesu plug 19 95 A DR 635E 2m 70cm FM dual band mobile transceiver 299 95 P 88Y Adonis microphone lead wired with 8 pin round Yaesu plug for older radios 19 95 A EDS 9 Seperation kit for DR 635E 29 95 D 88Y3 Adonis microphone lead wired with 8 pin round Yaesu plug 19 95 A Spare 12V DC lead C W 2 x 15A fuses for DR 635 9 95 D 8MK Adonis microphone lead wired with RJ 45 modular Kenwood plug 19 95 A EMS 57 Optional DTMF hand microphone back lit with DTMF amp remote contol key pad 49 95 D 88K Adonis microphone lead wired with 8 pin round Kenwood plug 19 95 A EMS 53 Spare hand microphone for DR 635 34 95 D 88C Adonis microphone lead wired with 8 pin round Alinco plug 15 95 A EJ 50U Direct GPS input for APRS TNC supports digipeat mode for DR 635 149 95 D 8MC Adonis microphone lead wired with RJ 45 Modular Alinco plug 15 95 A DR 135EMKill 2m FM mobile 50W packet option 189 95 P 8i Adonis microphone lead wired for Yaesu Icom Alinco Standard ADI handhelds 19 95 A EMS 53 Spare hand microphone for DR 135 34 95 P 8i3 Adonis microphone lead wired for IC Q7 T 81 T 90 etc handhelds 22 95 A EMS 56 Hand microphone back lit with DTMF key pad for DR 135 39 95 P 8K4 Adonis microphone lead wired for Kenwood handhelds 22 95 A EMS 57 Hand microphone back lit with DTMF amp remote contol key pad for DR 135 49 95 AMCM Adonis 8 core microphone cable per meter 2 95 A EJ 41U Option
74. DC 500 MHz N 15 Watts average 300 Watt dummy load 0 3GHz N type 1 5 KW dummy load DC 650 MHz PL 259 1 5 KW dummy load DC 650 MHz N type 2 5KW dummy load fan cooled HF VHF UHF digital SWR analyser with digital readout 1 5 65MHz 105 230MHz 300 490MHz Dummy load with VSWR meter DC 54MHz 300W 1500W HF VHF UHF digital SWR analyser 530KHz 230MHz 415 470MHz HF VHF UHF digital SWR analyser professional version 1 8 170 amp 430 520MHz Lightning surge protector up to 1000MHz 400W SO 239 SO 239 Lightning surge protector up to 1000MHz 400W SO 239 PL259 Lightning surge protector up to 1000MHz 400W N type Lightning surge protector up tp 1000MHZ 1 5kW S0239 S0239 Lightning surge protector up to 1000MHz 1 5kW SO239 PL259 Lightning surge protector up tpo 1000MHz 1 5kW N connectors Extension speaker for mobile use with magnetic swivel base Extension speaker for mobile use Neckset microphone with PTT amp speaker for Icom Alinco Yaesu etc Neckset microphone with PTT amp speaker for Kenwood Neckset microphone with PTT amp speaker for Yaesu 1 x 4 pole plug screw type Neckset microphone with PTT amp speaker for Yaesu 1 xd 4 pole plug type Ear vibration speaker microphone for Icom Ear vibration speaker microphone for kenwood Ear vibration speaker microphone for Yaesu Earpiece with boom microphone and FM scan radio for Icom Earpiece with boom microphone and FM scan radio for Kenwood Earpiece with boom microphone and FM scan
75. Eagle Optional internal ATU module for Eagle 599 Optional 1 8KHz roofing filter for Eagle Optional 600Hz roofing filter for Eagle Optional 300Hz filter for Eagle Optional 6KHz AM filter for Eagle Optional 15KHz AM FM filter for Eagle Mounting bracket for Eagle External speaker black 4 Ohms 5 Watts for Eagle Regal desk microphone with 707 T8 lead included Ten Tec 8 pin 716 stand not included for Eagle Desk stand for 707 microphone USB soundcard digital mode adaptor cable for Eagle Power supply with speaker for Eagle Switch mode power supply 115 230VAC in 13 8VDC out 25 Amps for Eagle Compact HF 1 10w transceiver DSP 12vdc 160 10m excluding 60 amp 12m Optional 6KHz AM filter for Argonaut Hand microphone 8 pin for Argonaut Amplifier for HF amp 6m 5W in 100W out for Argonaut USB soundcard digital mode adaptor cable for Argonaut 229 95 199 95 499 95 159 95 349 95 289 95 159 95 159 95 179 95 299 95 249 95 69 95 69 95 9 95 42 95 8 95 8 95 8 95 8 95 8 95 8 95 8 95 8 95 8 95 8 95 8 95 8 95 20 95 559 95 21 95 21 95 21 95 9 95 1 374 95 924 95 874 95 569 95 479 95 34 95 39 95 529 95 499 95 499 95 699 95 599 95 269 95 269 95 499 95 113 95 204 95 149 95 81 95 149 95 204 95 2 099 95 2 099 95 2 099 95 2 099 95 199 95 4 095 95 4 379 95 3
76. Earpiece with boom microphone for Icom Earpiece with boom microphone for Kenwood Earpiece with boom microphone for Yaesu VX 7R Earpiece with boom microphone for Yaesu 1 x 4 pole plug type Handheld speaker microphone for com Handheld speaker microphone for Handheld speaker microphone for Speaker mic for Icom Yaesu etc Speaker mic for Kenwoo Speaker mic for Yaesu VX 7R Speaker mic for Yaesu FT 10 50 51 Speaker mic with PTT lock and vol enwood Yaesu 1 x 4 pole plug O VX1VX5 ICQ7 etc lume control for Icom 35 95 4 95 34 95 5 95 11 95 22 95 72 95 111 95 69 95 108 95 59 95 59 95 29 50 15 95 26 95 35 95 29 95 24 95 25 95 78 95 169 95 86 95 108 95 99 95 106 95 189 95 109 95 90 95 121 95 279 95 279 95 279 95 279 95 279 95 279 95 279 95 184 95 339 95 329 95 219 95 269 95 79 95 159 95 59 95 249 95 14 95 39 95 54 95 34 95 45 95 109 95 79 95 86 95 209 95 299 95 169 95 339 95 359 95 27 95 37 95 37 95 39 95 44 95 44 95 25 95 15 95 29 95 29 95 29 95 29 95 39 95 39 95 39 95 46 95 46 95 46 95 19 95 19 95 23 95 18 95 9 95 28 95 28 95 28 95 28 95 44 95 22 95 22 95 22 95 22 95 22 95 22 95 22 95 22 95 22 95 22 95 22 95 23 95 23 95 23 95 19 95 19 95 23 95
77. Fast charger includes AD 100 amp BC 145 6 way charger including 6 x AD 100 adaptors and BC 124 UK mains PSU for BC 119N fast charger Desktop charger for IC M87 Spare AC adaptor for BC 121 12V cigarette lighter lead for charging or 12V supply for IC M87 Dry cell case for IC M87 5 x AA cells Spare Li lon battery 7 2V 1700mAh for IC M87 Waterproof speaker microphone Aerial VHF 150 162MHz for IC M87 Aerial VHF 160 174MHz for IC M87 Bare ends DC lead for battery charging or 12 V supply for IC M87 Cloning cable for IC M87 serial Cloning cable for IC M87 USB Cloning software for IC M87 Service manual for IC M87 on CD Marine hand held tough water proof transceiver voice scrambler BC 119N charger adapter Fast charger includes AD 109 amp BC 145 BP 224 only 6 way charger including 6 x AD 109 adaptors and BC 157 BP 224 only UK mains PSU for BC 119N fast charger Charger 2 pin euro for BC 158 Spare AC adaptor for BC 121 Desktop charger Single desktop rapid charger 12V cigarette lighter lead for charging or 12V supply Spare Li lon battery pack 7 4V 980mAh Waterproof speaker microphone Headset ear piece type needs OPC 1392 Headset neck arm type needs OPC 1392 Earphone with throat mic needs OPC 1392 Spare Alligator style belt clip YELLOW Swivel belt clip Cloning cable PC to transceiver Bare ends DC lead for battery charging or 12 V supply DC cable 12 20V for BC 121N Cloning cable adaptor Headset adaptor cable
78. HF mini stick for 12m 3 8ths stud HF mini stick for 15m 3 8ths stud HF mini stick for 17m 3 8ths stud HF mini stick for 20m 3 8ths stud HF mini stick for 30m 3 8ths stud a 817 Ann el el ni ni aa 90 95 88 95 39 95 39 95 101 95 101 95 55 95 59 95 40 95 132 95 79 95 96 95 45 95 45 95 45 95 45 95 45 95 45 95 244 95 234 95 69 95 90 95 43 95 67 95 49 95 41 95 70 95 44 95 34 95 359 95 399 95 389 95 449 95 514 95 49 95 192 95 204 95 174 95 174 95 269 95 299 95 339 95 309 95 399 95 40 95 79 95 19 95 29 95 29 95 19 95 22 95 24 95 24 95 44 95 29 95 29 95 24 95 29 95 29 95 43 95 67 95 34 95 84 95 85 95 69 95 112 95 244 95 204 95 159 95 209 95 53 95 199 95 249 95 259 95 89 95 99 95 99 95 149 95 169 95 179 95 56 95 101 95 84 95 84 95 159 95 39 95 13 95 29 95 25 95 56 95 199 95 30 95 53 95 67 95 59 95 79 95 79 95 99 95 129 95 53 95 64 95 54 95 54 95 57 95 57 95 57 95 59 95 99 95 179 95 22 95 22 95 22 95 22 95 22 95 22 95 22 95 AAADAAAAADAAAADAADAADADADADADADADANSFSFOSSFSFOVVVVVAOVVVVVVVVVAVDVNDNDNDOFOSFOOS SES SESESSESESEESEFSFUVUVIVVVVVVVVCVOCFUVTVTDSFONN
79. Include 20 VAT except books which are zero rated EU customers now have to pay VAT unless they are VAT registered Other overseas customers can still buy at ex VAT prices so 20 can be deducted from the prices listed Carriage Is charged at cost and as this varies enormously each overseas order will have to have a separate carriage quote from us unless they arrange their own carrier We deal with many enquiries from overseas and are able to offer a mail order service all over the world The easiest way to do this is to ask us for a for a pro forma invoice and then give us your credit card details if you accept the quote We will supply our bank details for a direct credit Please do not hesitate to contact us if you need any information at all Overseas visitors to our premises will be offered a VAT refund form where appropriate This price list supersedes all previous Waters amp Stanton price lists it has been put together in good faith and every step has been taken to ensure that the prices listed herein are accurate at the time of going to print However due to circumstances beyond our control prices do vary from time to time for different reasons and we cannot be held responsible for this We know that special offers are advertised by our competitors in the various magazines Contact us to confirm price before sending an order if you want to be certain of the deal that you are going to get All prices are shown in Sterling E amp O E
80. KMC 41 Speaker microphone for NX 200E 300E 33 95 VGS 1 Voice guide amp storage unit for NX 200E 300E 86 95 KPG 36A Programming interface cable for NX 200E 300E 49 95 KPG 111DM Programming software for NX 200E 300E 48 95 NX 220E Digital and analogue handheld transceiver VHF 136 174IMHz 5W 260ch 16 keys needs batt chgr ant 314 95 NX 220E2 Digital and analogue handheld transceiver VHF 136 174IMHz 5W 260ch 4 keys needs batt chgrant 294 95 ECC E OOO OOO T T OOO OOO TOO TOO OOO T T T TT T T T T TOHO OD 00 OOO T O TOH TOHO T T T T T T T OHO OOO OO NX 220E3 NX 320E NX 320E2 NX 320E3 KRA 23M KRA 23M3 KRA 27M KRA 27M3 KRA 22M KRA 22M2 KRA 22M3 KRA 26M KRA 26M2 KRA 26M3 KBP 5 KNB 55L KNB 56N KNB 57L KSC 25T KSC 30T KSC 256T KBH 12 KHS 10 OH KHS 21 KHS 8BL KHS 9BL KMB 30M KMC 21 KMC 45 KMC 48GPS KTI 4 KWR 1 KCT 53U KPG 141DM KPG 22A NX 700E NX 800E KMC 30 KMC 32 KMC 35 KMC 36 KMC 9C KAP 2 KAS 10 KCT 23M KCT 23M3 KCT 46 KES 5 KLF 2 KMC 38GPS KRK 10 VGS 1 KPG 46A KPG 111DM Digital and analogue handheld transceiver VHF 136 174IMHz 5W 64ch no keypad needs batt chgr ant Digital and analogue handheld transceiver UHF 400 470MHz 5W 260ch 16 keys needs battichgr ant Digital and analogue handheld transceiver UHF 400 470MHz 5W 260ch 4 keys needs batt chgr ant Digital and analogue handheld transceiver UHF 400 470MHz 5W 64ch no keypad needs batt chgr ant UHF short antenna 440 490MHz for TK 220 320 UHF shor
81. Kenwood USA web site MJ 88 Mic plug adaptor for TM 281E PG 2N DC cable for TM 281E PG 3B DC line noise filter for TM 281E PS 60 Regulated matching power supply 22 5 Amps 13 8 Volts for TM 281E TM 271E Discontinued accessories still available KMC 30 Hand microphone standard for TM 271E KMC 32 Hand microphone with DTMF for TM 271E MC 60A Dual impedance desk mic pre amp for TM 271E needs MJ 88 KPG 46A PC interface cable for TM 271E KCT 53U Serial to USB adaptor with drivers MCP 1A Memory Control Software download free from Kenwood USA web site MJ 88 Mic plug adaptor for TM 271E PG 2N DC cable for TM 271E PG 3B DC line noise filter for TM 271E PG 5A Data cable for TM 271 KENWOOD VHF UHF HANDHELD TRANSCEIVERS TH D72EE 2m 70cms handheld with GPS TNC APRS 118 174 amp 320 524MHz inc PC cable PB 45L Spare Lithium lon rechargeable battery 7 5V 1550mAh for TH D72E BT 15 Dry cell case 4 x AA for TH D72E KSC 32T Rapid charger for TH D72E EMC 12 Clip microphone with D type earpiece was EMC 6 for TH D72E HMC 3 Headset boom mic VOX PTT for TH D72E KHS 21 Headset boom mic less VOX for TH D72E KHS 29F Boom microphone with D type earpiece and PTT for TH F7E was KHS 28F for TH D72E SMC 32 Speaker mic for TH D72E SMC 33 Speaker mic with 3 functions for TH D72E SMC 34 Speaker mic with 3 functions and volume control for TH D72E PG 2W DC cable open end for TH D72E PG 3J Cigar cable with filter for TH D72D S C 55 Nylon case for TH D72E MCP 4A Memory co
82. LIMITED IT 24 Intemet tester 2 3 2 6GHz Professional tester for wi fi cctv WiMax ZigBee wireless network 2 3 2 6 GHz 269 95 AA 1400 Antenna analyser 1 1400MHz 899 95 AA 1000 Antenna analyser 1 1000MHz 9 12V N type USB 699 95 AA 600 Antenna analyser 1 600MHz 9 12V N type USB 529 95 AA 170 Antenna analyser 0 1 170MHz USB PL 259 USB 429 95 AA 54 Antenna analyser 0 1 54MHz USB PL 259 USB 279 95 AA 30 Antenna analyser 0 1 30MHz USB PL 259 USB 199 95 17 Digital mode interface 169 95 15 Digital mode interface 199 95 RIG EXPERT STAN USB Modem for digital modes built in soundcard plus interface for CAT 155 95 WT Control transceiver via internet 279 95 RIG EXPERT TINY Soundcard to transceiver interface state radio 49 95 CHG RE UK Spare charger for RIGEXPERT antenna analyser 3 pin UK plug 9 95 CHG RE EU Spare charger for RIGEXPERT antenna analyser 2 pin EU plug 9 95 C 001 ransceiver cable RigExpert to transceiver wired cable ready to use IC 7600 7700 7800 49 95 C 002 ransceiver cable RigExpert to transceiver wired cable ready to use IC 706 718 703 7000 7200 7400 9100 49 95 C 003 ransceiver cable RigExpert to transceiver wired cable ready to use IC 746 7400 49 95 001S ransceiver cable RigExpert to transceiver wired cable ready to use TS 570 590S 2000 49 95 002 ransceiver cable RigExpert to transceiver wired cable ready to use TS 850 950 49 95 003 ransceiver cable RigExpert to transceiver wired cable ready to use TS
83. Lead RJ 45 to bare end 3 long use to make your own cable 4 95 A WR G313i 180 internal PCI card professional HF receiver 9KHz 30MHz with 180MHZ option fitted 1 329 95 FT100 CBL Lead RJ 45 to RJ 22 3 long adapts any model to FT 100 15 95 A WR 180 Frequency extension option 180MHz for WR G313i must be factory fitted 269 95 HT1 CBL RIGblaster to handheld adapter cable 21 95 A WR XR External reference oscillator option for WR G313i must be factory fitted 209 95 PP CW CBL Stereo 3 5mm jack plug to 1 4 inch stereo jack plug CW keying cable 6 feet long 9 95 A WR RO Reference oscillator output option for WR G313i must be factory fitted 159 95 CWSWITCHIDUO Cw switch for RIGblaster Duo 53 95 C WR IF4 F output option 10 7 MHz for WR G313i must be factory fitted cannot be fitted with WR IF4 269 95 RBDUO LEDS LED indicators for RIGblaster Duo 16 95 A WR IF4 F output option for WR G313i 45 MHz must be factory fitted cannot be fitted with WR IF1 209 95 CW CBL Lead RJ 45 to 1 4 stereo jack for nomic keyboard CW or mic any model 15 95 A WR G313e External USB high performance HF receiver for WR G313e 1 099 95 DC CBL Spare DC lead 6 long for RIGblasters 8 95 A WR G313e 180 External USB high performance HF receiver for WR G313e with 180MHz option fitted 1 329 95 M CBL DB25M to DB9F serial cable 6 long 7 95 A WR G305i internal PCI card wide band receiver with standard demodulor 9KHz 1 8GHz 669 95 MX CBL DB9M to DBOF serial extension cable
84. Leatherette case for IC RX7 Cigarette lighter cable for IC RX7 Cloning cable radio to radio for IC RX7 Cloning cable for radio to PC RS 232C for IC RX7 Cloning cable for radio to PC USB cable for IC RX7 Antenna connector adaptor SMA plug to BNC socket for IC RX7 PC programming software for IC RX7 CI V level converter RS 232 computer interface for IC RX7 Spare flexible aerial for C RX7 Spare belt clip for C RX7 Handheld scanner 0 150 3304 999MHz Spare lithium battery charger for IC R20 Spare Ll ion battery pack 3 7V 1600mAh for IC R20 Cigarette lighter cable for C R20 Leatherette case for IC R20 Swivel belt clip for IC R20 Spare alligator style belt clip for IC R20 60 95 18 95 6 95 6 95 25 95 18 95 62 95 25 95 20 95 57 95 52 95 52 95 19 95 29 95 29 95 60 95 19 95 109 95 25 95 10 95 28 95 46 95 41 95 13 95 6 95 29 95 70 95 12 95 57 95 334 95 36 95 14 95 14 95 19 95 80 95 15 95 42 95 21 95 36 95 25 95 45 95 31 95 60 95 15 95 127 95 28 95 9 95 17 95 15 95 9 95 9 95 28 95 46 95 25 95 5 95 169 95 31 95 63 95 13 95 14 95 179 95 14 95 19 95 21 95 5 95 20 95 10 95 15 95 10 95 28 95 46 95 5 95 31 95 98 95 18 95 14 95 60 95 22 95 52 95 14 95 9 95 28 95 6 95 25 95 63 95 19 95
85. M87 Spare Desktop fast charger UK 3 pin for IC M87 Spare Desktop fast charger EU 2 pin for IC M87 Cigar lighter cable for IC M87 12V cigarette lighter lead for charging or 12V supply for IC M87 Dry cell case for IC M87 5 x AA cells Spare Li lon battery 7 2V 1700mAh for IC M87 Hard leather case for M87 Spare aerial for IC M87 Aerial VHF 150 162MHz for IC M87 Aerial VHF 160 174MHz for IC M87 Waterproof speaker microphone for C M87 ATEX APPROVED OPTION Waterproof speaker microphone for C M87 ATEX APPROVED OPTION Headset ear piece type needs OPC 1392 for IC M87 Headset neck arm type needs OPC 1392 for IC M87 Earphone with throat mic needs OPC 1392 for IC M87 VOXIPTT unit for IC M87 Swivel belt clip for IC M87 ATEX APPROVED OPTION Spare Alligator style belt clip for IC M87 ATEX APPROVED OPTION Bare ends DC lead for battery charging or 12 V supply for IC M87 Cloning cable for IC M87 serial Cloning cable for IC M87 USB Cloning software for IC M87 Service manual for IC M87 on CD Hand held marine amp PBR transcvr with Li lon pack amp charger ATEX VERSION Spare Li lon battery 7 2V 1700mAh for IC M87E ATEX APPROVED OPTION Spare aerial for IC M87 ATEX APPROVED OPTION Waterproof speaker microphone for C M87 ATEX APPROVED OPTION Swivel belt clip for IC M87 ATEX APPROVED OPTION Alligator style belt clip ATEX APPROVED OPTION Charger adaptor for BC 119N amp BC 121N Spare UK mains charger for use with BC 152
86. N socket 188 95 220344 70cm 430 440MHz 44 element PRO XL series N socket 309 95 220899 2m 70cm Oscar special 9 19 element 13 1 16 2dBi gain 2 x N sockets 3 70m long 143 95 220725 13cm 2280 2330 MHz 25 element N socket 18 3dBi gain 1 45m long 102 95 220745 13cm 2300 2420 MHz 25 element N socket 18 3dBi gain 1 45m long 102 95 220701 WiFi 2400 2500MHz low profile patch antenna 9dBi gain SMA connector 76 95 220702 WiFi 2400 2500MHz low profile patch antenna 12dBi gain SMA connector 87 95 220623 23cm 1296 MHz 23 element 17 9dBi gain N socket 1 75m long 77 95 220624 23cm ATV 1250 MHz 23 element 18 1dBi gain N socket 1 85m long 77 95 220635 23cm 1296 MHz 35 element 20 6dBi gain N socket 3 07m long 93 95 220636 23cm ATV 1240 1260MHz 35 element 20 4dBi gai socket 3 07m long 93 95 220650 23cm ATV 1240 1260MHz 55 element 21 8dBi gai socket 4 64m long 114 95 220655 23cm 1296 MHz 55 element 21 5dBi gain N socket 4 64m long 119 95 220614 23cm 1240 1300MHz low profile patch antenna 13 8dBi gain N socket 174 95 TONNA ACCESSORIES 231202 144 146 MHz 2 port power splitter with N cable connector set 540mm long 109 95 231402 144 146 MHz 4 port power splitter with N cable connector set 540mm long 127 95 231270 430 440 MHz 2 port power splitter with N cable connector set 196mm long 99 95 231470 430 440 MHz 4 port power splitter with N cable connector set 196mm long 112 95 231223 1250 1300 MHz 2 port powe
87. OH KHS 21 KHS 22 KHS 29F KHS 7 KHS 7A KHS 8BL KHS 9BL KMC 21 KMC 45 KCT 53U PG 22A PG 119DM2 K 2312E K 3312E RA 22M RA 22M2 RA 22M3 RA 23M RA 23M3 RA 26M RA 26M2 RA 26M3 RA 27M RA 27M3 KNB 29N KNB 45L KNB 53N KSC 35ST KSC 35SE BAAAAaAazazaAa BAAAAAAAAAzAAAAaaasyD BABABBAAAAAAAzAAAasy Programming software for TK 7180 8180 VHF 136 174MHz 12 5 20 25KHz 1 25W 512 CH needs microphone UHF 400 470MHz 12 5 20 25KHz 1 25W 512 CH needs microphone Hand microphone standard for TK 7189 8189 Hand microphone with DTMF keypad for TK 7189 8189 Hand microphone heavy duty for TK 7189 8189 Hand microphone with keypad heavy duty for TK 7189 8189 Control station desktop microphone for TK 7189 8189 Horn alert public address relay unit for TK 7189 8189 DC cable remote mount 7m for TK 7189 8189 Radio interface cable for KDS 100 KGP 2A 2B for TK 7189 8189 ignition sense cable for TK 7189 8189 DIN size vehicle mount for TK 7189 8189 External speaker for TK 7189 8189 External speaker needs KAP 2 for TK 7189 8189 AVL software for TK 7189 8189 Line noise filter for TK 7189 8189 Key lock adaptor for TK 7189 8189 DC power supply for TK 7189 8189 Control head remote kit 7m for TK 7189 8189 Voice guide amp storage unit for TK 7189 8189 Serial to USB adaptor with drivers for TK 7189 8189 PC programming interface cable for TK 7189 8189 Programming software for TK 7189 8189 ENWOOD HANDHELD PMR TRANSCEIVERS
88. ORION 11 566AT ATS66K 2000 2001 2002 2003 2006 R6217 R6218 46176 86095 307B 4228 940 941 707 716 302R EAGLE 599 EAGLE 599AT 320 98619 ATS99K 2000 2001 2002 2003 2005 321 307B 707 716 712 940 941 ARGONAUT VI 539 2003 702 418 712 Transceiver CW QRP 40 20m 5W 12V Open Source HF transceiver DSP 100W 12vdc twin receiver HF transceiver DSP 100W 12vdc twin receiver internal ATU Optional internal ATU module for Orion Il Optional 1 8KHz filter for Orion I Optional 600Hz filter for Orion Il Optional 300Hz filter for Orion ll Optional 6KHz AM filter for Orion lI Optional 700Hz filter for Orion ll Optional 250Hz filter for Orion I earlier model Optional 1 8KHz filter for Orion earlier model Optional audio lead for Orion Il Replacement 12V DC lead 2 pin for Orion I amp II External speaker black 4 Ohms 5 Watts for Orion II Centurion 1 3KW amplifier for 100W in 2 x 3 500Z 160 10m for Orion II Power supply with speaker for Orion Il Switch mode power supply 115 230VAC in 13 8VDC out 25 Amps for Orion ll Regal desk microphone with 707 T8 lead included Ten Tec 8 pin 716 stand not included for Orion Il Desk stand for 707 microphone Remote keypad encoder for Orion II Compact HF amp 6m transceiver DSP 100W 12vde Compact HF amp 6m transceiver DSP 100W 12vde with 160 10m ATU free 320 n blanker 2005 filter Optional noise blanker for Eagle 599 Replacement 4 pin 12V DC lead for
89. PC interface cable for TKR 751 781 Serial to USB adapter with drivers for TK 751 781 Programming disc for TKR 751 781 339 95 339 95 339 95 38 95 319 95 16 95 39 95 39 95 49 95 28 95 33 95 18 95 17 95 26 95 87 95 129 95 70 95 234 95 33 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 14 95 61 95 49 95 33 95 309 95 309 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 47 95 59 95 18 95 38 95 319 95 16 95 219 95 11 95 14 95 17 95 9 95 24 96 26 95 87 95 129 95 70 95 234 95 33 95 86 95 49 95 61 95 33 95 249 95 509 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 129 95 119 95 38 95 47 95 319 95 16 95 129 95 14 95 29 95 129 95 49 95 39 95 61 95 1 099 95 1 099 95 62 95 30 95 61 95 61 95 33 95 1 099 95 1 099 95 1 099 95 30 95 62 95 61 95 61 95 33 95 OOO T K T T TO TOOT T T T T T T T T TC HOD T T T T T T T T T T T T T T T T T OHO T OOO TOO CC CCC EEE CT O r or p r P H C3 OOO KOTE OTTO HEADSETS FOR KENWOOD HAND HELD TRANSCEIVERS OTTOBREEZE TK Breeze headset with boom mic for TK series large PTT 53 95 OTTOBREEZE MOT Breeze headset with boom mic for GP 300 large PTT 75 95 KENWOOD PMR 446 TRANS
90. PPPRP aan rrrrrrrrrrrrrrorrrrrrrrannaneoa rrrrrrorrrrrrr gt yS rrrrrrrrr y rrrrrrrrrrroa rrrrrrrrr gt r WEP 501Y4 Earpiece with attached but fully adjustable boom mic for Yaesu single plug 4 pole 12 95 A CT DS01 insulated terminal die set 10 95 WEP 501K Earpiece with attached but fully adjustable boom mic for Kenwood 2 pin 12 95 A CT DS02 Non insulated open barrel terminal die set 10 95 WEP 501M Earpiece with attached but fully adjustable boom mic for Motorola 2 pin 12 95 A CT DS03 Non insulated terminal die set 10 95 WCT 421Y Rugged lapel talker beige colour Alinco lcom Yaesu 2pin type 19 95 A CT DS04 RG 58 RG 59 62 BNC TNC coax connector die set 13 95 WCT 421Y4 Rugged lapel talker beige colour Yaesu single pin four pole 19 95 A CT DS05 RG 59 RG 6 F type CATV connector die set 13 95 WCT 421Y4S Rugged lapel talker beige colour Yaesu single pin four pole screwed 19 95 A CT DS06 RJ 45 8p modular plug die set 13 95 WCT 421K Rugged lapel talker beige colour Kenwood 2 pin 19 95 A CT DSPKG1 Crimp tool die set package 49 95 WCT 421M Rugged lapel talker beige colour Motorola 2 pin 19 95 A CTIDSPP Replacement die set for PWRerimp tool 17 95 WCT 321Y Lapel microphone with over the ear earpiece for Alinco lcom Y
91. PRO single headset Trim ring replacement for Ten Tec knobs Black Trim ring replacement for Ten Tec knobs Michigan dark blue Trim ring replacement for Ten Tec knobs Charcoal grey Trim ring replacement for Ten Tec knobs North Carolina light blue Trim ring replacement for Ten Tec knobs Tennessee orange Trim ring replacement for Ten Tec knobs Red 238B knob 4 pin microphone connector 8 pin microphone connector 40 and 20 meter QRP transceiver 40 and 30 meter QRP transceiver HB1B four band QRP transceiver FG 01 antenna analyser Rechargeable lithium battery for FG 01 or HB1B Ten Tec logo coffee mug white with two colour Ten Tec logo Ten Tec baseball cap grey with embroidered Ten Tec logo Ten Tec baseball polo shirt light grey with embroidered Ten Tec logo size medium Ten Tec baseball polo shirt light grey with embroidered Ten Tec logo size large Ten Tec baseball polo shirt light grey with embroidered Ten Tec logo size extra large Ten Tec baseball polo shirt light grey with embroidered Ten Tec logo size extra extra large PC radio computer controlled HF receiver with DRM I F output Ultimate 50KHz 30MHz SWL receiver Adds both USB and ethernet control to RX 340 Spare operating manual for Ten Tec RX 340 HR SDR receiver 100KHz 54MHz HF rack mount black box receiver Adds both USB and ethernet control to RX 331 VHF UHF black box receiver Broadband RF pre amplifier ki transmatch tuning bridge kit for
92. PTT and acoustic tube earpiece for Yaesu single plug 4 pole screwed AC BUD Spare beige coloured soft silicone part for earpiece of WAP 700 WEP 601Y Rugged earpiece amp adjustable boom microphone for Icom Yaesu Alinco 2 pin type WEP 601K Rugged earpiece amp adjustable boom microphone for Kenwood 2 pin type WEP 601Y4 Rugged earpiece amp fully adjustable boom microphone for Yaesu single plug 4 pole 2 1 1 1 1 E k i 3 hm mm m m 22 95 24 95 7 95 6 95 6 95 6 95 12 95 79 95 99 95 49 95 44 95 49 95 31 95 10 95 9 95 9 95 9 95 12 95 20 95 20 95 79 95 79 95 99 95 49 95 59 95 59 95 59 95 59 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 19 95 19 95 19 95 19 95 2 95 2 95 0 95 0 95 9 95 14 95 29 95 9 95 1 95 1 95 1 95 10 95 10 95 0 50 9 95 9 95 4 95 4 95 5 95 19 95 3 95 0 95 0 95 6 95 5 95 7 95 32 95 23 95 23 95 23 95 23 95 23 95 23 95 23 95 23 95 23 95 23 95 23 95 0 95 6 95 6 95 6 95 6 95 2 95 39 95 2 95 20 95 6 95 9 95 24 95 9 95 9 95 9 95 9 95 1 95 9 95 9 95 9 95 o gt T e a T a TOC
93. Programming interface USB KPG 67D Programming software KPG 90D PC programming software for TK 3201 KPG 87DM2 Programming software for TK 2202 3202 KRA 27 UHF helical aerial 440 490MHz SMA KSC 15T Standard rate desk top charger for Ni Cd batteries KSC 17 Charger for KNB 5 6 7 11 12 amp PB 6 7 8 KSC 21RE Rapid rate conditioner charger for Ni Cd batteries MB 201 Detachable mobile mount for TM G707 MJ 64 Microphone plug adaptor 6 pin plug to 4 pin socket PB 37 Nicad pack 12V 950 mAh for TH 235E high power PG 4M ATU extension control cable for TS 50S 6m long PG 4X Extended front panel kit for TM D700 RC V7 Spare control head of TM V7 790 0472 05 Spare rubber duck aerial for TH 22 T90 0634 05 Spare rubber duck aerial for TH G71 amp TH D7 KLINGENFUSS PUBLICATIONS K DDDS Digital Data Decoder Screenshots K EISS Encyclopedia of Inelligence and Secret Services In French language only K GTUS 09 10 Guide To Utility Stations 2009 10 25th Edition K MTCD 1 Modulation Type Double Compact Disc Set 1 K MTCD 2 Modulation Type Double Compact Disc Set 2 K RTLM Radiotelex Messages 1974 1998 1st Edition K SFG 09 Shortwave Frequency Guide 2009 13th Edition LA CROSSE TECHNOLOGY WEATHER STATION EA 3000 Handheld anemometer measures wind speed LCD back light EA 3010 Handheld anemometer LCD back light Beaufort wind scale amp temperature LAKE ELECTRONICS XTAL MW Medium wave 700 1500KHz crystal set kit XTAL SW Short wave receiver 6 18 MHz crystal set
94. SMA socket to SMA socket adaptor black in colour Common mode filter 1 54MHz 2kW SSB attenuation 50dB max RF choke line isolator Common mode filter 1 54MHz SkW SSB attenuation 50dB max RF choke line isolator Portable telescopic mast 1 45m to 3 85m 1 2kg 28mm top 36mm bottom with carry case 3 way coax switch SO 239 sockets 3 way coax switch 0 1500MHz N type sockets 2 way coax switch SO 239 sockets 2 way coax switch N type sockets 1 1 50 Ohm balun 1 7 40MHz 1 2KW PEP 1 1 50 Ohm balun 3 75MHz 500W PEP SO 239 30 Amp power supply V A meter 25 Amp switch mode power supply 40 Amp switch mode power supply 60 Amp switch mode power supply 3 5 150MHz X needle SWR POWER meter 144 470MHz X needle SWR POWER meter 1 8 54MHz amp 144 470MHz X needle 30W 300W 3KW HF only SWR POWER meter 1 6 60 MHz 30W 300W 3KW PL 259 1 8 200 MHz 5 20 200 Watts PL 259 140 525 MHz 5 20 200 Watts PL 259 140 525 MHz 5 20 200 Watts N 1 8 525 MHz 5 20 200 Watts PL 259 1 8 160 430 450 800 930 1240 1300 MHz 5 20 200 Watts PL 259 N Lightning surge arrestor DC 1000MHz 400W PEP 2 x SO 239 Lightning surge arrestor DC 3000MHz 200W PEP 2 x N sockets Lightning surge arrestor DC 3000MHz 400W PEP N type plug to N type socket Lightning surge arrestor DC 1000MHz 400W PEP PL 259 to SO 239 Lightning surge arrestor DC 3000MHz 200W PEP 2 x N sockets Replacement fuse for CA 23RS RW 200W type lightning surge protectors Replacement fuse for C
95. SP 35L SM 50 SM 30 IC PW1EURO HM 36 HM 103 HM 151 HM 152T HM 154T HM 198 AH SNV RC 28 MB 62 MBF 1 MBA 1 CS 7100 CT 17 OPC 2253 OPC 2254 OPC 2321 OPC 589 OPC 599 OPC 1529R OPC 2218LU WDC HF4 C 28 AH 2B AH 4 180 B 62 B 105 B 106 MK 7000 PC 1443 PC 1444 PC 1457 PC 1457 002 DC EMC PC 589 PC 599 M 20 P 10 HM 151 HM 154T CT 17 SM 7000 AH 710 IC 7200 AH 2B AH 4 AH 710 AT 180 HM 36 SM 20 OPC 599 SP 10 SP 20 SP 21 CT 17 MB 116 MB 117 MB 118 SM 7200 IC 718 AH 2B AH 4 AH 710 AT 180 FL 52A E E G C 0 E EL NN R ACESSORIES FOR IC 7000 Mains power switch mode power supply 25 Amps for IC 9100 DC lead for IC 9100 with EMC filter Carrying handle for IC 9100 Solid state HF 6m linear amplifier 1KW for IC 9100 HF amp 50MHz 200W DSP transceiver auto ATU LCD USB Keyboard for C 7700 Not an Icom product made by Kensington Spare hand microphone with up down buttons for IC 7700 Desktop microphone for IC 7700 Dynamic desktop microphone for IC 7700 Base station speaker large with audio filters for IC 7700 RS 232 computer interface for IC 7700 HF amp 50MHz dual DSP transceiver Antenna whip amp mount for IC 7600 Automatic antenna tuner HF plus 6m for IC 7600 Spare hand microphone with up down buttons for IC 7600 Desktop microphone for IC 7600 Dynamic desktop microphone for IC 7600 Base station speaker small for C 7600 Base station speaker small for C 7600 4 audio filters he
96. T T OD T T OD T T T T T TO T T T OHO T TO T T T T T T T T T T T T T T T T T T T T T T T T T C3 T T T T T T T T T T T T T T HS 10SB HS 10SA HS 15SB IF 3 LC 118 LC 119 LC 122 LC 125 LC 126 LC 136 LC 147 LC 163 LONESOFT MIEUROV CD MB 68 MB 63 MB 72 MB 74 MIC 003 OPC 552 OPC 596 OPC 597 OPC 600R OPC 646 OPC 718 OPC 104 OPC 782 OPC 853 OPC 947 OPC 979 OPC 1174 OPC 1147 OPC 1229 OPC 1248 001 RADIOCOM 4001 RSSI 001 RS 91 SAVOXNC SM 2725 SM E7 SM R5 SM E91 SM E208 SM 703 SM 7400 SM 756PROIII SM 706MKIIGDSP SM 910 SM T3 SP 5 SM F31GS TOOL 013 UT 79 UT 96 UT 109 01 ZONESOFT INNOVANTENNAS RUBBASEAL CONDUCTASEAL 10MHz 10 LFA 3 10 LFA 4 14MHz 14 DES 3 14 DES 4 14 DES 5 14 OWA 4 HD 14 DES 5 L 14 OWA 5 HD 14 DES 6 14 DES 6 L 14 OWA 6 HD 18MHz 18 LFA 3 18 DES 4 18 LFA 5 18 LFA 6 24MHz 21 DES 3 21 DES 4 21 DES 5 21 DES 5 L 21 DES 6 21 DES 7 24MHz 24 LFA 3 24 LFA 4 HD 24 LFA 4 24 LFA 5 24 LFA 6 24 DES 7 27MHz 2 DES 27 2 LFA 27 3 DES 27 3 LFA 27 5 DES 27 4 LFA 27 5 LFA 27 6 DES 27 7 DES 27 28MHz 28 LFA 2 28 LFA2 2 28 DES 3 28 LFA2 3 28 LFA 4 28 DES 5 28 OWA 5 Switch unit for use with HS 10 headset Vox PIT Lea Lea Lea Soft Soft Lea Lea Soft control unit for use with HS 10 headset switch box for mobiles needs OPC 589 for IC 2100 Enhanced man down uni herette case for IC 2GXE with BP 130A 157A 160 herette case for IC 2G
97. VX 821 824 829 Leather case with swivel belt clip for VX 821 824 829 Leather case with swivel belt clip and key cut out for VX 821 824 829 Radio to radio cloning cable for VX 821 824 829 RS 232 DB9 programming cable kit USB interface adaptor for use with CT 29 amp CT 115 for VX 821 824 829 CT 108 Programming cable connects to FIF 10A for VX 821 824 829 Programming software for VX 821 824 829 Antenna connector adaptor SMA BI Handheld 512ch low band VHF 66 NC for VX 821 824 829 88MHz limited keypad Helicoil aerial 66 71MHz 15cm RED insulator for VX 924 Helicoil aerial 70 76MHz 15cm BROWN insulator for VX 924 Helicoil aerial 75 81MHz 15cm BLACK insulator for VX 924 Helicoil aerial 81 88MHz 15cm WH ITE insulator for VX 924 Lithium lon battery 7 4V 1150mAh for VX 924 Lithium lon battery 7 4V 2000mAh for VX 924 Lithium lon battery 7 4V 3000mAh for VX 924 Desktop rapid charger for FNB V86 V87 V92 230C 2 pin Euro plug Desktop rapid charger for FNB V86 V87 V92 230C 3 pin UK plug Mul Mul Vehi Speaker microphone noise cancelli unit charger for FNB V86 V87 unit charger for FNB V86 V87 N92 230C 2 pin Euro plug N92 230C 3 pin UK plug icle charger mounting adaptor for VAC 300 ing for VX 924 Speaker microphone submersable for VX 924 Speaker microphone submersable Digital voice storage for VX 924 with PF key toggle for VX 924 Rolling code encryption unit for VX 924 Inversion encryption unit f
98. VX 8GE 7 95 CT 144 Clone cable for VX 8GE 12 95 CT 143 Serial PC cable for VX 8GE 31 95 SDD 13 Cigar lighter DC cable for VX G8E 24 95 E DC 6 External DC cable for VX 8GE 5 95 NC 86U Spare charger and battery charger for CD 41 for VX 8GE UK 3 pin old style 12 95 NC 86C Spare charger and battery charger for CD 41 for VX 8GE EURO 2 pin old style 12 95 PA 44U Spare charger and battery charger for CD 41 for VX 8GE 3 pin UK new style 11 95 PA 44C Spare charger and battery charger for CD 41 for VX 8GE 2 pin Euro new style 11 95 VC 25 VOX headset for VX 8GE 50 95 YHA 72 Spare aerial for VX 8GE 15 95 RA1053600 Spare belt clip for VX 8E 3 95 VX 8DE 6m 2m 70cm handheld transceiver Bluetooth GPS APRSSW Listed 429 95 249 95 BH 1A Bluetooth mono headset earphone jack for VX 8DE needs BU 2 134 95 BH 2A Bluetooth stereo headset for VX 8DE needs BU 2 129 95 BU 2 Bluetooth adaptor unit for VX 8DE 78 95 CD 40 Charge cradle 3 hours for BH 1A BH 2 and VX 8DE needs PA 46 9 95 CD 41 Rapid charger cradle 2 5 hours for VX 8DE needs PA 44 16 95 CN 3 Antenna connector adaptor SMA BNC for VX 8DE 8 95 CSC 93 Soft case for VX 8DE 12 95 CT 131 Microphone adaptor for VX 8DE 25 95 CT 134 Cloning cable for VX 8DE 29 95 CT 136 GPS antenna adaptor for FGPS 2 for VX 8DE 32 95 SDD 13 Cigar lighter DC cable for VX 8DE 24 95 E DC 6 External DC cable for VX 8DE 5 95 FBA 39 Dry cell case 3 x AA not supplied for VX 8DE
99. W2 KM Lead for W2 EDGE and Kenwood modular mobile rigs W2 Y8MP Lead for W2 EDGE and Yaesu 8 pin round for FT 950 920 990 1000MP Field W2 Y8 Lead for W2 EDGE and Yaesu 8 pin round for FT 1000 847 W2 YML Lead for W2 EDGE and Yaesu 8 pin modular for FT 817 900 W2 YMS Lead for W2 EDGE and Yaesu 6 pin modular for FT 100 etc W2 EQEQ Lead for W2 EDGE to EQPLUS 5 pin din plug to 5 pin din plug W2 YLA Short adaptor cable fitted with 8 pin mic socket amp large Yaesu modular socket W2 YSA Short adaptor cable fitted with 8 pin mic socket amp small Yaesu modular socket W2 PTT Locking PTT switch for W2IHY audio gear and most radios W3FF ANTENNAS W3 BP Buddipole portable antenna kit 40 2m 250W with balun amp 25 coax cable W3 BP DELUXE Kit tripod portable mast rotating arm kit carry bag extra whip amp coil clips 25 coax 40 2m W3 BP LONG DLX Kittripod portable mast rotating arm kit carry long bag extra long whip 18 amp coil clips 50 coax 40 4m W3 TRSB riple ratio balun A 1 1 2 1 and 4 1 balun all in the same box 1 8 30MHz 100W W3 BPT tipod for Buddipole needs W3 BM W3 WIRE ASS Wire assembly 32 of insulated wire W3 BM elescopic mast for Buddipole 22 closed 8 open needs W3 CTA W3 BML elescopic Mast long for Buddipole 37 closed 16 open W3 VERSATEE Replacement centre piece for Buddipole W3 CTA Center tee adaptor between a pole and Buddipole W3 STW Spare Buddipole stainless steel telescopic whip 66 open 13 collapsed 3 8th W3
100. X11 10 95 A EDC 36 Cigarette lighter cable with filter for DJ G7 19 95 ERW 8 Mini USB USB ports PC interface cable full functions for DJ X11 39 95 C EDC 43 12V DC cable with filter for DJ G7 8 95 ESC 50 Soft carry case for DJ X11 23 95 A EDC 173 Spare battery charger for DJ G7 29 95 ERW 7 USB port PC interface cable can be used for clone utility only for DJ X11 39 95 C EDH 35 Dry cell case for DJ G7 takes 4 x AA cells 19 95 EA 154 Spare aerial for DJ X11 9 95 A EDS 10 Speaker microphone cable adaptor 2 pin to 1 pin 8 95 EBC 23 Spare belt clip for DJ G7 5 95 A EDS 14 Speaker microphone cable adaptor 2 pin to 1 pin 9 95 DJ X30 Handheld scanner AM NFM WFM 0 1 1299 995MHz 189 95 C EDS 11 Clone cable for DJ G7 8 95 EBP 57N Ni MH rechargeable cell pack 1 2V 1800mAh x 2 pieces 12 95 A EME 32A Earhone microphone for DJ G7 54 95 EDC 154EUK Trickle drop in charger 29 95 C EMS 62 Speaker microphone for DJ G7 29 95 EDH 33 DC DC converter with cigar lighter plug 12vdc 24vdc to 6vde for DJ X30 14 95 A ERW 4C Programing cable for DJ G7 39 95 EME 26 Curly cord earphones for DJ X30 10 95 A ERW 7 PC interface cable USB needs EDS 10 for DJ G7 39 95 ESC 44 Leatherette case for DJ X30 1795 A ESC 50 Soft carry case for DJ G7 23 95 ERW 4C Programing cable 39 95 C DJ V17E 2m FM handy transceiver with keypad Ni MH battery and charger Listed 149 95 139 95 ERW 7 Eprom writer for DJ X30 USB 39 95 C EBP 63 Li ON battery pack DC 7 4
101. and play jumper mod Plug and play jumper mot Plug and play jumper mot SLMODHT Plug and play Sound Card Radio In Sound Card Radio In Sound Card Radio In Sound Card Radio In Sound Card Radio In Sound Card Radio Interface C Sound Card Radio In Sound Card Radio In Sound Card Radio In Sound Card Radio In Sound Card Radio In Rado Interface CD ROM wih cable Yaesu Handhelds inducing the FT 60R and VX 8GR Rado Interface CD ROM wih cable for Baofeng Wouxun and Kenwood Handhelds terface C terface C terface C terface C terface C ROM with 4 pin round mic cable ROM with 8 pin round mic cable ROM with RJ 11 mic cable ROM with RJ 45 mic cable ROM with 5 pin din cable ROM with 8 pin din cable ROM with 6 pin mini din ROM with 13 pin din for Icom erface CD ROM with 13 pin din for Kenwood terface CD ROM for Elecraft K3 terface CD ROM for Elecraft KX3 terface C terface C Cee eS SO 22S Sound Card Radio Interface CD ROM with unterminated radio cable le for Signal le for Signal le for Signal le for Signal le for Signal le for Signal le for Signal le for Signal le for Signal le for Signal le for Signal le for Signal ule Link 4 pin round plug Link 8 pin round plug Link RJ 11 plug Link RJ 45 plug Link 5 pin din plug Link 8 pin din plug Link 6 pin mini din plug Link for 13 pin din Icom Link for 13 pin din Kenwood Link for Elecraft K3 Link for Elecraft KX3 Link 1 x bare
102. based option for 1000 and 3000 series receivers 92 95 TOUCH KEY CW TOUCHkeyer 112 95 C WR ADS FULL INT Advanced digital suite advanced DSP processing option for all Win Radio receivers full int version 184 95 CWSWITCH Cw switch for stand alone operation 56 95 C WR ADS UPGRADE Upgrade from WR DS to WR ADS FULL I international version for all Win Radio receivers 92 95 CBA III Computerised battery analyser tester 150 Watts 40 Amps 135 95 C WR ATO G305 Advanced trunking option software for G305 receivers 134 95 CBA 3P PRO Computerised battery analyser 179 95 C WR VSC V Virtual sound card software option for G3 receivers digital bridge for Windows 2000 XP Vista 32 64 bit 49 95 CBA 3P UP PRO and extended software package upgrade 314 95 C WR UNIFSK Universal FSK software decoder option for all Win Radio Receivers uses DSP if not needs soundcard 484 95 CBA AMP 240 CBA II amplifier to extend range of CBA II up to 500 Watts 160 Amps 110 240V AC 639 95 C WR CSO G313 Win Radio G313 series client server software option for the G3 receiver series for PC network control 216 95 CBA AMP HAR Dual amp 1000w harness connects two CBA amplifiers to one CBA amplifier 142 95 C WR FSL GPSU Field strength logger software and hardware option for 3xxx and G313 G315 series includes GPS USB 1 279 95 CBA TEMP CBA II magnetic temperature probe optional accessory 10 95 A WR FSL 3000 GPSS__ Field strength logger software and hardware option for 3xxxa nd G313 G31
103. charger including 6 x AD 106 adaptors and BC 124 UK mains PSU for BC 119N fast charger Spare AC adaptor for BC 121 Spare Desktop rapid charger Spare Li ion battery pack 7 4V 1150mAh High capacity Li ion battery pack 7 4V 2000mAh VHF antenna for 136 150MHz UHF antenna for 400 430MHz VHF antenna for 150 174MHz UHF antenna for 430 470MHz UHF antenna for 470 520MHz Stubby VHF antenna 160 174MHz Stubby UHF antenna for 450 490MHz Mini hand held speaker microphone Earphone Microphone GS style speaker microphone Earphone microphone screw type connector Heavy duty hand held microphone Splash proof full sized speaker microphone durable Earphone microphone Headset ear piece type needs VS 1L Headset neck arm type needs VS 1L Earphone with throat mic needs VS 1L Swivel belt clip Alligator type belt clip Swivel belt hanger for use with MB 93 Fixed type leather non swing belt hanger for use with N batteries Alligator type belt clip for use with N batteries Cloning cable PC to transceiver Cloning cable for radio to PC USB cable DC cable 12 20V for BC 121N Scrambler unit inversion Scrambler unit inversion and rolling for IC F34 44 Man down unit not 5 tone Man down unit Earpiece VOXIPTT unit Programming software for IC F34 44 Service manual on CD for IC F34 44 Waterproof 136 174MHz c w battery charger aerial belt clip inversion scrambler Waterproof 400 470MHz c w batt charger aerial belt clip inversion scram
104. charger mounting adaptor for VAC 10 Vehicle charger mounting adaptor for VAC 810 Earpiece with in line microphone for VX 160 180 Speaker microphone noise cancelling for VX 160 180 Speaker microphone small type for VX 160 180 Speaker microphone miniature type for VX 160 180 VOX headset for VX 160 180 Leather case and belt loop for VX 160 Leather case and swivel belt loop for VX 160 Leather case and belt loop for VX 180 Leather case and swivel belt loop for VX 180 Radio to radio cloning cable for VX 160 180 Programming kit RS232 for VX 160 180 USB interface adaptor for use with CT 106 Programming cable interface for VX 160 180 connects to FIF 10A Programming software for VX 160 180 Antenna connector adaptor SMA BNC for VX 160 180 Dry cell case for VX 160 180 6 x AA cells Handheld 16ch VHF 136 174MHz 5W no display Handheld 16ch UHF 440 470MHz 5W no display Handheld 16ch VHF 134 174MHz 5W limited keypad Handheld 16ch UHF 440 470MHz 5W limited keypad 134 151MHz helicoil 15cm RED for VX 351EV 354EV 150 163MHz helicoil 15cm BROWN for VX 351EV 354EV 161 174MHz helicoil 15cm BLACK for VX 351EV 354V 400 430MHz whip 16cm BROWN for VX 351EU 354EU 420 450MHz whip 16cm YELLOW for VX 351EU 354EU 450 485MHz stubby 8cm RED for VX 351EU 354EU 440 470MHz whip 16cm BLUE for VX 351EU 354EU 450 490MHz whip 16cm for VX 351EU 354EU Lithium lon battery 7 4V 1800mAh for VX 351 354 Lithium lon battery 7 4V 2000mAh for VX 351 354 Desktop rapid ch
105. chassis socket 7 pin microphone chassis socket 6 pin microphone chassis socket 5 pin microphone chassis socket 4 pin microphone chassis socket 3 pin microphone chassis socket 2 pin microphone chassis socket 4 pin RJ 11 plug 6 pin RJ 12 plug 8 pin RJ 45 plug Adaptor has two sockets to join 2 x RJ 45 plugs straight through Adaptor has two sockets to join 2 x RJ 11 plugs straight through Red in line phono plug Black in line phono plug Red in line phono socket Black in line phono sockel 3 5mm 4 pole in line jack plug 1 4 in line stereo jack plug 3 5mm in line stereo jack plug Jack plug 3 5mm stereo right angled 2 5mm in line stereo jack plug 1 4 in line mono jack plug 3 5mm in line mono jack plug 2 5mm in line mono jack plug 1 4 in line stereo jack socket 3 5mm in line stereo jack socket 2 5mm in line stereo jack socket 1 4 in line mono jack socket 3 5mm in line mono jack socket 2 5mm in line mono jack socket In line cigar lighter plug spring loaded contacts rubber cable protector fused 5A In line cigar lighter plug spring loaded contacts rubber cable protector LED fused 3A In line cigar lighter socke Speaker plug 2 pin in line Speaker socket 2 pin in line Gold plated stackable banana plug RED Gold plated stackable banana plug BLACK 1 1mm DC battery cut out plug 1 3mm DC battery cut out plug 2 1mm small barrel DC battery cut out plug 2 1mm long barrel DC battery cut out plug 2 5mm small barrel DC battery c
106. diameter aluminium pole for Cushcraft 10 X 1 5 straight aluminium pole 10 X 2 straight aluminium pole 12 X 2 straight aluminium pole Galvanised 6 wall stand off bracket for up to mast Galvanised 9 wall stand off bracket for up to 1 mast Galvanized 12 wall stand off T amp K brackets up to 2 mast Galvanized 18 wall stand off T amp K brackets up to 2 mast Galvanized 24 wall stand off T amp K brackets up to 2 mast Galvanized 36 wall stand off T amp K brackets up to 2 mast Clamp heavy duty for mounting 2 3 8th thread mobile aerial to make a dipole SO 239 feed Clamp heavy duty for base mounting a mobile aerial with PL base SO 239 feed point Clamp heavy duty for base mounting a mobile aerial with 3 8th base SO 239 feed point Clamp 1 amp 1 4 boom to 1 2 mast Clamp 1 boom to 1 2 mast Clamp 1 boom to 1 2 mast Clamp 1 1 25 boom to 1 2 mast Clamp heavy duty 1 25 boom to 1 2 mast Clamp cross over plate 2 X 2 Clamp for guy wire 3 way hook type non rotating Clamp for guy wire 4 way hook type non rotating Mastbase plate for 2 diameter mast Mast base plate 6 x 6 square with 8 centre stub amp fixing screws for 2 or less mast Mast base plate for 2 mast held in place by vehicle wheel drive on 15 jointing sleeve for 2 masts only 15 jointing sleeve for 1 5 masts only Double chimney lashing kit Pulley for rope mast fixing U bolt 37mm 1 5inches to clamp mast up to 30mm 1 25 inches U bolt 62mm
107. e E D E 5 e I I e a e e ee E ee E T ee bai E T J P H E T I I H Er J r I T I I P e T J P J h O G GD 9 CG COO C9 GEE OOO RG 213 RG 213 50 G 213 RG 174 G 174 RG 316 G 316 R MINI RG8 R MINI RG8 50 NI RG8 R W103 W 103 DR TW75 TW 75 DRG 59U RG 59U DR 300 DoOWOWSIS ozo B 1 5 B 2 5 fos a RB 10 i 3 RB 15 kd a RB 25 RB 40 A Ss R 3 CORE CORE R 7 CORE CORE R 8 CORE CORE R GYGY gegggzgegggggggggggaggg Q GA 2 8 R FW 18 R EW EW 50 W R FW PVC 18 W PVC 18 R AMCM AMCM T292 cy CABLE SECURITY P WRAPS 5 P WRAPS 5S P WRAPS 10 P WRAPS 10S TW 100 2 5BK TW 160 2 5BK TW 200 3 6BK TW 160 4 8BK TW 300 4 8BK TW 370 7 8BK TW 100 2 5NT TW 160 2 5NT TW 200 3 6NT TW 160 4 8NT TW 300 4 8NT TW 370 7 8NT CAPACITORS DNC 100 100m drum of RG 50m drum of RG 2 213 50 Ohm low loss coaxial cable 13 50 Ohm low loss coaxial cable 50 Ohm low loss coaxial per metre 100m drum of RG 174AU military spec very thin 50 Ohm coaxial cable RG 174AU military spec very thin 50 Ohm coaxial cable per meter 100m drum of RG 316AU military spec very thin 50 Ohm coaxial cable RG 316AU military spec very thin 50 Ohm coaxial cable per meter 100m drum of Mini RGB 50 Ohm coaxial cable 50m drum of Mini RG8 50 Ohm coaxial cable Mini RG8 50 Ohm coaxial cable per metre 100m drum of Westflex 103 50 Ohm low loss airspaced coax Westflex 103 50 0
108. for Argonaut HF amp 6m transceiver DSP 100W 12vdc LAN fan fitted HF amp 6m transceiver DSP 100W 12vdc LAN fan fitted internal ATU Optional internal ATU module for Omni VII 588 Optional 500Hz Collins mechanical filter for Omni VII Optional 300Hz Collins mechanical filter for Omni VII Remote keypad encoder for Omni VII External speaker black 4 Ohms 5 Watts for Omni VII USB to serial port converter for Omni VII Centurion 1 3KW amplifier for 100W in 2 x 3 500Z 160 10m for Omni VII Regal desk microphone with 707 T8 lead included Ten Tec 8 pin 716 stand not included for OMNI VII Desk stand for 707 microphone Walnut desk stand for 707 microphone Replacement 4 pin 12V DC lead for Omni VII USB soundcard digital mode adaptor cable for Omni VIl Power supply with speaker for Omni VII RF speech processor price includes one output cable of your choice for Omni VII 19 opening rack mount hardware for Omni VII Optional internal ATU module for Jupiter Rear heat sink fan for Jupiter Remote keypad encoder for Jupiter Hand microphone 4 pin for Jupiter Spare operating manual for Jupiter Replacement 12V DC lead 2 pin for Jupiter Aluminium enclosure 5 370 wide x 2 059 high x 4 144 deep Amplifier for HF amp 6m 5W in 100W out HF manual ATU 2KW low loss L network 1 8 30MHz Acro Bat unbreakable UV resistant antenna hanger Acro Bat unbreakable UV resistant antenna hanger pack of 4 Vector Network Analyser VNA by TAPR special order Plug
109. for GX 1500 Mounting bracket knob for GX 1500 Sun cover for GX 1100 Programming software for GX 1500 Programming cable side to side for GX 1500 Programming cable PC side for GX 1500 VHF DSC fixed marine transceiver Black Flush mount bracket for GX 1100 External speaker for GX 1100 10W external amplified speaker for GX 1100 DC cable for GX 1100 Mounting bracket for GX 1100 Mounting bracket knob for GX 1100 Programming software for GX 1100 Programming cable for GX 1100 Spare Flush mount bracket for GX 3000 RAM plus microphone for GX 3000 Black RAM plus microphone for GX 3000 White Rubber cover for CMP30B and VH 310 socket for GX 3000 Microphone clip hanger for CMP30B for GX 3000 Original cable with socket for CMP30B and VH 310 for GX 3000 23 foot RAM plus extension cable for GX 3000 3 loud hailer horn for GX 3000 5 x 8 rectangular loud hailer horn for GX 3000 External speaker for GX 3000 Loud hailer extension intercom speaker with call button for GX 3000 10W external amplified speaker for GX 3000 DC cable for GX 3000 Mounting bracket for GX 3000 Mounting bracket knob for GX 3000 Sun cover for GX 3000 Programming software for GX 3000 Programming cable side to side for GX 3000 Programming cable PC side for GX 3000 Stand alone loud hailer fog horn Flush mount bracket for VLH 3000 3 loud hailer horn for VLH 3000 5 x 8 rectangular loud hailer horn for VLH 3000 External speaker for VLH 3000 Loud hailer extens
110. for IC F5012 6012 Scrambler unit inversion non rolling type voice scrambler 40 pin for IC F5012 6012 Scrambler unit inversion and rolling 40 pin type for C F5012 6012 PMR VHF 128 CH amp screen 136 174MHz microphone mobile mount amp DC lead PMR UHF 128 CH amp screen 400 470MHz microphone mobile mount amp DC lead Standard mobile microphone Mobile 10 key microphone DTMF Desk microphone for F mobiles DC power cable 7m 31 95 94 95 18 95 25 95 18 95 10 95 104 95 104 95 83 95 83 95 62 95 392 64 409 07 4 95 66 95 394 95 4 95 94 95 31 95 46 95 8 95 8 95 8 95 73 95 27 95 57 95 31 95 8 95 124 95 27 95 31 95 1 95 1 95 8 95 8 95 8 95 8 95 0 95 8 95 28 95 46 95 89 95 119 95 10 95 83 95 62 95 443 57 460 00 443 57 460 00 14 95 20 95 66 95 394 95 14 95 94 95 31 95 15 95 26 95 46 95 25 95 18 95 18 95 18 95 18 95 18 95 46 95 62 95 83 95 67 95 179 95 105 95 18 95 124 95 27 95 11 95 9 95 18 95 18 95 104 95 104 95 41 95 62 95 121 95 134 95 67 95 41 95 9 95 74 95 62 95 m m m m m m m M rp rp Mh Mh m 263 95 263 95 79 95 28 95 47 95 84 95 84 95 84 95 19 95 52 95 68 95 28 95 128 95 75 95 75 95 26 95 63 95 142 95 254 95 254 95 27 95 46 95
111. for IC M71 Cigar lighter cable for IC M71 12V cigarette lighter lead for charging or 12V supply was CP 17 for IC M71 Spare Li lon battery pack for IC M71 7 4V 2000mAh Belt case yellow for IC M71 Yellow shoulder strap for use with BCM71 and IC M71 Spare rubber duck type aerial for IC M71 Waterproof speaker microphone for IC M71 Spare cable and plug for HM 167 Headset ear piece type needs OPC 1392 for IC M71 Headset neck arm type needs OPC 1392 for IC M71 Earphone with throat mic needs OPC 1392 for IC M71 Spare Alligator style belt clip YELLOW for IC M71 Swivel belt clip for IC M71 Headset adaptor cable for VOX hands free operation for IC M71 Cloning cable Serial type PC to transceiver for IC M71 Cloning cable USB type requires OPC 1655 for IC M71 DC power cable for use with BC 119N and IC M71 DC cable 12 20V for BC 121N and IC M71 Cloning cable adaptor for C M71 Cloning software needs OPC 478 and OPC 922 for IC M71 Service manual on CD for IC M71 Hand held marine amp PBR transceiver with Li lon pack amp charger Charger adaptor for BC 119N amp BC 121N and IC M87 Spare UK mains charger for use with BC 152 and IC M87 Desktop fast charger includes BC 145UK and IC M87 6 way charger for IC M71 needs BC 157S and 6 x AD 100 for IC M87 UK 3 PIN mains PSU for BC 119N fast charger for IC M87 EU 2 PIN mains PSU for BC 119N fast charger for IC M87 Spare desktop battery charger for IC M87 Spare AC adaptor for BC 121N and IC
112. for VHF UHF mobile transceiver DC cable for VHF UHF mobile transceiver Anderson powerpole connectors fitted DC cable for HF transceiver DC cable for HF transceiver fitted with Anderson powerpole connectors DC cable for HF transceivers IC 7000 WIFI cable 6 SMA M RP N WIFI cable 6 TNC M RP N male Patch lead RG 58 molded PL 259 on each end 3 long Patch lead RG 58 molded PL 259 on each end 6 long Patch lead RG 58 molded PL 259 on each end 9 long Patch lead RG 58 molded PL 259 on each end 12 long Patch lead RG 58 molded PL 259 on each end 18 long Patch lead RG 58 molded PL 259 on each end 50 long Patch lead RG 58 molded PL 259 on each end 100 long Patch lead RG 8X molded PL 259 on each end 3 long Patch lead RG 8X molded PL 259 on each end 6 long Patch lead RG 8X molded PL 259 on each end 9 long Patch lead RG 8X molded PL 259 on each end 12 long Patch lead RG 8X molded PL 259 on each end 18 long Patch lead RG 8X molded PL 259 on each end 50 long Patch lead RG 8X molded PL 259 on each end 100 long Patch lead RG 213 molded PL 259 on each end 3 long Patch lead RG 213 molded PL 259 on each end 6 long Patch lead RG 213 molded PL 259 on each end 12 long Patch lead RG 213 molded PL 259 on each end 18 long Patch lead RG 213 molded PL 259 on each end 50 long Patch lead RG 213 molded PL 259 on each end 100 long 15 meter 1 2 wave end fed Zepp antenna 17 meter 1 2 wave end fed Zepp antenna 20 meter 1 2 wave end fed Zepp antenna t t
113. for VX 110 150 YHA 69 Spare aerial for VX 177 YOUKITS EK 1A HF transceiver kit 3 band 40 30 20 QRP CW 4 5 Watts out 700Hz sidetone built in keyer EK 1B HF transceiver kit 3 band 20 17 15 QRP CW 4 5 Watts out 700Hz sidetone built in keyer HB 1B MK 2 4 band 80m 40m 30m 20m ready built 5W CW Transceiver now with charge socket FG 01 MK 2 Antenna analyser 1 72MHz LCD graphic digital display10 frequency memories FG 01 DC Spare DC cable for FG 01 FG 01 CASE Spare battery case for FG 01 18650 Battery pack for FG 01 HB 1B and EK 1A EK 1B needs FG 01 CHG FG 01 CHG Charger for FG 01 HB 1B EK 1A EK 1B when using 18650 220 230V UK 3 pin TJ2B 4 band 5W HF handheld transceiver 20 17 15 10m ready built ZX AERIALS amp ACCESSORIES 23137 Suction cup holder for portable aerials 23137 01 Extension kit for suction cup holder GP 3 Groundplane for 10 15 20m GP 2W Groundplane for 12 17m GP 3W Groundplane for 12 17 30m MTFT INT Magnetic balun brings down high SWR of a wire for ATU for indoor use MTFT EXT Magnetic balun brings down high SWR of a wire for ATU for outdoors MTFT MULTI Magnetic balun brings down high SWR of a wire for ATU for outdoors 3 taps 11372 20 Wideband long wire antenna with balun 20m long 100W max 11372 40 Wideband long wire antenna with balun 40m long 100W max N KIT N kit for ZX yagis ZX 4 3 4m 3 element yagi ZX 4 6 4m 6 element yagi ZX 6 2 6m 2 element beam boom length 0 6m 6 2dBd gain ZX 6 3 6m 3 element beam boom length 1 75m
114. gain 27MHz LFA yagi 7 7m long 5kW 10 42dBi gain 27MHz OP DES yagi 8 4m long 5kW 10 67dBi gain 27MHz OP DES yagi 13 8m long 5kW 11 01dBi gain comes in 2 boxes 28MHz LFA2 yagi 1 28m long 6 07dBi gain SkW 28MHz LFA2 yagi 1 4m long 6 50dBi gain SkW 28MHz OP DES yagi 2 1m long 7 47dBi gain 5kW 28MHz LFA2 yagi 3 1m long 8 02dBi gain 5kW 28MHz LFA yagi 4 5m long 9 15dBi gain 5kW 28MHz OP DES yagi 4 64m long 9 12dBi gain 5kW 28MHz OWA yagi 6 1m long 9 73dBi gain 5kW 25 95 25 95 33 95 119 95 16 95 16 95 10 95 14 95 14 95 16 95 16 95 19 95 74 95 36 95 2 95 11 95 11 95 9 95 1 95 28 95 8 95 29 95 29 95 44 95 12 95 23 95 14 95 20 95 9 95 49 95 9 95 39 95 15 95 11 95 41 95 74 95 51 95 168 95 62 95 74 95 62 95 62 95 62 95 62 95 62 95 62 95 62 95 63 95 62 95 35 95 74 95 24 95 52 95 30 95 71 95 528 95 5 95 5 95 1 049 95 2 149 95 429 95 699 95 899 95 699 95 1 999 95 1 799 95 1 999 95 2 499 95 2 499 95 379 95 529 95 1 095 95 1 799 95 349 95 499 95 589 95 689 95 999 95 1 499 95 228 95 349 95 299 95 449 95 899 95 999 95 139 95 159 95 199 95 229 95 349 95 299 95 379 95 399 95 789 95 159 95 169 95 199 95 239 95 299 95 339 95 369 95 DWOFOFWDEFWDWDODOAOOADDO
115. ground plane aerial RX TX 117 140MHz 820mm long N Discone 25 2000 MHz TX 6m 2m 70cm 23cm 1 535m long N Double discone 25 2000 MHz TX on 130 175 amp 410 475MHz 1 5m long N Mini Discone 25 2200MHz TX 6m 2m 70cm 23cm 90cm long N Wideband vertical 0 5 2000MHz 110cms long N The NOMAD compact portable scanning aerial 25 1300MHz Active NOMAD compact portable scanning aerial 25 1300MHz 2m 144 146MHz portable Slim Jim folds down to pocket size up to 25W 3 4 wave more than 3dBd gain 4m 70MHz portable Slim Jim folds down to pocket size Sky Scan Base station discone 25 2000MHz Sky Scan desk top scanning antenna 25 2000MHz coax BNC plug VHF UHF dedicated airband flexi handheld aerial TX on VHF 21 5cm long SMA plug VHF UHF dedicated airband flexi handheld aerial TX on VHF 17 3cm long SMA plug VHF UHF dedicated airband flexi handheld aerial TX on VHF 41cm long SMA plug 2m 70cm dualband rubber duck aerial 4 5cm long BNC plug 2m 70cm dualband rubber duck aerial 4 5cm long SMA plug 2m 70cm dualband rubber duck aerial 17 7cm long BNC plug 2m 70cm dualband rubber duck aerial 20cm long SMA plug 2m 70cm dualband rubber duck aerial 40cm long BNC plug 2m 70cm dualband rubber duck aerial 40cm long REVERSE SMA plug 2m 70cm dualband rubber duck aerial 40cm long SMA plug Regular Gainer scanning flexi 25 1900 MHz 21cm long BNC plug Regular Gainer scanning flexi 25 1900 MHz 21cm long SMA plug Super Gainer scanning flexi 25 1900 MHz 40c
116. in reducer for RG 58 L 259 plug for RG 213 type cable ack of 10 PL 259 plugs for RG 213 educer to fit PL 259 for RG 58 6mm L 259 plug for MINI RG8 7mm L 259 plug for Westflex 103 L 259 plug for RG 58 crimp type L 259 plug small entry SOLDERLESS for RG 58 L 259 plug small entry right angle SOLDERLESS for RG 58 L 259 plug small entry right angle for RG 58 L 259 plug for RG 174 crimp type Miniature UHF plug for RG 58 crimp type 0 239 right angled socket with built in reducer for RG 58 0 239 in line small entry socket for RG 58 0 239 in line large entry socket for RG 213 0 239 double ended chassis socket 0 239 chassis socket 4 hole 0 239 chassis socket 2 hole 0 239 chassis socket nut fixing BNC plug small entry for RG 58 Pack of 10 BNC plugs small entry for RG 58 BNC plug small entry right angle SOLDERLESS for RG 58 BNC plug large entry for RG 213 BNC plug for RG 174 crimp type BNC plug for RG 58 crimp type BNC plug large entry for Westflex 103 crimp type BNC socket in line small entry for RG 58 BNC chassis socket 4 hole BNC chassis socket nut fixing BNC chassis socket double ended nut fixing N plug large entry for RG 213 N plug large entry for Westflex 103 N plug small entry for RG 58 N plug for RG 174 crimp type solder centre N plug for RG 58 crimp type N socket large entry in line for RG 213 N socket small entry in line for RG 58 N chassis socket 4 hole N chassis socket n
117. kit NOVICE SW Short wave receiver 6 12MHz kit NOVICE MW Medium wave receiver 200 500m kit NOVICE AA Audio amplifier 250mW kit LWC 4 Antenna transformer for long wire ready built in a box CT 400 Antenna transformer for long wire ready built NRF 2 Passive audio noise reduction filter ready built LDG Z 11PROII Automatic ATU 0 1 125W Z 100PLUS Automatic ATU 0 1 125W 2000 memories 1 8 54MHz 2 817 Automatic ATU 0 1 20W for FT 817 Z 817H Automatic ATU 75W for FT 817 AT 100PROII Automatic ATU 1 8 54MHz 1 125W AT 200PROII Automatic ATU 5 250W 16 000 memories 1 8 54MHz AT 600PROII Automatic ATU 1 8 54MHz 600W AT 1000PROII Automatic ATU 1KW 1 8 54MHz AT 897PLUS Automatic ATU for FT 897 bolt on AL 100 Automatic ATU for Alinco 100W IT 100 Automatic ATU 0 1 125W 1 8 54MHz for IC 7000 KT 100 Automatic desktop ATU for Kenwood 100W YT 100 Automatic desktop ATU for FT 857 897 100 YT 450 Automatic ATU for FT 450 amp FT 950 100W 1 8 54MHz YT 1200 Automatic ATU for FT 450D FT 950 FT DX1200 amp FT DX3000 1 8 to 54MHz 100W FT METER External analogue meter for FT 857 897 FTL METER Jumbo meter4 5 inch for FT 857 897 DM 990 Dual meter for Kenwood TS 990 M 1000 Large meter for AT 1000PROII MOCVO ANTENNAS HW 80HP HF off centre fed dipole with 4 1 balun 80 10m inc WARC 40m long 400W HW 60HP HF off centre fed dipole half wave for 60m 5MHz 27 29m long 500W works OK on 30 15 40 6m with ATU 49 95 rPrerrrrandorroorrrrwawmrraoo gt y FRAQVEFOEFEFIQV
118. kit for mobile antenna SO 239 socket base coax amp PL 259 plug 5m long Cable kit for mobile antenna SO 239 socket base coax amp PL 259 4m long Cable kit for mobile antenna SO 239 socket base coax amp SMA plug 4m long Cable kit for mobile antenna SO 239 socket base coax amp BNC plug 4m long Cable kit very low loss for mobile antennas SO 239 socket base coax amp PL 259 plug 4m long Cable kit for mobile antenna SO 239 socket base coax amp PL 259 plug 4m long Cable kit for mobile antenna SO 239 socket base coax amp PL 259 plug 5m long Through window cable DC 1500MHz 2 x SO 239 HF 50MHz 150W SSB 2m SOW 70cm 30W 23cm 10W Bracket for mobile whip antenna for motor bike L shaped needs cable kit Rooftop railing mount bracket for K9000 suits 3 sided rail bar type Rooftop railing mount bracket for K9000 Roofside gutter mount bracket for K9000 Trunk lid or hatchback gate mount bracket for K9000 Spare protective plastic cap that fits over the S0 239 on a mag or gutter mount DIAMOND HANDPORTABLE ANTENNAS RH 3 RH 17 RH 205 RH 519 RH 536 RH 701 RH 707 RH 770 RH 771 RH 775 RH 789 RH 795 RH 799 RH 951S RH 999 RHF 10 RHF 20 RHF 40 RJ 77CA RH 1 RJF10 RH 103 RH 519 RH 815 RH 701 RH 771 RH 779 RH 789 RH 805S RH 920 RH 940 RH 999 RHF 10 RHF 40A RJF 40A RHF 1439 HC 200B HC 200S HC 100S HC 100 BNCP SMAJ BNCJ SMAP SMAJ SMA ANNMDDDDNDDHHHHNHHHHHH DIAMOND STATION ACCESSORIES
119. lapel microphone kit for TK 2202 3202 2302 3302 Palm size speaker microphone for TK 2202 3202 2302 3302 Speaker microphone for TK 2202 3202 2302 3302 Serial to USB adapter with drivers for TK 2202 3202 2302 3302 Programming interface cable serial for TK 2202 3202 2302 3302 Programming software for TK 2302 3302 VHF handy 136 174MHz 12 5 20 25KHz 1 5W 128 CH with belt clip needs aerial battery and charger UHF handy 440 470MHz 12 5 20 25KHz 1 4W 128 CH with belt clip needs aerial battery and charger VHF short antenna 146 162MHz for TK 2312 3312E VHF short antenna 162 174MHz for TK 2312 3312E VHF short antenna 136 150MHz for TK 2312 3312E UHF short antenna 440 490MHz for TK 2312 3312E UHF short antenna 400 450MHz for TK 2312 3312E VHF antenna 146 162MHz for TK 2312 3312E VHF antenna 162 174MHz for TK 2312 3312E VHF antenna 136 150MHz for TK 2312 3312E UHF antenna 440 490MHz for TK 2312 3312E UHF antenna 400 450MHz for TK 2312 3312E Ni MH battery 1500mAh for TK 2312 3312E Li ion battery 2000mAh for TK 2312 3312E Ni MH battery 1400mAh for TK 2312 3312E Rapid charger for KNB 45L and TK 2312 3312E 3 pin UK plug Rapid charger for KNB 45L and TK 2312 3312E 2 pin EURO plug DADAAADSKFVDDVIDSODSSYSPAWVIVIVISADNOA QOFrFFrFrFrFrSrSrSrSETSETSETSPIOIVDIIDESEODDADNDANANANSFSSFOOSFKSEWWBDOSSSPONOVIVOSFSESESPSESSSSFSESFSFPIOIIESESFAIVIIIFSSESEOIIIIINIFSFDONOISFOOOSFSSESEYSrYSrSE EIVO KSC 356T KSC 31T KSC 316T KMB 30
120. mmm m m rm m 00 AR DV1 Mobile desk top allmode scanner with built in digital voice decoder 100kHz 1300MHz 1199 95 C ARD 300 External digital voice decoder will decode APCO P25 D STAR NXDN dPMR Alinco Yaesu 699 95 C RF 6G RF front end super wide band RF tuner 500KHz to 6GHz 4 795 95 C AR 6000 Professional grade communications receiver 9KHz 6GHz IQ digital o p board and software 4 499 95 C HRE 5001 EIA standard 19 inch rack mount kit for AR 6000 front panel fitted with ext spkr and handles 1 099 95 C ARL 2300 LAN box external ethernet remote controller for AR 6000 549 95 C APCO P25 APCO 25 option internal board for AR 6000 for P25 decoding conventional mode 159 95 C GP 5001 External GPS receiver improves frequency stability accuracy from 1ppm to 0 01ppm 289 95 C 1Q 5001 Q option internal board with software for record playback for AR 6000 449 95 C AR 5001D Professional grade communications receiver 40KHz 3 15GHz DSP 2 799 95 C 1F5001 Optional board to change the IF output from 45 05MHz to 10 7MHz for AR 2300 5001D 6000 259 95 C ARL 2300 LAN box external 549 95 C AS 5001 4 way aerial switch up to 3 5GHz control and power from rig for AR 5001D only 124 95 C 1Q 5001 Q option internal board with software for record playback for AR 5001D 449 95 C AR IQ2 USB hardware key dongle UO software can run on any PC with this dongle plugged in it 259 95 C APCO P25 APCO 25 option internal board for AR 5001D for P25 decoding conventio
121. mobile whip antenna 3 way coax switch SO 239 1 5KW 0 900MHz Basic dipole antenna kit Deluxe dipole antenna kit Trailer hitch antenna mount SO 239 amp 3 8ths thread Boom mounted yagi balun for HF 6m 80 6m portable self supporting vertical antenna 31 feet long 600W Base station vertical HF aerial 160 6m 1500W 43 high self supporting weighs 20lbs Packet Operators Handbook Fox Hunt Adventure Book Troubleshooting antennas book 73 Dipole Vertical Antennas Book 73 Vertical Beam Antennas Book Antennas and Transmission Lines Book Antennas From The Ground Up Volume 1 Antennas From The Ground Up Volume 2 Morse Code Book Giant Book Of Electronic Projects Solid State QRP Projects Book FET Principles Book Ferromagnetic Core Design Book Practical RF Design Manual Radio Components Manual Ladder Crystal Filters Book Switch mode power supply for FT 817 AC mains power supply for MFJ QRP Portable power pack for MFJ QRP 12V or 8 x D cells with charging circuit Send up to 1Amp DC and up to 50 Volts DC down a coax cable Pair of MFJ 4116 Bias Tee Bias Tee with on off switch ransceiver voltage conditioner Super battery booster Remote for super battery booster House window antenna feedthrough panel N connectors House window antenna feedthrough panel PL 259 connectors 4 position coaxial patch panel 6 position coaxial patch panel 2 position remote antenna switch 1 8 150MHz 4 position remote antenna switch 1 8 150MHz Remote c
122. option 399 95 MTU 30 20 RF y tuning unit C 30 20m band unit for FT DX9000CONTEST installation option 399 95 FH 2 Y Spare remote keypad for FT DX9000 29 95 OOO TOK T K T T T K T T K K T T K T T T OH HOO CET C3 ro AADADADADAFAADAAADADAAADAADADADASFSFDDIDVDASADADADADADAADAAAAAAARAADAAAAAAAADA OOO KOG GO SCU 17 USB interface unit for FT DX9000 SCU 22 Connecting cable RXU 9000 Dual receive unit for FT DX9000 installation option VRF 9000 Sub band VRF unit for FT DX9000 installation option DMU 9000 Data management unit for FT DX9000 installation option TFT 9000 internal TFT screen unit for FT DX9000 installation option FT DX5000MP Deluxe base station 200W HF amp 6m transceiver with 300Hz roofing filter and SM 5000 station monitor FT DX5000MP LTD Deluxe base station 200W HF amp 6m transceiver with 300Hz roofing filter MD 200A8X Dynamic desk microphone for FT DX5000 MD 100A8X Desk microphone for FT DX5000 MH 31B8 Spare hand mic for FT DX5000 SP 2000 Y External speaker for FT DX5000 YH 77STA Open air type stereo headphones for FT DX5000 79101556 Control cable between FT DX5000 and G 1000DXC MTU 160 RF tuning unit A 160m band unit for FT DX5000 needs RF UTUNEKIT MTU 80 40 RF tuning unit B 80 40m band unit for FT DX5000 needs RF UTUNEKIT MTU 30 20 RF tuning unit C 30 20m band unit for FT DX5000 needs RF UTUNEKIT RF UTUNEKIT Base platform for MTU 160 80 40 30 20 SCU 17 USB int
123. radio for Yaesu 1 x 4 pole plug Perfect size mini speaker microphone for Icom Yaesu ADI Standard Alinco Perfect size mini speaker microphone for Kenwood Perfect size mini speaker microphone for Yaesu VX 7R etc Perfect size mini speaker microphone for Yaesu FT 10 40 50 amp VX 1R only Speaker mic for Kenwood Headset boom mic earpiece for Icom Yaesu etc handheld transceivers Headset boom mic earpiece for Kenwood handheld transceivers Headset boom mic earpiece for Yaesu VX 7R Headset boom mic earpiece for Yaesu handheld transceivers Microphone for MFJ SSB transceivers HF radio handheld mic 8 pin round HF radio handheld mic 4 pin round HF radio handheld mic 8 pin modul HF radio handheld mic 8 pin round HF radio handheld mic 4 pin round HF radio handheld mic 8 pin modul HF radio handheld mic 8 pin round HF radio handheld mic 4 pin round HF radio handheld mic 8 pin round HF radio handheld mic 4 pin round HF radio handheld mic 8 pin modul Lightweight earpiece for Icom with Lightweight earpiece for Kenwood Icom Icom ar Icom Kenwood Kenwood ar Kenwood Ten Tec Ten Tec Yaesu Yaesu ar Yaesu VOX with VOX Lightweight earpiece for Yaesu wit Discreet earphone microphone PT Discreet earphone microphone PT Discreet earphone microphone PT Discreet earphone microphone PT h VOX for Icom Yaesu ADI Standard Alinco for Kenwood for Yaesu VX 7R for Yaesu FT 10 40 50 amp VX 1R only
124. speaker with volume control Deluxe communications station speaker Amplified earpiece 12dB Super amplified earpiece 50dB Desk stand heavy duty with gooseneck for hand microphone Mono Padded communications headphones Headphones with boom microphone wired for Icom 8 pin round Headphones with boom microphone wired for Kenwood 8 pin round Headphones with boom microphone wired for Yaesu 8 pin round Headphones with boom microphone wired for Icom 8 pin modular RJ 45 Headphones with boom microphone wired for Kenwood 8 pin modular RJ 45 Headphones with boom microphone wired for Yaesu 8 pin modular RJ 45 Econo keyer will send iambic auto semiauto manual Tiny electronic keyer built in iambic paddle Micro CW keyer Micro CW keyer with built in iambic paddle Deluxe electronic Keyer Curtis keyer chip for MFJ 9020 Pocket Morse tutor similar to 417 less random words QSO s setting saver Profesional Morse tutor and practice oscillator CW adaptor for MFJ 9420X CW adaptor for MFJ 9406X 9402 Pocket Morse tutor same as 418 but no LCD Pocket Morse tutor Compact keyer with built in paddle Compact keyer fit your own paddle Contest voice keyer Slimline econo keyer Slimline electronic keyer with paddle Slimline electronic keyer fit your own paddle Slimline deluxe keyer CW keyboard with power supply Interface only no keyboard CW keyboard with perpetual memory 2 line 16 character Interface only no keyboard Pocket size Morse code reade
125. style belt clip 10 95 MB 130 Vehicle charger bracket for use with BC 213 31 95 CP 23L 12V cigarette lighter lead for charging or 12V supply 18 95 OPC 656 DC power supply cable 12 20V for use with BC 214 8 95 OPC 478UC Cloning cable for radio to PC RS 232C USB type 46 95 CS F29SR Programming software for IC F29SR 72 95 HM 158LA Compact speaker microphone 27 95 HM 159LA Durable speaker microphone 57 95 IC F4029SDR Professional licence free digital radio BC 160 BC 145 BP 231 MB 94 199 95 AD 106 Charger adaptor for BC 119N 121N 14 95 BC 119N 15 25 Fast charger includes AD 106 amp BC 145 66 95 BC 121N 15 25 6 way fast charger includes 6 x AD 106 amp BC 124 389 95 BC 145 UK mains PSU for BC 119N fast charger 14 95 BC 157 Spare AC adaptor for BC 121 94 95 BC 160 Spare Desktop rapid charger 31 95 BP 231 Spare Li ion battery pack 7 4V 1150mAh 26 95 BP 232N High capacity Li ion battery pack 7 4V 2000mAh 46 95 CASE 053 Soft case for IC F44GT GS amp IC F4029SDR amp IC F3022 18 95 CASE 054 Hard case for IC F44GT GS amp IC F4029SDR amp IC F3022 29 95 HM 153L Earphone microphone screw type connector 72 95 HM 158LA Heavy duty hand held microphone 27 95 HM 159L Splash proof full sized speaker microphone durable 56 95 HS 94 Headset ear piece type needs VS 1L 18 95 HS 95 Headset neck arm type needs VS 1L 125 95 HS 97 Earphone with throat mic needs VS 1L 27 95 MB 93 Swivel belt clip 11 95 MB
126. the ear earpiece 2 5mm mono jack plug beige colour PAD 9 Spare replacement black foam pad for FBI 9 type earpiece WAT 999 Acoustic tube earpiece 3 5mm straight plug curly cable WAT 999K Acoustic tube earpiece 2 5mm right angled plug curly cable WEP 300MKIl Over the ear earpiece 3 5mm mono jack plug WEP 300KMKII Over the ear earpiece 2 5mm mono jack plug WEP 400 Deluxe earpiece 1 5m lead 8 Ohms 3 5mm mono jack plug HP 100 8 Ohm communications headphones 3 5mm amp 1 4 30 9751 Pillow speaker 8 Ohms 1 5m lead with 3 5mm mono jack plug 17 0576 Earpiece 8 Ohms 0 9m lead with 3 5mm mono jack plug 17 0575 Earpiece 8 Ohms 0 9m lead with 2 5mm mono jack plug IW 02 USB 2 0 cable for iPod and iPod mini for PC to iPod IW 04 3 5mm plug to plug retractable cable connects your audio device to speakers etc 100 330 Headphone adaptor 3 5mm plug to two sockets WATSON SAFE 2 WAY MOBILE MICROPHONE amp ACCESSORIES SAFE 2 WAY Hands free mobile microphone system with microphone amp PTT VDC 101 DC lead with cigar lighter plug for HKU 356 if separate power is required VDC 102 DC lead bare end for HKU 356 if separate power is required ICM 101 Lead between SAFE 2 WAY amp Icom modular RJ 45 ICM 102 Lead between SAFE 2 WAY amp Icom 8 pin round KEN 101 Lead between SAFE 2 WAY amp Kenwood modular RJ 45 KEN 104 Lead between SAFE 2 WAY amp Kenwood amp Alinco 8 pin round YAE 101 Lead between SAFE 2 WAY amp Yaesu small modular RJ 11 YAE 10
127. throat microphone for use with VS 1 IC and IC T70E needs OPC 2006 OPC 2006 Plug adaptor cable for HS 94 95 97 when using with IC T70E CS 170 Cloning and programming software for IC T70E OPC 474 Cloning cable set to set for IC T70E OPC 478 PC cloning cable computor to radio RS 232C type for IC T70E OPC 478UC PC cloning cable computer to radio USB type for ID T70E CP 12L Cigarette lighter cable with noise filter for IC T70E CP 19R Cigarette lighter cable DC DC convertor built in for IC T70E CP 23L Cigarette lighter cable for use with BC 191 or BC 193 OPC 254L DC power cable with 1 end bare wires L shaped plug with in line fuse for IC E80D OPC 515L DC power cable for use with BC 191 BC 192 BC 193 LC 174 Leatherette carry case for IC T70E MB 124 Spare aligator type belt clip for IC T70E SM T70 Service manual on CD for IC T70E IC V80E 2m 5 5W hand held transceiver long lasting battery life loud audio built in VOX BC 01 Spare UK mains charger for BC 192 also needs BC 192 to charge IC V80E BC 06 Spare UK mains PSU for BC 191 and BC 193 BC 191 Rapid desktop charger for BP 264 2 hours comes with BC 06 for IC V80E BC 192 Spare charger for IC V80E and BP 264 16 hours comes with BC 01 BC 193 Rapid desktop charger for BP 265 2 5 hours comes with BC 06 for IC V80E BP 263 Dry cell case for IC V80E 6 x AA cells not included BP 264 Spare Ni MH battery pack 7 2V 1400mAh for IC V80E BP 265 Li lon battery pack 7 4V 1900mAh 2000mAh for IC V80E H
128. type 2m 70cm 23cm fibre glass 4 5 8 3 11 7 dB 1 8m long N type 2m 70cm 23cm fibre glass 6 5 9 0 10 0 dB 3 05m long N type 2m 70cm 23cm fibre glass 8 3 11 7 13 7dB gain N type VHF UHF airband 3 4dB VHF 5 5dB UHF 1 7m long 120 300MHz PL 259 type Flat antenna for AM FM SW reception 50 Ohms 285Wx184hx1 5dmm 240g 4m coax PL 259 type Receiving antenna 1 56m long 0 5 200MHz with 10m RG 58U PL 259 type 2m 70cm 6 5dBi 9 0dBi 150W 2 85m long NO RADIALS NEEDED PL 259 type DIAMOND VHF UHF COMMERCIAL BASE STATION ANTENNAS CP 22E F 22 F 23 F 23H BC 100 BC 100S BC 101 BC 103 BC 200 BC 205 BC 200U BC 200L BC 202 BC 102 144 174MHz 6 5dB gain 200W 2 7m long 2 x 5 8 SO 239 144 174 MHz 6 7dB gain 200W 3 2m long 2 x 7 8 SO 239 144 174 MHz 7 8dB gain 200W 4 6m long 3 x 5 8 SO 239 144 174 MHz 7 8dB gain 350W 5 2m long 3 x 5 8 SO 239 134 174 MHz 4 5dB gain 200W 1 7m long 1 x 5 8 SO 239 115 174 MHz 3 4dBi gain 100W 1 7m long 1 x 5 8 SO 239 144 174 MHz 3 5dB gain 200W 1 5m long 1 x 5 8 SO 239 144 174 MHz 3 5dBi gain 300W 1 25m long 1 x 5 8 SO 239 NO RADIALS needed 430 490MHz 6 5dB gain 200W 1 7m long 3 x 5 8 SO 239 430 490MHz 8 5dB gain 200W 2 9m long 3 x 5 8 SO 239 450 510MHz 6 5dB gain 200W 1 7m long 3 x 5 8 SO 239 370 430MHz 6 5dB gain 200W 1 7m long 2 x 5 8 SO 239 430 490MHz 6 5dB gain 200W 1 15m long 2 x 5 8 SO 239 134 174 MHz 6 5dB gain 200W 3 2m long 2 x 5 8 SO 239 DIAMOND VHF UHF COMMERCIAL MOBILE ANTENNAS M150GS M150
129. with 4 contact single pole plug 15 95 HE 57S D type earpiece with 4 contact single pole plug with screw 15 95 UM 700M Hand held speaker microphone 2 pin type for Icom Standard Yaesu Alinco 21 95 UM 700K Hand held speaker microphone 2 pin type for Kenwood 21 95 UM 700V Hand held speaker microphone 4 contact single pole plug for Icom Yaesu Standard 21 95 UM 700S Hand held speaker mic 4 contact single pole plug with screw for Yaesu Standard 21 95 ELECRAFT TRANSCEIVERS amp ACCESSORIES K3S 100 F High Performance 100W HF amp 6M DSP Transceiver Fully Assembled 2 699 95 K3S 100 K High Performance 100W HF amp 6M DSP Transceiver Modular No Solder Kit 2 599 95 K3S 10 F High Performance 10W HF amp 6M DSP Transceiver Fully Assembled 2 149 95 K3S 10 K High Performance 10W HF amp 6M DSP Transceiver Modular No Solder Kit 2 049 95 K3 100 F High Performance 100W HF amp 6M DSP Transceiver Fully Assembled 2 099 95 K3 100 K High Performance 100W HF amp 6M DSP Transceiver Modular No Solder Kit 1 999 95 K3 10 F High Performance 10W HF amp 6M DSP Transceiver Fully Assembled 1 599 95 K3 40 K High Performance 10W HF amp 6M DSP Transceiver Modular No Solder Kit 1 499 95 PRO SET K2 Heil Large dual headphones boom microphone for Elecraft with AD 1 K8 156 95 EM 184 K3 YOGA lightweight communications heaset with boom microphone for K3 with AD 1 K8 49 95 KRX3 F Sub Receiver for K3 Transceiver Fitted to your radio 649 95 KRX3 K Sub Rec
130. with USB 81 USB cable 49 95 ADMS VX3 Programming software for VX 3 comes with USB 57A USB cable 49 95 ADMS VX6 Programming software for VX 6 comes with USB 57B USB cable 49 95 ADMS VX8 Programming software for VX 8E amp VX 8DE comes with USB 59 USB cable 69 95 ADMS VX8G Programming software and lead for VX 8GE comes with USB 82 USB cable 49 95 RTS 03 USB to Serial Converter 2000 XP VISTA with drivers on CD 24 95 USB RTS 05 USB cable for programming and data for IC E2820 29 95 USB 57B USB cable to single pin 4 pole 3 5mm jack plug for radio programming with drivers on CD ROM 34 95 USB 62B USB cable 8 pin mini din for Yaesu HF radio programming and control software CD with drivers 33 95 WCS R10 Programming software for IC R10 comes with USB 29A USB cable 49 95 WCS 80 U Programming software only for IC E80 27 95 WCS 208 Programming software for IC 208 comes with USB 29A USB cable 49 95 WCS 2820 SOFT Programming software only for IC E2820 24 95 WCS 2820 USB Programming software for IC E2820 comes with USB 29A USB cable 49 95 WCS 2820 DATA Programming and data software for C E2820 comes with USB RTS05 USB cable 49 95 WCS D880 Programming and data software for ID E880 comes with USB 29A USB cable 49 95 WCS 7000 Programming software for IC 7000 comes with USB RTS 01 USB cable 49 95 WCS 7410 Programming software for IC 7410 comes with USB RTS 01 USB cable 49 95 WCS D5100 USB Programming software for ID 5100 comes with
131. 0 DC power cable 1 end bare wires L shaped plug for IC PCR2500 Controller extension cable 3 5m with joiner for IC R2500 DSP unit for IC R2500 DTMF decoder unit for IC R2500 D STAR digital unit for IC R2500 Mobile speaker 4W 8 Ohms for IC R2500 Service manual for IC R2500 Base all mode 0 1 2000MHz with PSU Listed Spare mains power supply for IC R8500 Discone antenna 100MHz 3 3GHz High stability crystal for IC R8500 455KHz CWIRTTY filter 500Hz for IC R8500 Mobile mount for IC R8500 Carry handle and feet for IC R8500 4 pin Molex DC lead for IC R8500 and IC E290 and varients PC control software for IC R8500 95 98 only Base station speaker small for IC R8500 Service manual for IC R8500 Professional communications receiver 0 005 3335MHz RS 232 computer interface for IC R9500 Base station speaker large with audio filters for IC R9500 P25 digital unit provides APCO P25 digital mode reception for IC R9500 VHF Airband vehicle transceiver Mobile mount Spare DC lead Cloning cable PC to transceiver needs OPC 592 Cloning cable mobile to mobile Cloning cable needs OPC 478 Headset adaptor with PTT socket Desk microphone Standard mobile microphone Mobile 10 key microphone Hand microphone 10 Amp power supply with choice of base enclosure Spare base enclosure for C A110 Programming software and service manual on PC CD ROM Service manual for IC A110 Handheld airband transceiver VOR NAV BP210N OPC499 BC 11
132. 0 DVD or VCR adaptor cable for CP 300 14 95 P 58 Transducer depth temperature speed 50 200KHz 600W RMS plastic for CPF 300 149 95 CP 3001 Marine GPS chart plotter 7 colour TFT screen 3000 waypoints 50 routes with internal aerial 599 95 CP 300 Marine GPS chart plotter 7 colour TFT screen 3000 waypoints 50 routes with external aerial 649 95 79101553 Power cable for CP 300 15 95 HBS27BX Mounting bracket with knob for CP 300 16 95 UXOGPL10SD GPS antenna for CP 300 145 95 8002235 Protective dust cover for CP 300 15 95 ACVC10 DVD or VCR adaptor cable for CP 300 14 95 CPF 1801 Chart plotter fish finder needs transducer 5 inch colour screen 439 95 79101553 Power cable for CP 180 15 95 HBS27BX Mounting bracket with knob for CP 180 16 95 UXOGPL10SD GPS antenna 145 95 8002222 Protective dust cover for CP 180 14 95 P 58 Transducer depth temperature speed 50 200KHz 600W RMS plastic 149 95 CP 1801 Marine GPS chart plotter 5 colour TFT screen 600 waypoints 20 routes with internal aerial 339 95 CP 180 Marine GPS chart plotter 5 colour TFT screen 600 waypoints 20 routes with external aerial 359 95 79101553 Power cable for CP 180 15 95 HBS27BX Mounting bracket with knob for CP 180 16 95 UXOGPL10SD GPS antenna CP 180 only 145 95 8002222 Protective dust cover for CP 180 14 95 FF 525 Fish finder echo sounder needs transducer 199 95 B 117 Transducer depth temperature opt 50 200KHz 600W RMS bronze 199 95 P 319 Transducer depth temperature opt
133. 0 Ohms RG 58 1 x N plug Patch lead 50 Ohms RG 58 1 x N plug 1 x BNC plug 10m long Patch lead 50 Ohms RG 58 1 x N plug 1 x BNC plug 15m long Patch lead 50 Ohms RG 213 2 x PL 259 66cms long Patch lead 50 Ohms RG 213 2 x PL 259 10m long Patch lead 50 Ohms RG 58 mil spec 2 x PL 259 10m long Small mag mount with coax BNC socket to BNC plug Window clip antenna mount BNC for mobile use Triple magnetic mount with SO 239 socket and 5m cable with PL 259 Triple magnetic mount with 3 8 socket and 5m cable with PL 259 x BNC plug 2m long 10m resonant end fed approx 5m long 150W PEP c w mounting insulator support cord ties amp tape 12m resonant end fed approx 6m long 150W PEP c w mounting insulator support cord ties amp tape 15m resonant end fed approx 7m long 150W PEP c w mounting insulator support cord ties amp tape 17m resonant end fed approx 8m long 150W PEP c w mounting insulator support cord ties amp tape 20m resonant end fed approx 10m long 150W PEP c w mounting insulator support cord ties amp tape 30m resonant end fed approx 15m long 150W PEP c w mounting insulator support cord ties amp tape 60m resonant end fed approx 30m long 150W PEP c w mounting insulator support cord ties amp tape 159 95 99 95 109 95 3 95 9 95 7 49 16 95 15 95 9 95 20 95 20 95 19 95 14 95 14 95 11 95 9 95 16 95 13 95 19 95 16 95 5 95 5 95 5 95 5 95 5 95 7 95 9 95 1
134. 00E DC cable with cigar lighter plug for HX 400E Antenna connector adaptor SMA BNC for HX 400E Spare antenna for HX 400E Programming software for HX 400E Programming cable for HX 400E Handheld marine transceiver Li lon battery and charger floats has strobe light Waterproof speaker microphone for HX 751E Speaker microphone for HX 751E Vox headset for HX 751E Earpiece microphone for HX 751E Charging cradle for HX 751E Antenna connector adaptor SMA BNC for HX 751E Spare charger for HX 751E 3 pin EU old style Spare charger for HX 751E 3 pin UK new style Spare charger for HX 751E 3 pin EU new style Dry cell case for HX 751E 5 x AAA cells Spare 1150mAh Lithium lon battery pack for HX 751E DC cable with cigar lighter plug for HX 751E External DC cable for HX 751E Spare antenna for HX 751E Programming software for HX 751E Programming cable for HX 751E 35 95 23 95 59 95 28 95 19 95 11 95 11 95 2 95 42 95 9 95 8 95 9 95 41 95 48 95 139 95 35 95 23 95 59 95 28 95 13 95 8 95 11 95 11 95 11 95 16 95 29 95 9 95 6 95 9 95 41 95 48 95 Handheld marine transceiver Li Ion battery and charger floats has strobe light BLUETOOTH 294 95 Spare Bluetooth headset mono for HX 760E Charge cradle 3 hours for BH 1 BH 2 and HX 760E needs PA 46 Charger for CD 40 and HX 760E 3 pin UK new style Charger for CD 40 and HX 760E 3 pin EU new style Water
135. 00W 1 00m long PL 259 2m 70cm dualband 100W 3 5 5 dB gain 200W 0 98m long PL 259 2m 70cm dualband 100W 100W 0 43m long PL 259 1 4 wave on 2m amp 1 2 wave on 70cm 2m 70cm dualband 100W 3 5 5 dB gain 200W 0 98m long PL 259 black whip 2m 70cm dualband 200W 2 15 5 5dBi 0 96m with coil spring base PL 259 2m 70cm dualband 200W 3 4 6 0dBi 150W 1 1m with coil spring base PL 259 2m 70cm 23cm triband 100W 50W 3 15dB 6 3dB 9 7dB gain 0 99m long N type 2m 70cm dualband 250W 200W 3 5 5dB gain 1m long enclosed coil PL 259 2m 70cm dualband 300W 250W 3 2dBi 6 4dBi gain 1 46m long PL 259 Portable mobile antenna 7 430MHz 130W SSB telescopic 0 5 1 77m PL 259 BNC portable antenna 7 50MHz 120W SSB 0 5m 1 78m 6 10 15 20 40m mobile whip 100W 1 8m long spring base PL 259 2m 7 8th 5 2dB gain 1 59m long 150 Watts PL 259 2m 70cm 2 15dBi 3 8dBi 100W 0 47m long PL 259 2m 70cm 2 15dBi 4 8dBi 60W 0 62m long PL 259 2m 70cm 3 2dB 5 7dB 150W 0 96m long and 300MHz receive PL 259 2m 70cm 2 15dB 5 5dB 150W 0 99m long and 300MHz receive PL 259 2m 70cm 3 5 6dB gain 150W 1 06m long and 300MHz receive PL 259 2m 70cm 4 3dB 6 8dB 150W 1 27m long PL 259 2m 70cm 5 0 7 6 dB 150W 1 58m long PL 259 2m 70 23cm 3 15dB on 2m 6 3dB on 70cm 9 7dB on 23cm 100W 1 00m long PL 259 2m 70 23cm 3 15dB on 2m 6 3dB on 70cm 9 7dB on 23cm 100W 1 00m long N type 6m 2m 70cm 2 15dBi on 2m 5 2dBi on 70cm 60W 0 82m long PL 259 6m 2m 70cm 3dBi on 2m 5 8dB on 70cm 100W 1 07m long PL 259 2m 70cm 2 15dBi on
136. 00mA max Solar powered pocket torch Dynamic hand microphone 600 Ohm impedance with 4 pin CB type plug wired for Cybernet Mains kettle type 2m black lead with Euro 2 pin plug 5 Amp 2m long Mains kettle type 2m black lead with UK 3 pin plug 5 Amp 2m long Plug top 3 pin UK type hard wearing type black fused 13 Amp Plug top 2 pin EU type hard wearing type black Converts 2 pin Euro plug on fly lead to 3 pin UK plug permanantly black Converts 3 pin UK plug to a continental 2 pin plug 7 5A Log periodic antenna Motorcycle intercom set with pair of boom mics and ear sets 200ml aerosol can of Super Servisol switch cleaner and lubricator 200ml aerosol can of multi purpose foam cleaner Waterproof flexible sealer enough for 9 plugs Foot switch push on push off action latching 6 35mm mono jack plug Foot switch push to make action momentry 6 35mm mono jack plug Medium size black polypropylene ribbed insulator 7 x 2 5cm Large size black polypropylene ribbed insulator 11 x 3 5cm Ceramic insulator rectangular shape ideal for dipole center piece Plastic egg insulator 35mm long x 25mm wide Self amalgamating tape Airplane tracker RMX Sealing compound Pliable and rated 200 Deg C amp 25KV Packs of 0 5kg MIZUHO QRP TRANSCEIVER ACCESSORIES 14X 05S 14X 30S 3 5X 00S 3 5X 25S 3 5X 50S 3 7X 25S 3 7X 50S 3 7X 75S 6X 05S 7X 75S MASTS MAST LONG MAST SHORT FFLO SBSM 10 SBSM 12 SBSM 10 WTW SBSM 12 WTW WRCW
137. 05 705 305 805 729 etc MK 1 Kenwood adaptor for 24 25 and TH 25 25G 45 45G 55 75 77 etc MK 2 Kenwood adaptor for 24 25 and TH 22A 22AT 42A 42AT 59 79E etc MIRAGE 70CM AMPLIFIERS D 15N 70cm amplifier 1W in 15W out D 26N 70cm amplifier 2W in 60W out D 100 ATVN 70cm amplifier 2W in 100W out D 1010N 70cm amplifier 10W in 100W out D 1010 ATVN 70cm amplifier 10W in 100W out D 3010 N 70cm amplifier 5 45W in 100W out MIRAGE 6M 2M 70CM ATV REPEATER A 1015 R 3 4 Watts in 110 Watts out FM SSB CW 50 54MHz B 1018 G 3 4 Watts in 120 Watts out FM SSB CW 145 148MHz B 2518 R 10 12 Watts in 120 Watts out FM SSB CW 145 148MHz D 100 ATV R 0 25 1 Watt in 52 Watts out FM SSB CWIATV 420 450MHz for ATV repeater D 1010ATV NR 4 Watts in 80 Watts out FM SSB CW ATV 440 450MHz for ATV repeater D 1010 NR 70cm repeater amplifier 4W in 80W out D 3010 NR 70cm repeater amplifier 12W in 80W out MIRAGE MARINE BAND COMMERCIAL AMPLIFIER M 120 G 2 Watts in 25 Watts out FM SSB CW 156 158 5MHz marine band amplifier MIRAGE VHF COMMERCIAL AMPLIFIERS B 34 GC 2 Watts in 25 Watts out FM 150 174MHz VHF commercial amplifier for handheld PAC10 70 B 10 Watts in 70 Watts out FM 150 174MHz commercial amplifier for mobile PAC30 130B 30 Watts in 130 Watts out FM 150 174MHz commercial amplifier for mobile MIRAGE UHF COMMERCIAL AMPLIFIER PAC15 100 C 15 Watts in 100 Watts out FM 450 470MHz commercial amplifier MIRAGE UHF PRE AMPLIFIERS KP 1 10M 10m pre amplifier in shack type 28 30MH
138. 09 95 D CATC 460 UHF base station colinear aerial 450 470MHz 5dBd gain N 3dBd gain 1 46m long 209 95 D CATC 160 VHF 3dBd gain end fed integral clamp N socket 152 163MHz 2 63m long 219 95 D SCAT 160 VHF base station colinear 140 174MHz specify frequency 6dBd gain 6m long 759 95 D PA 2004 VHF High band base station aerial folded dipole 149 189 00MHz boom 1m long 139 95 D PA 2002 VHF Low band base station aerial folded dipole 50 90MHz boom 1 3m long 154 95 D PA 2006 UHF base station aerial folded dipole 440 480MHz boom 1 3m long 129 95 D PA 2072 VHF base station 120MHz folded dipole boom 1 3m long 154 95 D HEL 21 BNC Flexible helical 169MHz BNC 10 95 A HEL 21 TNC Flexible helical 169MHz TNC 10 95 A HEL 21 STUD Flexible helical 169MHz STUD 10 95 A HEL 23 BNC Flexible helical 157MHz for VHF marine band BNC 10 95 A HEL 23 TNC Flexible helical 157MHz for VHF marine band TNC 10 95 A HEL 23 STUD Flexible helical 157MHz for VHF marine band STUD 13 95 A HEL 25 BNC Flexible helical 455MHz high band UHF BNC 10 95 A HEL 25 TNC Flexible helical 455MHz high band UHF TNC 10 95 A HEL 25 STUD Flexible helical 455MHz high band UHF STUD 13 95 A HEL 26 BNC Flexible helical 430MHz low band UHF BNC 10 95 A HEL 26 TNC Flexible helical 430MHz low band UHF TNC 10 95 A HEL 26 STUD Flexible helical 430MHz low band UHF STUD 13 95 A NIFTY MANUALS EZ DSTAR Nifty E Z guide to D STAR Operation 12 99 A NIFTY 857 Nifty guide to Yaesu FT 857D 14
139. 0E CT 91 Microphone adaptor for FT 270E MH 57A4B Speaker microphone for FT 270E VC 27 Earpiece microphone for FT 270E MH 73A4B Waterproof speaker microphone for FT 270E VC 24 Vox headset for FT 270E 14 95 69 95 41 95 55 95 55 95 11 95 11 95 12 95 12 95 11 95 11 95 15 95 3 95 159 95 14 95 8 95 14 95 10 95 24 95 5 95 19 95 49 95 24 95 28 95 61 95 35 95 11 95 11 95 39 95 3 95 15 95 99 95 8 95 8 95 7 95 13 95 24 95 5 95 19 95 15 95 14 95 14 95 22 95 24 95 50 95 9 95 11 95 11 95 52 95 52 95 16 95 16 95 15 95 289 95 289 95 14 95 8 95 14 95 10 95 24 95 5 95 19 95 49 95 24 95 28 95 36 95 11 95 11 95 39 95 16 95 3 95 119 95 8 95 8 95 7 95 10 95 13 95 28 95 29 95 22 95 24 95 49 95 11 95 11 95 10 95 24 95 12 95 12 95 21 95 19 95 5 95 8 95 89 95 8 95 19 95 5 95 9 95 11 95 11 95 52 95 52 95 16 95 16 95 15 95 14 95 14 95 8 95 13 95 24 95 5 95 9 95 25 95 28 95 36 95 61 95 rFrerwmwrrrrrrrrraoarrorroaoororrrFrrrrandrerroaooaFrrrorrrrrrrrrrrrarrayerraoaororrrrrrroaorrrrrrrrannaoaye QAOOFSFYSrYrrrrrrrraorrrrrrorrrrrr gt Y FTD 7 CLIP 14 YAESU RECEIVERS VR 160 ADMS 5 FNB 82L1 PA 46U PA 46C FBA 37 YHA 66 CSC 92 CN 3
140. 0MHz for TK 3260 Li lon battery 2000mAh for TK 2260 3260 Li lon battery 1030mAh for TK 2260 3260 Rapid charger for TK 2260 3260 Rapid charger for TK 2260 3260 6 way tri chemistry charger for TK 2260 3260 Optional wall hanging bracket for KSC 326T Speaker microphone for TK 2260 3260 Spare belt clip for TK 2260 3260 Soft leather case for TK 2260 3260 Enhanced staff safe function software upgrade for TK 2260 3260 Programming interface cable for TK 2260 3260 Programming software Windows for TK 2260 3260 Serial to USB adapter with drivers for TK 2260 3260 KENWOOD REPEATERS amp ACCESSORIES TKR 750E TKR 850E KMC 9C KMC 30 KPG 46A KCT 53U KPG 91D TKR 751E TKR 851E TKR 851E3 KMC 30 KMC 9C KPG 46A KCT 53U KPG 91D VHF repeater 16ch 25 50W 146 174MHz 12 5 25KHz channel spacing Listed 1476 60 UHF repeater 16ch 25 50W 440 470MHz 12 5 25KHz channel spacing Listed 1476 60 Control station desktop microphone for TK 750 780 Hand microphone standard for TK 750 780 PC interface cable for TKR 750 780 Serial to USB adapter with drivers for TK 750 780 Programming disc for TKR 750 780 VHF repeater 16ch 1 25W 146 174MHz 12 5 20 25KHz channel spacing Listed 1476 60 UHF repeater 16ch 1 25W 440 470MHz 12 5 20 25KHz channel spacing Listed 1476 60 UHF repeater 16ch 1 25W 400 430MHz 12 5 20 25KHz channel spacing Listed 1476 60 Hand microphone standard for TK 751 781 Control station desktop microphone for TK 751 781
141. 0W Super compact auto antenna tuner 200W PEP Remote mobile auto antenna tuner 200W remote auto tuner with power injector Basic 200W compact auto antenna tuner 55 95 111 95 99 95 129 95 101 95 289 95 32 95 55 95 37 95 81 95 102 95 42 95 42 95 102 95 42 95 101 95 85 95 67 95 174 95 219 95 85 95 92 95 131 95 141 95 152 95 67 95 84 95 29 95 121 95 63 95 74 95 119 95 159 95 63 95 74 95 99 95 154 95 149 95 209 95 99 95 99 95 99 95 129 95 149 95 119 95 109 95 109 95 127 95 77 95 125 95 149 95 102 95 69 95 48 95 48 95 32 95 26 95 39 95 76 95 32 95 84 95 32 95 29 95 33 95 32 95 27 95 66 95 98 95 199 95 98 95 159 95 259 95 259 95 203 95 Compact 200W 1 8 30MHz coax or random wire auto antenna tuner needs MFJ 5114 cable 219 95 Artificial ground 1 8 30MHz HF Basic loop tuner 3 5 30MHz 150 Watts Artificial ground and MFJ 941E HF ATU all in one box Portable Home base multiband Loop Antenna Tuner Tx Rx 40 10m 150W Heavy duty home base multiband Loop antenna Tuner Tx Rx 40 10m 150W Plug and play compact HF autotuner 200W 1 8 30MHz includes Icom cable Plug and play compact HF autotuner 200W 1 8 30MHz includes Kenwood cable Plug and play compact HF autotuner 200W 1 8 30MHz includes Yaesu cable 1 8 30 MHz antenna tuner 300 Watts
142. 1 95 34 95 33 95 33 95 9 95 29 95 28 95 49 95 15 95 11 95 48 95 22 95 66 95 175 95 17 95 22 95 99 95 69 95 45 95 69 95 69 95 12 95 37 95 22 99 32 99 14 95 14 95 14 95 14 95 14 95 28 95 10 95 29 95 167 95 141 95 124 95 157 95 209 95 219 95 304 95 494 95 187 95 167 95 182 95 186 95 234 95 209 95 46 95 85 25 159 95 124 95 72 55 KSC 24T Rapid rate desk top charger for TH K2 4 PB 43N Spare 7 2v 1100 mAh Ni MH battery for TH K2 4 BT 14 Dry cell case for TH K2 4 6 x AA cells EMC 3 Clip microphone with earpiece for TH K2 4 EMC 6 Clip microphone with D type earpiece for TH K2 4 EMC 12 Clip microphone with D type earpiece for TH K2 4 HMC 3 Headset boom microphone for TH K2 4 KHS 21 Headset boom mic less VOX for TH K2 4 KHS 29F Boom microphone with D type earpiece and PTT for TH K2 4 SMC 32 Speaker mic for TH K2 4 SMC 33 Speaker mic with 3 functions for TH K2 4 SMC 34 Speaker mic with 3 functions and Vol control for TH K2 4 PG 2W DC cable 1 x bare end for TH K2 4 PG 3J Filtered cigarette lighter DC cord for TH K2 4 PG 4Y PC interface cable D Sub 9 pin for TH K2 4 KCT 53U Serial to USB adaptor with drivers SC 53 Leatherette case for TH K2 4 WR 2 Water resistant bag for TH K2 4 J29 0709 14 Spare belt clip for TH K2 4 T90 1019 25 Spare UHF rubber duck aerial for TH K4E T90 1018
143. 108 W 30 W 50 W 300 W 2000 W 70PLUS W 50PLUS WBA 20 WBD 40 W 32DD WMD 50 WBV 60 WPN 97 WAN 97A WJ 2 WJ 4 WS BASE WS DESKTOP WATSON HANDHELD ANTENNAS W 901 WSMA 901 WSMA 901L WSMA 450 WDB 32 WSMA 7000 WHX 7000 WHSM 270 WHXX 270 WRSMA 270 WSMA 801 W 801 WSMA 881 W 881 WSMA 889 W 889 TW 7030 WRH 169 W 2002 WSW 2 SCAN FORCE PL SCAN FORCE TOP SCAN FORCE TELE ACLA X MKII X WBN X WPL X W38 125 SMA S 125 SMA L 12 SPrrrrrrrrrrr gt gt oo Ss 22 Amp continuous 25 Amp peak switch mode mini size power supply variable volts with noise offset 40 Amp continuous 45 Amp peak switch mode varialble volts supply with V amp A meters amp noise offset 60 Amp continuous 65 Amp peak switch mode varialble volts supply with V amp A meters amp noise offset 30 Amp continuous switch mode power supply 25 Amp continuous switch mode power supply 120 240V 10 Amp continuous switch mode power supply Plate to make SEC power supply in to 19 rack mount 12 Amp switch mode DC DC convertor 24V to 12V 20 Amp switch mode DC DC convertor 24V to 12V Spare charger psu for any Yupiteru Handheld 5 Amp cont 7 Amp peak fixed voltage power supply 7 Amp continuous 10 Amp 50 duty cycle 12 Amp peak variable power supply V A meter Switch mode DC DC convertor 7 plugs 1 5 3 4 5 6 7 5 9 12V out 11 30V in 12V car adaptor lead set cigarette lighter plug to choice of 6 plugs 12V DC lead 3m long C W 2 x 15A fuses f
144. 12Q Handheld speaker microphone for Quansheng 2 pin 12 95 G UV2 PROG Programming cable and software for TG UV2 19 95 G UV2 SCRAM Voice scrambler unit for TG UV2 12 95 TG UV2 ANT Spare antenna for TG UV2 9 95 G UV2 LANYARD Spare lanyard for TG UV2 3 95 TG UV2 MANUAL Spare user instruction book for TG UV2 4 95 G UV2 ELEM Battery eliminator for TG UV2 battery case and cable 9 95 G UV2 CAR Car charger for TG UV2 hod and cable 9 95 G UV2 BATT Spare Battery for TG UV2 DC 7 2V 2000mAh Li ion 14 95 G UV2 CASE Leather case for TG UV2 9 95 G UV2 AC Spare mains charger for TG UV2 hod and PSU 9 95 G UV2 CBC Spare belt clip for TG UV2 3 95 SMA SMA Adaptor SMA socket to SMA socket 3 95 WCN 2 Adaptor SMA socket to BNC socket 4 95 WCN 4 Adaptor SMA socket to SO 239 5 95 WCN 9 Adaptor SMA socket to N socket 4 95 RADIOCOM TELECOMUNICACAO LTDA ALEX LOOP HF loop antenna 7 bands 40 30 20 17 15 12 10m 1m diameter 20W 349 95 RADIO WORKS SL 80 Super Loop 80 10m inc WARC bands 1 5KW 112 long 30 high 4dB gain 149 95 SL 40 Super Loop 40 10m inc WARC bands 1 5KW 56 long 16 high 4dB gain 134 95 CW 160 Carolina Windom 160 10m inc WARC bands 252 feet long 76 8m 189 95 CW COMPACT 160 Carolina Windom 160 6m inc WARC bands 134 feet long 40 5m 1500W cw ssb 179 95 CWS 160 Carolina Windom 160 10m inc WARC bands 133 feet long 40 5m 149 95 CW 80 Carolina Windom 80 10m inc WARC bands 133 feet long 40 5m 1500W cw ssb 159 95 CW COMPACT 80 Carolina Windo
145. 13 30MHz 1 5kW 39 longest element N plug LP 1010A Log periodic 10 30MHz 1 5kW 48 longest element PL 259 plug LP 1010AN Log periodic 10 30MHz 1 5kW 48 longest element N plug TH 6 10 15 20m rotatable dipole 26 feet long 1 5KW TH 11DX 10 12 15 17 20m beam 4kW 24 boom 11 elements DB 1015 10 15m beam 1 5kW 14 boom 7 elements DB 1217 12 17m beam 1 5kW 14 boom 7 elements EXP 14 10 15 20m beam 1 5kW 14 boom 4 elements TH 2MK3 10 15 20m beam 1 5kW 6 boom 2 elements TH 3JRS 10 15 20m beam 600W 12 boom 3 elements TH 3MK2 10 15 20m beam 1 5kW 14 boom 3 elements TH 5MK2 10 15 20m beam 1 5kW 19 boom 5 elements TH 7MK2 10 15 20m beam 1 5 kW 24 boom 7 elements QK 710 30 40 m kit for EXP 14 DP 19PD 160 to 10m dipole DP 2BDQ 80 amp 40m dipole 101 long DP 5BDQ 80 to 10m dipole 94 long HYGAIN VHF UHF ANTENNAS DB 218SAT Complete 2m 70cm antenna system DB 2345 2m 70cm dual band yagi VB 216SAT Oscar link 16 element beam 144 148MHz 200W 13 7dBi gain VHB 246 Tri band beam 6m 2m 70em FB 217SAT Crossboom assembly UB 7030SAT Oscar link 30 element beam 432 438MHz 200W 16 2dBi gain UB 7031DX 70cm 31 element beam 2kW N type GPG 1 1 4 wave ground plane unity gain 100W 162 174MHz GPG 1B 2m 1 4 wave ground plane unity gain 100W 144 148MHz GPG 2B 2m 5 8th wave ground plane 3 2dBi gain 100W 4 long 142 185MHz V 2R 2m VHF vertical 5 2dBi gain SO 239 500W 9 long 138 175MHz V 2PRO VHF commercial vertical aerial 150 175MHz V 4R 70cm vertical 5 2dB
146. 14 95 20 95 10 95 10 95 15 95 21 95 21 95 10 95 28 95 46 95 4 95 41 95 98 95 18 95 8 95 399 95 14 95 51 95 21 95 18 95 11 95 11 95 PPPO DWrrrraoarrraranarraoaarror Tr FPrPmrorrorrrrrrTrrTraoaranngaraoroaoroaoFrFrranono gt s eC Te De CU E ee ee oe oD rorrrrroror rFrrraoaraoarraoarrorrrrrrrry SP 13 CT 17 CS R20 SM R20 FA BO4RE 0001 R3 016 Earphone for IC R20 RS 232 computer interface for IC R20 Cloning software amp USB cloning cable for IC R20 Service manual for IC R20 Spare aerial for IC R20 Spare battery spacer to enable dry cells to be used ACCESSORIES FOR IC R2500 R1500 001 BC 1A CP 12L OPC 254 OPC 254L OPC 1156 UT 106 UT 108 UT 118 SP 10 SM 1500 2500 1C R8500 AD 55 AH 8000 R 293 L 52A B 12 1 B 23 PC 023C S 8500 P 21 M R8500 R9500 AT P 20 122 BLO ZZTO CHQ ICOM AIRBAND IC A110 EURO MBR 100 OPC 346 OPC 478 OPC 591 OPC 592 OPC 871 SM 25 HM 152 HM 152T HM 161 PS 1508 001 PS 1508 002 CSA 110 SM A110 IC A24PRO IC A24SPORT IC A6PRO IC A6SPORT AD 104 BC 110 BC 119N 209 11 BC 121N 209 11 BC 144N BC 145 BC 157 CP 20 BP 208N BP 210N FA BO2AR LC 159 MB 103 MB 86 MB 96N MB 96F OPC 478UC OPC 499 OPC 656 HM 173 CS A24 SM A24 A6 Head control unit Spare AC adaptor for IC R2500 Cigarette lighter cable with noise filter for IC R2500 DC power cable 1 end bare wires straight plug for IC PCR250
147. 166 BC 122 BC 123E BC 149D BC 155 BC 164 BC 167D BCM1V BELT 003 BELT 010 BELT 013 BM 103 BM 112 E BP 170 BP 200L BP 215 BP 243 CASE 038 CASE 040 CASE 043 CASE 045 CASE 046 CASE 047 CM 167 CIGAR 001 CP 12 CP 12L CP 13 CP 21LR CR 282 CR299 CS E7 CS R2 CS R5 CS R10 CS V8 CS 2725 CS 2800 CS E208 CS F31GS CS F40G MT DSESOFT 001 EM 80 EM 89 EX AIR 169 003 FA BO1AR FA B02RE 001 FA SC54V FA SC56U FA S6270 001 FA S6270A FL 100 FL 103 FL 132 FL 133 FL 223 F 34 HM 100TN HM 103 HM 112 HM 157B HM 166PL Antenna connector for IC F4GS Mic socket Front panel Rubber Keypad Keypad 44 Volume button Set of accessory screws for IC F6022 Volume knob for IC F51 61 Mic socket 645000680 4030011600 for IC F110S 2030000150 for IC F110S Channel button Channel switch volume Lithium lon battery BP 252 and BC 162 charger and DC unit for IC M21 31 33 35 Knob uning volume control pot Loud speaker connector Ip ear panel for IC 4088 n OFF volume pot Volume pot for IC FD44 annel switch for IC F34G 44G PA unit for IC F110 F110S UHF 1 4 wave helical aerial 430 472MHz for F3 F12 F15 F41 etc BNCJ Spare microphone hanger for mobile radio Spare screw for M401 011 Volume knob for IC F34G F25 DC cable Battery charge adaptor for BP 160 157A 130A 174 Adaptor for BC 119 121 for BP 130A 160 174 Battery charge adaptor for CM 140 141 142 Battery charge adaptor for CM 138 139 165 BC 119 121 adaptor pod for BP 198 200
148. 174MHz coded black for GP 320 340 360 380 6 95 A PMAE4002 UHF 9cm antenna 403 433MHz coded green for GP 320 340 360 380 9 95 A RLN4762 Comfortable ear insert right large for GP 320 340 360 380 needs 1 x NTN8371 amp 1 x discrete acc 18 95 A KEN GODWIN PMR ANTENNAS FOR PMR PA 126 UHF 5 8th wave mobile whip 415 470MHz 4 5dBd gain 450mm long 20 95 A PA 195 VHF Low band base loaded mobile whip 68 88MHz 0dB gain 600mm long 31 95 A PA 129 VHF High band 5 8th wave mobile whip 146 170MHz 3dB gain 1350mm long 23 95 A PA 139 VHF High Band 1 4 wave mobile whip 140 200MHz 2 15dBi gain 620mm long 6 95 A PA 140 VHF Low band 1 4 wave mobile whip 68 88MHz 2 15dBi 1230mm long 11 95 A PA 143 VHF Low band base loaded mobile whip 68 88MHz 600mm long 39 95 C PA 157 VHF Low band spring loaded mobile whip 68 88MHz 1330mm long 21 95 A PA 159 VHF High band 1 2 wave mobile whip 140 200MHz centre loaded 2 2dBi 500mm 25 95 A PA 162 UHF 1 2 wave over 1 4 wave mobile whip 380 470MHz 4 5dBi gain 788mm long 28 95 A PB 146 Body mount with 5m coax for PA aerials 18 95 C PB 143 Heavy duty magnetic mount with cone and 5m coax for PA aerials 31 95 C PB 144 Trunk lip mount with 5m coax for PA aerials 20 95 A PA 2266 UHF base colinear aerial 440 470MHz 3dBd gain 1 6m long 129 95 D PA 2263 VHF High band base colinear aerial 166 175MHz 3dBd gain 3 1m long 149 95 D CATC 170 VHF High band base colinear aerial 163 174MHz N socket 3dBd gain 2 63m long 2
149. 1V IC F61V AD 100 BC 01 BC 119N F51 61 BC 121N F51 61 BC 145 BC 152 BC 157 BC 190 UK BC 190 EU CP 23L BP 226 BP 227 FA S24V FA S59V FA S62VS FA S63VS HM 168 HM 169 HM 170GP HM 138 HS 94 HS 95 HS 97 VS 1SC MB 86 MB 98 MB 96F MB 96N OPC 515L OPC 656 OPC 966 OPC 966U CS F51 61 SM F51 62 IC F51 ATEX IC F61 ATEX BP 227AX FA S24V FA S27U FA S59V FA S63VS FA S57US HM 138 MB 86 MB 98 AD 100 BC 01 BC 119N F51 61 BC 121N F51 61 BC 145 Earphone microphone Headset ear piece type Headset neck arm type needs VS 1L Earphone with throat mic Swivel belt clip Spare belt clip Fixed type leather non swing belt hanger for use with MB 94 Fixed type leather non swing belt hanger for use with N batteries Cloning cable PC to transceiver Cloning cable for radio to PC USB cable DC cable 12 20V for BC 121N DTMF decoder unit Scrambler unit inversion for IC F3022 4022 Scrambler unit inversion and rolling for C F3022 4022 Man down unit VOXIPTT unit right angled plug Programming software for IC F3022 4022 Service manual for C F3022 4022 PMR VHF 136 174MHz BC 160 BC 145 BP 231 MB 94 aerial PMR VHF 136 174MHz BC 160 BC 145 BP 231 MB 94 aerial keypad PMR UHF 400 470MHz BC 160 BC 145 BP 231 MB 94 aerial PMR UHF 400 470MHz BC 160 BC 145 BP 231 MB 94 aerial keypad Charger adaptor for BC 119N 121N and BP 230 231 232 Spare mains PSU for BC 119N Fast charger includes AD 106 amp BC 145 6 way
150. 1XLR BLK with GOLD grille Professional large diameter dynamic kick drum microphone 3 pin XLR needs CC 1XLR 144 95 99 95 119 95 189 95 169 95 109 95 129 95 199 95 199 95 139 95 249 95 249 95 249 95 249 95 259 95 289 95 369 95 369 95 369 95 229 95 219 95 259 95 H Microphone kit for drum set featuring the PR 22 Microphone kit for drum set featuring the PR 22 e Fin PR 20 element chrome with BLUE LED 3 pin XLR needs CC 1XLR e FIN PR 20 element satin black body with BLUE LED 3 pin XLR needs CC 1XLR e FIN PR 20 element chrome with RED LED 3 pin XLR needs CC 1XLR e FIN PR 20 element chrome with WHITE LED 3 pin XLR needs CC 1XLR e FIN PRO 20 element Black body with RED LED needs CC 1XLR e FIN PRO 20 element black body with BLUE LED needs CC 1XLR e FIN PRO 20 element black body with WHITE LED needs CC 1XLR Handy mic with cardoid broadcast element no PTT PRO PLUS 3 pin XLR needs CC 1XLR Dual sided professional headphones 10Hz to 22KHz 32 Ohms Leatherette travel bag for PRO SET 3 Drum microphone mount Desk top flush mount Flange mount for Heil boom Superior balanced ROAD CASE ha ROAD CASE hard carry case for PR 40 amp PR 780 12 Riser Small adjustable microphone boom Shock mount assembly 1 for GM iCM HM PR 20 Standard mic clip for PR 30 PR 40 PR 35 mic clip Shock mount assembly 2 for PR30 amp PR40 black S
151. 2 15 17 20m 2 elements MQ 26 with enhanced reflector Mini beam 6 10 12 15 17 20m 3 elements MQ 26SR with director Replacement driven coil with spokes for MQ 26 MQ 26SR MQ 36SR Replacement reflector coil with spokes for MQ 26 MQ 26SR MQ 36SR Spare cross arm bracket Upgrade kit MQ 1 to MQ 3 Upgrade kit MQ 2 to MQ 4 Upgrade kit R 246 to B 246 director kit Upgrade kit R 246 to B 246 with 6m kit Upgrade MQ 1 to MQ 24SR reflector kit Upgrade MQ 24SR to MQ 34SR director kit Upgrade MQ 1 to MQ 34SR reflector director kit Upgrade MQ 26 to MQ 26SR reflector kit Upgrade MQ 26SR to MQ 36SR director kit Upgrade MQ 26 to MQ 36SR reflector director kit Upgrade MQ 3 to MQ 34SR reflector kit Upgrade MQ 2 to MQ 4SR reflector director kit original version coils Transmitter only CW only 135 7 137 8KHz 50 100W out SO 239 13 8V SignaLink USB SignaLink USB SignaLink USB SignaLink USB SignaLink USB SignaLink USB SignaLink USB SignaLink USB SignaLink USB SignaLink USB SignaLink USB Signal ink USB Sound Card Signal ink USB Sound Card SignaLink USB ra radio cabl ra radio cabl ra radio cabl ra radio cabl ra radio cabl ra radio cabl ra radio cabl ra radio cabl ra radio cabl ra radio cabl ra radio cabl ra radio cabl mmmmmmmmmm mm Plug and play jumper mot Plug and play jumper modi Plug and play jumper mod Plug and play jumper modi Plug and play jumper mod Plug and play jumper mot Plug and play jumper mod Plug
152. 200 and G 1000DXC MTU 160 RF tuning unit A 160m band unit for FT DX1200 MTU 80 40 RF tuning unit B 80 40m band unit for FT DX1200 MTU 30 20 RF tuning unit C 30 20m band unit for FT DX1200 RF UTUNEKIT Base platform for MTU 160 80 40 30 20 DVS 6 Voice memory unit for FT DX1200 FFT 1 FFT unit for FT DX1200 SCU 17 USB interface unit for FT DX1200 FC 40 External automatic ATU with 200 memories for end fed wire or long whip and FT DX1200 FH 2 Y Remote keypad for FT DX1200 FT 991 HF 6m 2m 70cm all mode transceiver 100W MD 200A8X Desk microphone for FT 991 MD 100A8X Desk microphone for FT 991 MH 31A8J Spare hand mic for FT 991 MH 36E8J DTMF hand microphone for FT 991 YH 77STA Open air type stereo headphones for FT 991 ATAS 120A Active tuning mobile aerial for FT 991 ATBK 100 Antenna base kit for ATAS 120 ATAS 25 Manual tuning mobile aerial for FT 991 FC 40 External automatic ATU with 200 memories for end fed wire or long whip and FT 991 CT 39A Packet interface cable for FT 991 MMB 90 Mobile mounting bracket for FT 991 FH 2 Y Spare remote keypad for FT 991 FT 450D HF 6m 100W auto ATU 300Hz CW IF filter built in voice module MD 200A8X Desk microphone for FT 450 MD 100A8X Desk microphone for FT 450 MH 31A8J Spare Hand mic for FT 450 MH 36E8J DTMF hand microphone for FT 450 MLS 100 High Power external speaker for FT 450 YH 77STA Open air type stereo headphones for FT 450 ATAS 120A Active tuning mobile aerial for FT 4
153. 2000 Programming software for GX 2000 Programming cable side to side for GX 2000 Programming cable PC side for GX 2000 VHF DSC fixed marine transceiver Black VHF DSC fixed marine transceiver White Flush mount bracket for GX 1600 RAM plus microphone for GX 1600 Black RAM plus microphone for GX 1600 White Rubber cover for CMP30B and VH 310 socket for GX 1600 Microphone clip hanger for CMP30B for GX 1600 99 95 8 95 11 95 11 95 35 95 23 95 59 95 28 95 13 95 8 95 1 95 1 95 1 95 6 95 29 95 9 95 6 95 9 95 41 95 48 95 224 95 35 95 23 95 59 95 28 95 25 95 8 95 11 95 11 95 11 95 16 95 29 95 9 95 6 95 9 95 41 95 23 95 m Ph rh PD 329 95 329 95 8 95 99 95 99 95 2 95 1 95 43 95 12 95 109 95 28 95 31 95 33 95 42 95 49 95 6 95 41 95 18 95 38 95 199 95 199 95 8 95 99 95 99 95 2 95 1 95 43 95 12 95 109 95 28 95 31 95 33 95 42 95 49 95 6 95 41 95 18 95 38 95 159 95 159 95 8 95 99 95 99 95 2 95 1 95 E C3 e eC P L C3 C3 EC C C1 E Te e T E C C3 PC rC C3 CTC C1 E e e e C3 C rC C1 CTC H POPE h C1 C3 C3 fe ICO C C3 CTC EC C3 CC e C3 C CTC EET CEE CT C3 CTC r PPO CT C3 C1 C3 8101512 CT 100 MLS 300 MLS 310 792023306 RA1283200 RA0978600 HC 1600 CE 123E CT 99 CT 62 GX 1500E BK GX 1500E WH VH 310 MMB 8
154. 201 3301 69 95 KHS 8BL 2 wire palm microphone kit for TK 3201 3301 47 95 KHS 9BL 3 wire mini lapel microphone kit for TK 3201 3301 91 95 KMC 21 Palm size speaker microphone for TK 3201 3301 50 95 KMC 45 Speaker microphone for TK 3201 3301 33 95 KCT 53U Serial to USB adapter with drivers for TK 3201 3301 61 95 KPG 22A PC programming interface cable for TK 3201 3301 48 95 KPG 121DE PC programming software for TK 3301 39 95 UBZ LJ8BE Funky446 PMR 446 handheld transceiver black 75 95 UBZ LJ8YE Funky446 PMR 446 handheld transceiver yellow 75 95 UBZ LJ8SLE Funky446 PMR 446 handheld transceiver silver 75 95 UBC 4E Single unit charger for UPB 5N for UBZ LU8 16 95 UPB 5N Rechargeable Ni MH battery for UBZ LJ8 15 95 UBC 4HT Single unit charger for UPB 1 for UBZ LJ8 16 95 UPB 1 Rechargeable Ni Cd battery for UBZ LJ8 15 95 USC 11 Carrying case mainly transparent plastic for UBZ LU8 1 95 KENWOOD HF TRANSCEIVERS TS 990SE HF 6m 5 200W dual TFT display dual RX PSU ATU SSB CW FSK PSK FM AM COM LAM port USB A B 5599 95 D TMRF TS990KPC External keypad for TS 990S to enable easy use of the 8 user definable functions 54 95 MC 43S Dynamic hand microphone with up down 8 pin plug for TS 990S 20 95 MC 47 Hand microphone with 4 programmable buttons for TS 990S 42 95 MC 60A Dual impedance desk microphone with internal pre amplifier for TS 990S 127 95 MC 90 Desk microphone for DSP transceivers for TS 990S 204 95 SP 990M External s
155. 23 2x AA dry cell case for VX 6E FNB 80LI Spare 7 4V 1300mAh lithium ion battery pack for VX 6E MH 57A4B Speaker microphone for VX 6E VC 27 Earpiece microphone for VX 6E VC 24 Vox headset for VX 6E MH 73A4B Waterproof speaker microphone for VX 6E PA 48U Spare charger for VX 6E 3 pin UK new style PA 48C Spare charger for VX 6E 2 pin EU new style SU 1 Barometric Pressure Sensor Unit for VX 6E RA0649900 Spare belt clip for VX 6E YHA 67 Spare aerial for VX 6E FT 60E 2m 70cm 5W handheld transceiver wide band receive CT 27 Cloning cable for FT 60E CN 3 Antenna connector adaptor SMA BNC for FT 60E CT 44 Microphone adaptor for FT 60E FBA 25A Dry cell case for FT 60E 6 x AA cells SDD 13 Cigar lighter DC cable for FT 60E E DC 6 External DC cable for FT 60E FNB 83 Spare NiMH battery pack for FT 60E 1400mAh CD 47 Desktop rapid charger with hod to hold the complete radio needs PA 43 PA 43U PSU for CD 47 and FT 60E 3 pin UK PA 43C PSU for CD 47 and FT 60E 2 pin Euro MH 34B4B Speaker microphone for FT 60E MH 37A4B Earpiece microphone for FT 60E VC 25 VOX headset for FT 60E NC 88C Spare charger for FT 60E 2 pin EU old style PA 48U Spare charger for FT 60E 3 pin UK new style PA 48C Spare charger for FT 60E 2 pin EU new style VAC 370U Rapid charger for FT 60E only Includes PA 23U 3 pin UK VAC 370C Rapid charger for FT 60E only Includes PA 23C 2 pin EU PA 23U Spare power supply for VAC 370U 3 pin UK PA 23C Spare pow
156. 2312 3312E Headset with VOX PTT for TK 2312 3312E Over the head heavy duty headset with boom microphone for TK 2312 3312E Headset boom mic less VOX for TK 2312 3312E Headet with PTT for TK 2312 3312E Boom microphone with D type earpiece and PTT for TK 2312 3312E Single headset with boom microphone no PTT for TK 2312 3312E Single headset with boom microphone with PTT for TK 2312 3312E 2 wire palm microphone kit for TK 2312 3312E 3 wire mini lapel microphone kit for TK 2312 3312E Palm size speaker microphone for TK 2312 3312E Speaker microphone for TK 2312 3312E Programming interface cable serial for TK 2312 3312E Serial to USB adapter with driversfor TK 2312 3312E Programming interface cable USB for TK 2312 3312E Programming software Windows for TK 2312 3312E VHF handy 136 174MHz 12 5 20 25KHz 1 5W 16 CH needs aerial battery charger TK 2360ECPS5L6M2T VHF handy 136 174MHz 12 5 20 25KHz 1 5W 16 CH KNB 55L KRA 26M2 KSC 25T TK 2360ECP5L2M2T VHF handy 136 174MHz 12 5 20 25KHz 1 5W 16 CH KNB 55L KRA 22M2 KSC 25T VHF handy 136 174MHz 12 5 20 25KHz 1 5W 16 CH KNB 55L KRA 26MN needs charger VHF handy 136 174MHz 12 5 20 25KHz 1 5W 16 CH KNB 55L KRA 22M2 needs charger UHF handy 400 470MHz 12 5 20 25KHz 1 4W 16 CH needs aerial battery charger UHF handy 400 470MHz 12 5 20 25KHz 1 4W 16 CH KNB 55L KRA 27M KSC 25T UHF handy 400 470MHz 12 5 20 25KHz 1 4W 16 CH KNB 55L KRA 23M KSC 25T UHF handy 400 470MHz 12 5 20 25KHz 1 4W 16 CH KNB 5
157. 26B fist microphone AIS grey ransceiver fixed DSC VHF with HM 126B fist microphone AIS GPS black ransceiver fixed DSC VHF with HM 126B fist microphone AIS GPS grey ransceiver fixed DSC VHF with HM 162 fist microphone AIS black ransceiver fixed DSC VHF with HM 162 fist microphone AIS grey ISi ISi ISi ISi IC M505 BK AIS 162 GPS Transceiver fixed DSC VHF with HM 162 fist microphone AIS GPS black IC M505 GY AIS 162 GPS Transceiver fixed DSC VHF with HM 162 fist microphone AIS GPS grey HM 126B HM 162E MB 75 OPC 478 OPC 478UC OPC 1541 OPC 980 UT 112 GPS ANT CS M505 SM M505 IC M603 IC M603 GPS IC M603 162 IC M603 162 GPS IC M603 AIS IC M603 AIS GPS IC M603 AIS 162 Remote control hand microphone standar Remote control hand microphone COMMANDMIC 3 Flush mount kit Cloning cable PC to transceiver Cloning cable for radio to PC USB cable Extension cable for HM 162B SW E 6m long 20 feet for IC M505 Cloning cable adaptor Voice scrambler unit with 32 codes GPS antenna Programming software for IC M505 on CD ROM Service manual on CD ROM for IC M505 Waterproof VHF DSC marine transceiver with HM 126B Waterproof VHF DSC marine transceiver with HM 126B GPS Waterproof VHF DSC marine transceiver with HM 162 Waterproof VHF DSC marine transceiver with HM 162 GPS Waterproof VHF DSC marine transceiver with HM 126B AIS Waterproof VHF DSC marine transceiver with HM 126B AI
158. 2dBi gain 14MHz OWA HD yagi 9 8m long 5kW 8 87dBi gain 14MHz OP DES L yagi 15 55m long 5kW 10 70dBi gain comes in 2 boxes 14MHz OWA HD yagi 15 7m long 5kW 10 34dBi gain comes in 2 boxes 14MHz OP DES yagi 17m long 5kW 11 01dBi gain comes in 2 boxes 14MHz OP DES L yagi 19 95m long 5kW 11 32dBi gain comes in 2 boxes 14MHz OWA HD yagi 21 1m long 5kW 11 16dBi gain comes in 2 boxes 18MHz LFA yagi 4 95m long 5kW 8 53dBi gain 18MHz OP DES yagi 6 36m long 5kW 9 51dBi gain 18MHz LFA yagi 12 70m long 5kW 10 48dBi gain comes in 2 boxes 18MHz LFA yagi 17 70m long 5kW 11 36dBi gain comes in 2 boxes 21MHz OP DES yagi 2 7m long SkW 7 44dBi gain 21MHz OP DES yagi 5 42m long 5kW 9 01dBi gain 21MHz OP DES yagi 6 2m long 5kW 9 12dBi gain 21MHz OP DES I yagi 8 4m long 5kW 10 17dBi gain 21MHz OP DES yagi 11 3m long 5kW 11 1dBi gain comes in 2 boxes 21MHz OPO DES yagi 17 7m long 5kW 12 13dBi gain comes in 2 boxes 24MHz yagi 3 9m long 5kW 8 49dBi gain 24MHz yagi 4 99m long 5kW 8 97dBi gain 24MHz yagi 5 534m long 5kW 8 99dBi gain 24MHz yagi 9 22m long 5kW 10 48dBi gain 24MHz LFA yagi 12 9m long 5kW 11 36dBi gain comes in 2 boxes 24MHz OP DES yagi 15m long SkW 12 13dBi gain comes in 2 boxes 27MHz OP DES yagi 1 24m long 5kW 5 41dBi gain 27MHz LFA2 yagi 1 45m long 5kW 6 55dBi gain 27MHz OP DES yagi 2 2m long 5kW 7 47081 gain 27MHz LFA yagi 3 3m long 5kW 8 48dBi gain 27MHz OP DES yagi 5 34m long 5kW 9 36dBi gain 27MHz LFA yagi 5 45m long 5kW 9 38dBi
159. 3 95 15 95 7 95 24 95 19 95 11 95 11 95 39 95 39 95 62 95 64 95 66 95 66 95 69 95 73 95 134 95 80m resonant end fed approx 44m long 150W PEP c w mounting insulator support cord ties balun amp tape 151 95 Kit for pole mounting a mobile 6 2 70 23 aerial for use as a base station Long wire balun for shortwave receiving station 20m 300 Ohm ribbon ladder line feeder 20m 450 Ohm ribbon ladder line feeder 50m enamelled copper wire 50m hard drawn copper wire 50m flexweave multi stranded copper wire 50m clear PVC coated multi stranded copper wire 50m genuine Copperweld copper clad steel 55 3 5mm alloy wire weighs only 400g ideal for G5 RV etc Half size G5RV 40 20 15 10m ultra light alloy element 450 Ohm ladder HF vertical antenna 250W SO 239 aluminium 7 13m long HF vertical antenna 250W SO 239 fibreglass 7 13m long Full size G5RV with 300 Ohm ladder Half size G5RV with 300 Ohm ladder Double size with 300 Ohm ladder 80 40 20 15 10m dipole kit 102 long 40 20 15 10m HF dipole kit 51 long 80m add on inductors kit for adding 80m to 1 2 size G5 RV Tension springs stainless steel for any G5 RV 1 30MHz Rx dipole 8 5m long plus 10m coax feeder with PL 259 Long wire antenna kit for shortwave receiver 50m 10m feeder Long wire antenna kit for shortwave receiver 25m 10m coax built in long wire balun Portable HF VHF UHF aerial 100KHz 1300MHz BNC 1 1 50 Ohm balun 400 Watts for wire dipoles or in
160. 3 Lead between SAFE 2 WAY amp Yaesu large modular RJ 45 amp DC lead YAE 104 Lead between SAFE 2 WAY amp Yaesu large modular RJ 45 YAE 107 Lead between SAFE 2 WAY amp Yaesu 8 pin round needs VDC 101 2 ALI 102 Lead between SAFE 2 WAY amp Alinco Modular RJ 45 needs VDC 101 2 WATSON SPEAKER MICROPHONERS U 120Y Handheld speaker microphone with lockable PTT amp volume control Alinco Yaesu lcom 2 pin QS 112Y Handheld speaker microphone for Alinco Yaesu Icom 2 pin QS 112Y4S Handheld speaker microphone for single plug 4 pole type screwed QS 112Y4 Handheld speaker microphone for single plug 4 pole QS 112K Handheld speaker microphone for Kenwood 2 pin QS 112W Handheld speaker microphone for Wouxun 2 pin QS 112E Handheld speaker microphone for Elecraft KX3 single pin 4 pole QS 112Q Handheld speaker microphone for Quansheng 2 pin QS 112GP Handheld speaker microphone for Motorola GP 320 340 etc QS 112M Heavy duty Motorola handheld speaker microphone 2 pin WATSON EARPHONE MICROPHONES WAP 700K Lapel microphone with PTT and acoustic tube earpiece for Kenwood 2 pin WAP 700GP Lapel mic with PTT and acoustic tube earpiece for Motorola GP320 340 360 380 WAP 700M Lapel microphone with PTT and acoustic tube earpiece for Motorola 2 pin WAP 700Y Lapel microphone with PTT and acoustic tube earpiece for Alinco lcom Yaesu 2 pin WAP 700Y4 Lapel microphone with PTT and acoustic tube earpiece for Yaesu single plug 4 pole WAP 700Y4S Lapel mic
161. 300C VAC 300U VAC 6300C VAC 6300U VCM 2 MH 37A4B MH 45B4B MH 450S MH 360S VC 25 FVP 25 FVP 35 FVP 36 VME 100 LCC 351 LCC 351S LCC 354 LCC 354S CT 27 CT 42 FIF 10 CT 106 VX 350 CN 3 VX 414E 2 5 VX 417E 1 5 VX 417E 3 5 VX 424E 2 5 VX 427E 1 5 VX 427E 3 5 VX 427AE 3 5 ATV 8A ATV 8B ATV 8C ATU 6A ATU 6DS ATU 6C Handheld 16ch VHF 146 174MHz 5W no display Handheld 16ch UHF 440 470MHz 5W no display Handheld 16ch VHF 146 174MHz 5W limited keypad Handheld 16ch UHF 440 470MHz 5W limited keypad 134 151MHz helicoil 15cm RED for VX 160EV 180EV 150 163MHz helicoil 15cm BROWN for VX 160EV 180EV 161 174MHz helicoil 15cm BLACK for VX 160EV 180EV 400 430MHz whip 16cm BROWN for VX 160EU 480EU 450 485MHz stubby 8cm RED for VX 160EU 180EU 440 470MHz whip 16cm BLUE for VX 160EU 180EU 450 490MHz whip 16cm for VX 160EU 180EU NiMH battery pack for 1400mAh 7 2V for VX 160 180 NiMH battery pack for 1800mAh 7 2V for VX 160 180 Lithium lon battery 7 4V 2000mAh for VX 160 180 Desktop rapid charger for FNB 83 and FNB V94 230V 2 pin Euro plug Desktop rapid charger for FNB 83 and FNB V94 230V 3 pin UK plug Desktop rapid charger for FNB V67 230V 2 pin Euro plug Desktop rapid charger for FNB V67 230V 3 pin UK plug Multi unit charger for FNB 83 FNB V94 230V 2 pin Euro plug Multi unit charger for for FNB 83 FNB V94 230V 3 pin UK plug Multi unit charger for FNB V67 230V 2 pin Euro plug Multi unit charger for FNB V67 230V 3 pin UK plug Vehicle
162. 34 95 69 95 39 95 59 95 39 95 41 95 159 95 369 95 3 95 3 95 3 95 3 95 5 95 5 95 5 95 5 95 5 95 2 95 4 95 5 95 5 95 8 95 5 95 53 95 67 95 87 95 33 95 59 95 36 95 112 95 158 95 87 95 79 95 77 95 79 95 89 95 85 95 89 95 41 95 99 95 39 95 149 95 68 95 164 95 67 95 107 95 155 95 99 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 24 95 24 95 24 95 24 95 24 95 24 95 24 95 24 95 24 95 24 95 24 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 14 95 20 95 20 95 14 95 8 99 22 95 22 95 22 95 22 95 22 95 22 95 22 95 7 50 22 95 22 95 61 95 61 95 61 95 MDM MMMM MIMD mmm DD M TK e e e K e T K K T T K T T T K T T K T T K K T T K T T e K T T K T T T K T T T K T T K T T T e T T K K T T K T T T OH HOD OOO OOO OOO OHO T e K T T K K T T e T T T K O HHOH e O HC 5124Y3 5124Y4 5161 5162 5163 5164 5166 5184 5205 5208 5213 5220 5222 5224 5226 5262 5265 5268 53831 5383K 5383Y 5302 5393K 5393Y 5393MI 5393MK 5393MY 53961 5396K 5397K 5397Y 5397MX 5397MY 5398 5399Y 5399 5399Y2 5408 5409 5413 5414 5419 5420 5427 5428 5429
163. 39 95 139 95 139 95 139 95 139 95 39 95 119 95 119 95 5 95 13 95 145 95 3 799 95 349 95 189 95 149 95 32 95 159 95 1 759 95 1 949 95 54 95 19 95 249 95 139 95 139 95 139 95 139 95 139 95 39 95 145 95 149 95 32 95 85 95 349 95 189 95 999 95 139 95 43 95 999 95 85 95 OOO OOOOGOGOGOGOGO TK T T K T T T e T T K L T O gt o GODO KERZ T CTE OE3 C3 GOGO eZee oA eE OK OOO EOG OOOOOOOE K OOO O 2006 86095 OMNI VII 588 OMNI VII 588AT AT588K 2031 2032 302R 307B 317 4228 707 716 R9313 98619 712 940 715 RM 588 AT538K 310 302R 703 OP 538 86095 TEN TEC GENERAL ACCESSORIES TP TPB TPC 41 418 238C 3003 3004 6000VNA 306 318 TT 610 702 707 7071 707K 707 74 707 78 708A 709A 710 710A 711 712 115 115 115 HB 71578 116 720 72 777 777 777 777 74 717 18 80572 80573 86055 86095 86139 767 315B 315BL 315G 315LB 3150 315R 92468 1 35057 35363 R4020 R4030 R4040 R9410 R9411 R9902 R9903 R9904 R9905 R9906 R9907 RX 320D RX 340 REAB 340 OP RX340 RX 360 RX 331TCXO REAB 340 RX 400 TEN TEC KITS 1001 1051 1213 1215 1225 1320 1330 1340 1380 1550 1000A R 246 B 246 MQ 1 MQ 1W MQ 1W30 MQ 1 10 14 MQ 24SR Optional 700Hz CW filter for Argonaut Replacement 12V DC lead 2 pin
164. 39 95 34 95 24 95 23 95 99 95 19 95 16 95 479 95 99 95 34 95 24 95 24 95 79 95 34 95 23 95 14 95 9 95 69 95 29 95 16 95 32 95 16 99 29 95 16 95 99 95 9 95 11 95 11 95 359 95 34 95 24 95 24 95 79 95 34 95 23 95 14 95 9 95 69 95 29 95 16 95 32 95 16 99 29 95 16 95 35 95 29 95 22 95 124 95 99 95 79 95 9 95 14 95 25 95 59 95 23 95 62 95 64 95 69 95 14 95 26 95 17 95 36 95 17 95 32 95 14 95 78 95 134 95 rrarrasv FREESE K K KOK K OOO OOO aK OOO O KK KO K KOG OOO Oa TK T T T OF T O D K OD K OH T T T K T T OH T TOH T OH 3 C3 EA 1 A 11 1 A 11 1 Qa CD 40 Charge cradle for BH 1A BH 2 9 95 PA 46U Charger for CD 40 for BH 1A for FTM 10 3 pin UK new style 11 95 PA 46C Charger for CD 40 for BH 1A for FTM 10 2 pin Euro new style 11 95 CAB 1 Headset charger sleeve for BH 1 for FTM 10 9 95 MEK M10 Microphone jack for front panel for FTM 10 10 95 FEP 4 Ear phone for BH 1 for FTM 10 14 95 CT M11 External headset connection cable for FTM 10 24 95 MH 68A6J Waterproof DTMF hand microphone for FTM 10 45 95 MH 68B6J Waterproof hand microphone for FTM 10 37 95 MMB M11 Multi angle mounting bracket for FTM 10 29 95 MMB M10 Multi angle stand bracket for FTM 10 20 95 MLS 200 M10 High power external mobile type speak
165. 3V Earphone with boom mic PTT 4 contact single pole plug for Icom Yaesu Standard 24 95 EM 13S Earphone with boom mic PTT 4 contact single pole plug with screw for Yaesu Standard 24 95 EM 100M Acoustic earphone with throat mic PTT 2 pin plug for Icom Yaesu Standard Alinco 49 95 EM 100K Acoustic earphone with throat microphone PTT 2 pin plug for Kenwood 49 95 EM 100V Acoustic earphone with throat mic PTT 4 contact single pole plug for Icom Yaesu Standard 49 95 EM 100S Acoustic earphone throat mic PTT 4 contact single pole plug with screw for Yaesu Standard 49 95 EM 200M Eartalker earphone with built in mic PTT 2 pin plug for Icom Yaesu Standard Alinco 69 95 EM 200K Eartalker earphone with built in microphone PTT 2 pin plug for Kenwood 69 95 EM 200V Eartalker earphone with built in mic PTT 4 contact single pole plug for Icom Yaesu Standard 69 95 EM 200S Eartalker earphone with built in mic PTT 4 contact single pole plug with screw for Yaesu Standard 69 95 HE 67M Acoustic tube earpiece with straight 3 5mm mono jack plug 31 95 HE 67K Acoustic tube earpiece with right angled 2 5mm mono jack plug for Kenwood 31 95 HE 67V Acoustic tube earpiece with 4 contact single pole plug 31 95 HE 67S Acoustic tube earpiece with 4 contact single pole plug with screw 31 95 HE 57M D type earpiece with straight 3 5mm mono jack plug 15 95 HE 57K D type earpiece with right angled 2 5mm mono jack plug for Kenwood 15 95 HE 57V D type earpiece
166. 4 CMP30B BK CMP30B WH RA052520A RA0458800 8101512 CT 100 MLS 300 MLS 3001 792023306 RA078400 RA045910A RA0777900 CE 81E CT 99 CT 62 GX 1200E MMB 84 MLS 300 MLS 310 79025406 RA0978400 RA0978600 CE 101E FIF UK1 MMB 84 CMP30B BK CMP30B WH RA052520A RA0458800 8101512 CT 100 220SW 240SW MLS 300 MLS 3001 MLS 310 792023306 RA0978400 RA045910A RA0772200 CE 81E CT 99 CT 62 VLH 3000 MMB 84 220SW 240SW MLS 300 MLS 3001 MLS 310 792023306 RA0978400 RA045910A RA0772200 Original cable with socket for CMP30B and VH 310 for GX 1600 23 foot RAM plus extension cable for GX 1600 External speaker for GX 1600 10W external amplified speaker for GX 1600 DC cable for GX 1600 Mounting bracket for GX 1600 Mounting bracket knob for GX 1600 Sun cover for GX 1600 Programming software for GX 1600 Programming cable side to side for GX 1600 Programming cable PC side for GX 1600 VHF DSC fixed marine transceiver Black VHF DSC fixed marine transceiver White Mic Spare Flush mount bracket for GX 1500 RAM plus microphone for GX 1500 Black RAM plus microphone for GX 1500 White Rubber cover for CMP30B and VH 310 socket for GX 1500 Microphone clip hanger for CMP30B for GX 1500 Original cable with socket for CMP30B and VH 310 for GX 1500 23 foot RAM plus extension cable for GX 1500 External speaker for GX 1500 Loud hailer extension intercom speaker with call button for GX 1500 DC cable for GX 1500 Mounting bracket
167. 4 151MHz helicoil 15cm RED for VX 414 424 150 163MHz helicoil 15cm BROWN for VX 414 424 161 174MHz helicoil 15cm BLACK for VX 414 424 400 430MHz whip 16cm BROWN for VX 417 427 450 485MHz stubby 8cm RED for VX 417 427 440 470MHz whip 16cm BLUE for VX 417 427 15 95 3 95 169 95 45 95 28 95 11 95 11 95 13 95 10 95 13 95 8 95 29 95 99 95 9 95 9 95 14 95 34 95 14 95 3 95 14 95 1 00 204 95 204 95 119 95 119 95 7 95 7 95 7 95 7 95 8 95 7 95 7 95 19 95 16 95 29 95 17 95 17 95 47 95 47 95 219 95 219 95 324 95 324 95 22 95 22 95 24 95 43 95 19 95 16 95 50 95 18 95 25 95 18 95 25 95 8 95 41 95 37 95 10 95 4 95 8 95 13 95 129 95 129 95 134 95 134 95 7 95 7 95 7 95 7 95 7 95 8 95 7 95 7 95 27 95 31 95 21 95 21 95 233 95 233 95 22 95 24 95 44 95 19 95 16 95 50 95 31 95 284 95 23 95 61 95 18 95 25 95 18 95 25 95 8 95 41 95 37 95 10 95 4 95 8 95 139 95 139 95 139 95 154 95 154 95 154 95 164 95 7 95 7 95 7 95 7 95 8 95 7 95 gt gt T T T K T T T CD T T T T T T T T GD C3 Te Te e e r CTC CCC C3 C3 e e C e C3 C3 C3 e C3 CTC CC I D R b e e CC C3 Te P C P I C3 h e C1 C1 CC E C3 C3 P P P P T e T e C1 C3 CC FNB
168. 4 Hand held speaker microphone for IC 4088SR 51 95 HM 75A Speaker microphone with up down for C 4088SR 51 95 HM 128 Earphone microphone for IC 4088SR 21 95 HM 131 GS style speaker microphone 36 95 HM 166 Earphone microphone 31 95 HS 5 Headset with PTT amp VOX for IC 4088SR 73 95 HS 85 Lightweight headset with VOX PTT TOT 67 95 HS 94 Headset ear piece type for IC4088SR 18 95 HS 95 Headset neck arm type needs VS 1 IC for IC 4088SR 125 95 HS 97 Earphone with throat mic for IC 4088SR 27 95 VS 1 IC VOXIPTT unit for IC 4088SR 29 95 SM 4088 Service manual on CD for IC 4088SR 69 95 IC F29SR PMR 446 Handheld transceiver 149 95 BC 157S PSU for BC 214 six way charger 92 95 AD 130 Charger adaptor as supplied with BC 214 14 95 BC 214 6 way charger 399 95 BC 123S PSU for BC 213 single charger 14 95 BC 213 Single fast charger 30 95 UK6WAY 6 way charger excluding pods 175 95 BP 278 Li ion battery pack 7 2V 1130mAh approx 10 hours operating time 31 95 BP 279 Spare Li ion battery pack 7 2V 1485mAh approx 14 hours operating time 37 95 HM 168LWP Waterproof speaker microphone IP67 84 95 HS 94 Headset ear piece type boom microphone needs VS 4LA 19 95 HS 95 Headset neck arm type with boom microphone needs VS 4LA 124 95 HS 97 Earphone with throat microphone needs VS 4LA 28 95 VS 4LA PTT switch cable 63 95 HM 153LA Durable earphone microphone 79 95 HM 166LA Earphone microphone 84 95 MB 133 Spare alligator
169. 40 80 vertical 20 high Wi Fi antenna 2 4GHz 15dBi 16 elemen Wi Fi antenna 2 4GHz 15dBi 16 element weather proof Wi Fi antenna 2 4 GHz 2 4dBi gain desk top 6m telescopic antenna for Yaesu FT 817 10m telescopic antenna for Yaesu FT 817 Scanner receiver telescopic antenna 2m 70cm foldover dual band telescopic whip BNC 12m telescopic antenna for Yaesu FT 817 15m telescopic antenna for Yaesu FT 817 2m 70cm telescopic rubber duck 14 5 long BNC 17m telescopic antenna for Yaesu FT 817 38 2m Long John H Fox Hunt Adventure Bool 30m telescopic antenna for Yaesu 40m telescopic antenna for Yaesu FT 817 Discone 144 1300MHz transmit 25 1300MHz receive Discone 50 1300MHz transmit 25 1300MHz receive 80m telescopic antenna for Yaesu FT 817 2 element moxon yagi beam for 10m 12 feet long 6 80m multiband telescopic antenna for Yaesu FT 817 Tilt base for vertical antennas takes mast size up to 2 1 4 inch outside diameter Ground coupled portable antenna base MFJ 1904 with MFJ 1795 vertical MFJ 1904 with Hy Gain AV 18VS 33 feet strong fibreglass masts with hose clamps 33 feet strong fibreglass masts with quick clamps Balcony antenna mount 18 inch stand off SO 239 3 8ths 43 feet strong fibreglass masts with hose clamps 43 feet strong fibreglass masts with quick clamps 50 feet strong fibreglass masts with quick clamps 33ft fibre glass mast telescopes to 3 8ft 1 75 base 3 3lbs 20ft lightweight telescopic fibreglass mast 28ft lightweight telesc
170. 400 Desktop magnetic loop aerial 10Hz 500MHz active whip inc PSU MC 600 Impedance matching transformer for LA 800 400 GT 1 Galvanised isolation transformer for LA 800 400 LA400 RCK Extension cables for LA 400 TW 500 elescopic whip aerial BNC as supplied with AR 2700 SA 7000 win element passive outdoor aerial 15m coax BNC plug 30KHz 2GHz RX only 1 8m long DA 3200 Wide band discone 16 element 25MHz 3GHz 15m cable DA 6000 Rugged Compact discone 700MHz 6GHz 50 Ohm N socket Height 232mm Weight 700g Military grey MA 500 VHF UHF mobile whip aerial on magnetic base RA 8600 telescopic whip RA 8200 Rubber duck type aerial ABF 128 Airband filter for 108 136MHz male femal BNC ABF 128 SMA Airband filter for 108 136MHz male femal SMA AOR ACCESSORIES FOR AR 8000 2700 PC MAN WIN CD PC manager for windows software for AR 8000 amp AR 2700 OP 8000 Operating handbook for AR 8000 AOR ACCESSORIES FOR SDU 5500 SM 5500 Service manual for SDU 5500 DC 5500 12v DC lead for SDU 5500 APACHE LABS ANAN 10E HF amp 6m 10W 10Hz 55MHz all mode SDR transceiver DSP HERMES ANAN 10EE Entry Level HF amp 6m 10W 10Hz 55MHz all mode SDR transceiver ANAN 100E HF amp 6m 100W 10Hz 55MHz all mode SDR transceiver DSP HERMES ANAN 100DE HF amp 6m 100W 10Hz 55MHz all mode SDR transceiver amp 2 receivers DSP ANGELIA ANAN 200DE HF amp 6m 100W 10Hz 55MHz all mode SDR transceiver amp 2 receivers DSP ORION QS 112A Handheld microphone for ANAN trans
171. 40T 1675T 1621 1622 1623 1624 1625 1642 1644 1661 1662 1664 1668 1672 1700C 1701 1702 1702C 1702CN 1703 1704 1704N 1705 1705H 1706 1706H 1707 1708 1709 1710 1710S 1712 1712S 1713 1713S 1714 1715 1715S 1716 1716S 1717 1717S 1717SF 1717P 1717PL 1719 1719S 1719SF 1720S 1721 1722 1722S 1724B 1728B 1729 1730 1731 1734 1736 1738 1739S 1739SF 1740 6 way DC outlet 8 way DC outlet with voltmeter on off switch amp fuse 6 way DC outlet 8 way high current DC outlet with voltmeter switch fuse 6 way DC outlet 4 x Anderson PowerPole 2 x binding posts 8 way DC outlet 6 x Anderson PowerPole 2 x binding posts 12 way DC outlet all Anderson PowerPole voltmeter on off switch 10 way DC outlet 7 x Anderson PowerPole 3 x binding posts V meter on off switch Filtered DC outlet reduces RFI hash noise etc Computer interface for data Multimode IBM FAX RTTY ASCII CW Microphone control centre 1 rig 2 mics c w 1 lead MFJ 53971 or MFJ 5397MX Microphone control centre 2 rigs 1 mic c w 2 leads MFJ 53971 amp or MFJ 5397MX Microphone control centre 2 rigs 2 mics c w 2 leads MFJ 53971 amp or MFJ 5397MX Basic digital interface with soundcard 8 pin round mic plug Basic digital interface with soundcard 8 pin modular mic plug RJ 45 Basic digital interface with soundcard 4 pin mic plug Sound card adaptor for all digital modes 8 pin round mic plug 220V PSU So
172. 443 for IC 7000 Separation cable 3 5m for IC 7000 Separation cable 5m for IC 7000 DC lead for IC 7000 with EMC filter DC lead for IC 7000 In line EMC DC filter 20Amps Microphone adaptor cable for IC 7000 Adapter cable for C 7000 600 Ohm 8 pin deluxe base station desk microphone for IC 7000 Mobile speaker 5W 4 Ohms for IC 7000 Spare remote control microphone for IC 7000 Mobile hand microphone for IC 7000 with DTMF keypad RS 232 computer interface for IC 7000 Service manual on CD for IC 7000 2 30MHz folded dipole T2FD type c w 30m coax for IC 7000 HF amp 6m DSP 0 005 3335MHz wideband receive USB port no FM Antenna whip amp mount for C 7200 Automatic antenna tuner HF plus 6m for IC 7200 2 30MHz folded dipole T2FD type c w 30m coax for C 7200 Automatic ATU for IC 7200 Spare hand microphone600 Ohm 8 pin up down for IC 7200 600 Ohm 8 pin deluxe base station desk microphone for IC 7200 Adapter cable for C 7200 Mobile speaker 4W 8 Ohms for IC 7200 Base station speaker large with audio filters for IC 7200 Base station speaker small for C 7200 RS 232 computer interface for IC 7200 Handles that fit on front panel for IC 7200 Carrying handle for IC 7200 Mobile mounting bracket for IC 7200 Service manual on CD for IC 7200 HF 100W transceiver no FM Antenna whip amp mount for IC 718 Automatic antenna tuner HF plus 6m for IC 178 2 30MHz folded dipole T2FD type c w 30m coax for IC 718 Automatic ATU for IC 718 455KH
173. 46 95 21 95 98 95 74 95 62 95 269 95 269 95 305 95 305 95 399 95 399 95 409 95 409 95 519 95 519 95 559 95 559 95 629 95 629 95 669 95 669 95 51 95 189 95 21 95 28 95 46 95 29 95 45 95 59 95 99 95 74 95 62 95 449 95 479 95 539 95 579 95 699 95 739 95 799 95 849 95 31 95 45 95 28 95 46 95 46 95 66 95 189 95 21 95 88 95 99 95 74 95 62 95 312 95 809 95 1 149 95 m m mh mh m m m m m AAANANDNDSFOKSFONFSFOSFSFSFVUVVVVVVVNNDSFOSFSFOSESFAIDIDANQAAAIADADADADADADAAIAADAFS TO T TOO OOO TOO K T TO OOO OOO OGO T T T T T T T T TO TOHO T OD T T OHO TO WO 0 T T T T TO TO TOC OPC 478UC Cloning cable for radio to PC USB cable 46 95 OPC 980 Cloning cable adaptor 49 95 HM 126B Remote control hand microphone standard 66 95 HS 98 Telephone handset 134 95 MB 75 Flush mount kit 19 95 PS 250 DC DC power supply 486 95 PS 240 AC DC power supply 486 95 CS GM651 Programming software for IC GM651 on CD ROM 82 95 SM GS651 Service manual on CD ROM for IC GM 651 62 95 IC M801 E24V MF HF marine SSB transceiver DSP HS 98 SP 24 24V 2 995 95 IC M801 E12V MF HF marine SSB transceiver DSP HS 98 SP 24 12V 2 995 95 IC M801 GMDSS24V MF HF marine SSB transceiver DSP HS 98 SP 24 GMDSS 24V 4 435 95 AH 710 2 30MHz folded dipole T2FD type c
174. 480 49 95 004 ransceiver cable RigExpert to transceiver wired cable ready to use TS 450 690 140 49 95 005S ransceiver cable RigExpert to transceiver wired cable ready to use TS 870 49 95 YS 001 ransceiver cable RigExpert to transceiver wired cable ready to use for FT 100 817 857 897 49 95 YS 002S ransceiver cable RigExpert to transceiver wired cable ready to use for FT 1000MP 2000 5000 49 95 YS 003S ransceiver cable RigExpert to transceiver wired cable ready to use for FT 1000 1000D 49 95 YS 004 ransceiver cable RigExpert to transceiver wired cable ready to use for FT 920 49 95 YS 005 ransceiver cable RigExpert to transceiver wired cable ready to use for FT 450D 49 95 YS 006 ransceiver cable RigExpert to transceiver wired cable ready to use for FT 950 49 95 YS 007S ransceiver cable RigExpert to transceiver wired cable ready to use for FT 1000MP 2000 5000 AF out 49 95 TT 001S ransceiver cable RigExpert to transceiver wired cable ready to use for Orion Argo V 49 95 EL 001S ransceiver cable RigExpert to transceiver wired cable ready to use for Elecraft K3 49 95 REGISTRATION Registration file for software MixW 31 95 MAGLOOP 8 Antenna for 20 10m band 349 95 ROTATORS AND ACCESSORIES SEE UNDER CABLE FOR ROTATOR CABLE SEE ALSO CREATE amp HY GAIN G 2800DXC YAESU rotator heavy duty needs 6 core cable 939 95 G 1000DXC YAESU rotator 1100 kg cm needs 6 core cable 499 95 G 1000C YAESU rotator 800 kg cm 449 95 G 650C YAESU rotat
175. 49 95 79 95 15 95 109 95 24 95 9 95 9 95 28 95 9 95 6 50 29 95 39 95 15 95 74 95 62 95 339 95 18 95 14 95 66 95 389 95 14 95 31 95 79 95 18 95 25 95 77 95 83 95 QNOFSFOFKFOOSFSFPOWDBDSUOFYrYrFSrErErSFAEFONAONDSFSSFOESEFSFOIVDESFNIDINOISESESFOONSFSFONOSSFPINIIVSESESESFOESFNOININDOOS SESE SPOSFONOOISKSESESFOKFYKSSFSESFOFSFYKSEFPOOSFKSFOWBDSSPLPOFWFSESFSPOASFOOIFSFKSESFOFYKrF rOA HM 169 HM 170GP HM 138 HS 94 HS 95 HS 97 VS 1SC MB 86 MB 98 MB 96F MB 96N OPC 515L OPC 656 OPC 966 OPC 966U CS F61M SM F61M IC GM1600 MED AD 109 BC 119N BP224 BC 121N BP224 BC 145 BC 147E BC 157 BC 158 CP 23 BP 234 HM 167 HS 94 HS 95 HS 97 MB 103Y MB 86 MB 96F MB 96N OPC 478 OPC 515L OPC 656 OPC 922 OPC 1392 CS GM1600 SM GM1600 IC M323 WH IC F110M SM 25 IC M401EURO HM 132 MB 69 MB 75 OPC 478 OPC 478UC OPC 1086 OPC 1088 SP 10 SP 24 CS M401 SM M401 IC M411 IC M411 GPS MB 69 OPC 478 OPC 478UC OPC 1758 GPS ANT CS M411 SM M411 IC M505 BK IC M505 GY IC M505 BK GPS IC M505 GY GPS IC M505 BK 162 IC M505 GY 162 IC M505 BK GPS 162 IC M505 GY GPS 162 IC M505 BK AIS IC M505 GY AIS IC M505 BK AIS GPS IC M505 GY AIS GPS IC M505 BK AIS 162 IC M505 GY AIS 162 Waterproof speaker microphone with programmable button Waterproof speaker microphone with GPS for BIIS mode position tracking Waterproof speaker microphone Headset e
176. 5 17 95 64 95 64 95 64 95 64 95 roo AARAAARN9000 OOO CRE OE3 C3 CC OOO E a A LEA R G C3 C3 C9 C C I P C h I H r I r r d A C3 R I E I H H I C CE H E CH EE 17 95 59 95 19 95 VEC 1300KC Metal case for VEC 1320 1330 1340 1380K VEC 1402DK 2m super pre amplifier VEC 1402K 2m pre amplifier kit VEC 1444K 70cm pre amplifier kit VEC 1500K Comprehensive soldering course kit VEC 1604K Portable CD player audio amplifier kit VEC 1604KC Metal case for VEC 1604K VEC 1680K Vacuum tube audio preamplifier VEC 1680KC Metal case for VEC 1680K VEC 4001K Functional generator with case VEC 5100K Flashing LED name badge kit VEC 8218K Counter surveillance monitor kit VEC 8218KC Metal case for VEC 8218K VEC 1901 he Giant Book Of Electronic Projects VIBROPLEX MORSE KEYS amp ACCESSORIES ZN ULTIMATE lambic paddle chrome base blue paddles V BR2D Blue Racer 2000 Deluxe bug key chrome plated base V BR2S Blue racer 2000 Standard bug key original blue base V OGBK Original Gold Bug Key entire base is 24K gold plated chrome components V OPBK Original Presentation Bug Key 24K gold plated brass plate chrome base V ODBK Original Deluxe Bug Key chrome base and components V OSBK Original Standard Bug Key black base chrome components V 100 100th anniversary original bug key V IG lambic Gold entire base is 24K gold plated chrome component
177. 5 32 95 19 95 32 95 49 95 49 95 19 95 14 95 19 95 34 95 39 95 69 95 44 95 17 95 19 95 6 95 12 95 14 95 14 95 19 95 19 95 19 95 19 95 19 95 13 95 13 95 19 95 19 95 19 95 19 95 21 95 39 95 55 95 19 95 15 95 29 95 36 95 46 95 49 95 59 95 69 95 54 95 39 95 54 95 rrrrr gt T e e e De De De De De ee ee ee I ID PP POO GQ TOYO OOO TOO Om 090999 GOGO OOO OOO OOO OOO OO OOO T T rrrrrrrrwwr gt r GO QQ PBX 100 MKII YP 450 ST 460 P 103 P81 PTMKB W RMSO W HRM W DPH S 100 SO WMT 1 WMT 2 W 3CK W 3HM W 3RM W ECH W EXT WM 14B WM 08B WMM 7 WMM 5 WPL 50 WPL 50 BNC WPL 50 PL BN WPL 50 PH BNC WPL 50 SMA BNC WPL 70 WPL NBNC 2 WPL NBNC 10 WPL NBNC 15 HQ 66 HQ 10M HQ 10M 58 WSM 88V WAM 2 W 300S W 300T WATSON HF ANTENNAS AND ACCESSORIES WREF 10 WREF 12 WREF 15 WREF 17 WREF 20 WREF 30 WREF 60 WREF 80 TRI STAR W LWB MK11 LAD 20 300 LAD 20 450 ECW HDCW FLEXWEAVE FW PVC 50 CCS 50 WAL 55 BYA HSRVK GP 2500 GP 2500F GSRV XF G5RV XH G5RV DS G5RV FULL G5RV HALF EL 40XC WTS G5 WDP 30 SWL DX1 SWL DXDL ANGLER WB 1 WB 4 WB 6 WGR 330 WGR 430 WGR 630 WGR 35B WGK MD WGK HD WG5 CHOKE WDC 50 WDC G5 WDC 300 DPC 38 DPC 38V Base portable 6 10 12 15 17 20 40 80m any 6 bands tripod 400W SO 239 needs no ground planes Portable 5 section aluminium telescopic mast 5 27m 3 way Al
178. 5 62 95 62 95 119 95 149 95 34 95 34 95 34 95 34 95 34 95 34 95 34 95 34 95 34 95 34 95 34 95 34 95 34 95 34 95 34 95 34 95 34 95 34 95 34 95 34 95 429 95 429 95 359 95 119 95 189 95 189 95 249 95 169 95 189 95 119 95 6 99 4 95 4 95 12 99 6 99 14 99 8 99 3 99 1 99 2 99 8 99 6 99 5 99 5 79 8 99 5 99 4 99 0 99 4 99 6 99 6 99 2 99 4 99 4 99 2 99 9 99 9 99 9 99 9 99 11 99 4 99 6 99 24 99 16 99 12 99 12 99 29 99 4 95 2 99 4 99 4 99 4 99 9 99 9 99 7 99 4 99 9 99 5 99 9 99 1 99 4 99 3 99 9 99 9 99 29 99 hr M M M m hr M D M M M m m m m m M M M h m m rir ra e m 5 99 4 99 3 99 7 99 4 99 4 99 m ro ro mh m GOW OOO OOE EE EE ECC EA a e e e he e e r I T aN H e e e e D E E e e e he I A cal A a H P e e e I e I H I al e he e e e ale cal TTSB3 BK Technical Topics Scrapbook Marklll 1995 99 Pat Hawker TTSB2 BK Technical Topics Scrapbook Markl 1990 94 Pat Hawker TTSB BK Technical Topics Scrapbook 1985 89 Pat Hawker USG 4BK Ultimate Scanning Guide complete with CD VHF2 BK The VHF UHF Handbook 2nd edition WEEK BK Weekend Projects For The Radio Amateur WHOS BK Who s Who In Amateur Radio WLOD BK World Licensing and Operating Director
179. 5 KFL3A 200 200Hz 5 pole Roofing Filter for K3 Transceiver 89 95 KFL3A 250 250Hz 8 pole Roofing Filter for K3 Transceiver 139 95 KFL3A 400 400Hz 8 pole Roofing Filter for K3 Transceiver 139 95 KFL3A 500 500Hz 5 pole Roofing Filter for K3 Transceiver 89 95 KFL3A 1K 1KHz 8 pole Roofing Filter for K3 Transceiver 139 95 KFL3A 1 8K 1 8KHz 8 pole Roofing Filter for K3 Transceiver 139 95 KFL3A 2 1K 2 1KHz 8 pole Roofing Filter for K3 Transceiver 139 95 KFL3A 2 8K 2 8KHz 8 pole Roofing Filter for K3 Transceiver 139 95 KFL3A 2 7K Spare 2 7KHz 5 pole Roofing IF Filter for K3 Transceiver 89 95 KFL3A 6K 6KHz AM SSB 8 pole Roofing Filter for K3 Transceiver required for AM transmit 139 95 KFL3B FM 13KHz FM Roofing Filter for K3 Transceiver required for FM transmit 139 95 KUSB USB Adaptor for the K3 Transceiver 42 95 K3SSKT Stainless steel exterior hardware ki 22 95 KFLMATCH Match for sub receiver 22 95 K3 0 Remote control head for K3 699 95 K3 0 MINI Remote control head for K3 699 95 RRIGSET RemoteRig 1258MKII set dual RX capable remote control set for amateur radio stations over the intemet 499 95 RRKOCBL Cable set for the local K3 O to RemoteRig uni 49 95 RRMTCBL Cable set for remotely controlled K3 to RemoteRig unit 49 95 RRK3CBL Cable set for the local terminal mode K3 to RemoteRig unit 49 95 PR6 10 Internal 6m and 10m 22 54MHz pre amplifier for K3 20dB gain needs KXV3 169 95 XVOVN Crystal oven for XV series of t
180. 5 95 49 95 99 95 94 95 309 95 699 95 389 95 189 95 369 95 249 95 459 95 359 95 579 95 829 95 1 499 95 1 499 95 1 899 95 1 899 95 329 95 1 329 95 479 95 479 95 699 95 449 95 439 95 569 95 869 95 999 95 199 95 299 95 149 95 279 95 595 95 99 95 249 95 279 95 129 95 249 95 239 95 41 95 41 95 53 95 119 95 299 95 119 95 284 95 179 95 219 95 57 95 69 95 99 95 109 95 249 95 159 95 284 95 17 95 14 95 34 95 79 95 94 95 219 95 89 95 119 95 119 95 129 95 89 95 32 95 32 95 7 95 1 50 4 95 23 95 14 95 29 95 39 95 279 95 8 995 00 TBA 8 999 95 4 699 95 41 95 114 95 228 95 259 95 109 95 98 95 70 95 2 649 95 295 95 331 95 52 95 52 95 41 99 114 95 228 95 99 95 139 95 42 95 21 95 599 95 98 95 159 95 59 95 OOO GO GGOGOGOGOGOGOGOOGOGOGOGOGOGOGOGOGOGOGOOGOOGOOOOO GOGO O C3 TO T O T e OGO GO OGO TKT L OOO OOOOOOOOOGOGOOOOOOOOOOGOGO O PS 126 OPC 1457 MB 123 IC PW1EURO 1C 7700 1C 7700KBD HM 36 SM 30 SM 50 SP 34 CT 17 1C 7600 AH 2B AH 4 HM 36 SM 30 SM 50 SP 21 SP 23 1 CT 17 MB 121 PS 126 SM 7600 1C 7410 AH 2B AH 4 FL 430 FL 431 HM 36 SM 50 SM 30 SM 20 SP 21 SP 23 1 IC PW1EURO OPC 599 SM 7410 IC 7100 PS 126 AH 2B AH 4 AH 740 AT 180
181. 5 series includes GPS serial 1 279 95 PP RXB Power pole to universal battery connector adaptor 8 95 A WR DRM KEY Licence key for DRM decoders demodulators 40 95 PP ULTRA Power pole to Deans Ultra connector adaptor 10 95 A WR PPS G3 Portable power source option rechargeable battery power supply for extemal G3 series receivers 174 95 PP ZERO Power pole to Astro Flight Zero Loss connector adaptor 11 95 A WR G303E SIO Serial interface option for G303E receiver 37 95 PP JST Power pole to JST connector adaptor 8 95 A WR G3E WMB Wall mount bracket for G3 series receivers 19 95 PP PIG Power pole to pigtail adaptor 7 95 A WR AX 17C indoor active HF antenna 144 95 PP CLAMP Power pole to battery test clamp 15 95 A WR AX 24B Discone antenna UHF SHF 359 95 RR 8012 C RIGrunner 12 way 12V distribution board complete with 2m cable 24 connectors 80A 155 95 C WR AC MC 01 Mounting clamps for AX 24B and AX 71C antennas 25 95 RR 8012 RIGrunner 12 way 12V distribution board 146 95 C WR AC MC HEA Horizontal extension arm for AX 24B antenna 20 95 RR 4010 SC RiGrunner 10 way 12V distribution board complete with 2m cable 24 conns Master on off switch 146 95 C WR AC MC UMC Universal mounting clamp for offset mast mounting 20 95 RR 4010 S RiGrunner 10 way 12V distribution board 129 95 C WR AX 71C Discone antenna VHF UHF 92 95 RR 4012 C RIGrunner 12 way 12V distribution board complete with 2m cable 24 connectors 129 95 C WR AX 91M Magnetic antenna
182. 50 ATBK 100 Antenna base kit for ATAS 120 ATAS 25 Manual tuning mobile aerial for FT 450 FC 40 Auto ATU with 200 memories for end fed wire or long whip for FT 450 SCU 17 USB interface unit for FT 450 MMB 90 Mobile mounting bracket for FT 450 MHG 1 Carrying handle for FT 450 Accessories For FT 897D MD 200A8X Desk microphone for FT 897 MD 100A8X Desk microphone for FT 897 MH 31A8J Spare Hand mic for FT 897 MH 36E8J DTMF hand microphone for FT 897 MLS 100 High Power external speaker for FT 897 YH 77STA Open air type stereo headphones for FT 897 SP 8 Large base station extension speaker with filter ATAS 120A Active tuning mobile aerial for FT 897 ATBK 100 Antenna base kit for ATAS 120 ATAS 25 Manual tuning mobile aerial for FT 897 FC 30 External automatic ATU for FT 897 FC 40 Auto ATU with 200 memories for end fed wire or long whip YA 007FG Mobile whip 7 54MHz for FC 40 YF 122S Collins SSB filter 2 3 kHz for FT 897 YF 122C Collins CW filter 500Hz for FT 897 YF 122CN Collins CW filter 300Hz for FT 897 SCU 17 USB interface unit for FT 897 CT 62 CAT interface cable for FT 897 CT 39A Packet interface cable for FT 897 FNB 78 Internal Ni MH battery pack for FT 897 4500mAh FP 30U Internal AC power supply for FT 897 CD 24 Ni MH battery charger adaptor 12V for FT 897 PA 26U Ni MH battery charger adaptor 230V for FT 897 needs CD 24 MMB 80 Mobile mounting bracket for FT 897 79019925 Spare DC power cord for FT 857 WDC HF6
183. 50 200KHz 600W RMS plastic 163 95 B 744V Transducer depth temperature speed 50 200KHz 600W RMS bronze 363 95 P 79 Transducer depth 200Khz 600W RMS plastic 136 95 P 58 Transducer depth temperature speed 50 200KHz 600W RMS plastic 149 95 YAESU MARINE HANDHELD TRANSCEIVERS HX 280E Handheld marine transceiver inc Ll lon pack and charger belt clip aerial 109 95 CD 46 Charging cradle for HX 280E needs PA 48 13 95 NC 90U Spare charger for HX 280E 3 pin UK old style 11 95 NC 90C Spare charger for HX 280E 2 pin EU old style 11 95 PA 48U Spare charger for HX 280E 3 pin UK new style 11 95 PA 48C Spare charger for HX 280E 2 pin Euro new style 11 95 FBA 40 Dry cell case for HX 280 6 x AA cells 15 95 FNB V105L1 Spare Lithium lon battery pack 7 4V 1650mAh for HX 280 29 95 E DC 19A DC cable with cigar lighter plug for HX 280 9 95 E DC 6 External DC cable for HX 280 6 95 CN 3 Antenna connector adaptor SMA BNC for HX 280 8 95 CAT 460 Spare antenna for HX 280 9 95 CLIP 920 Spare belt clip for HX 280 3 95 CE 68 Programming software for HX 280 41 95 FIF 14 Programming cable for HX 280 also needs CT 111 and PA 46U 23 95 PA 46U Charger for FIF 11 3 pin UK 11 95 PA 46C Charger for FIF 11 2 pin EU 11 95 CE 68 Programming software for HX 280E 11 95 CT 111 Programming cable for HX 280 48 95 HX 290E Handheld marine transceiver 5W inc Ll lon pack and charger belt clip aerial FLOATS 119 95 MH 73A4B Waterproof speaker mi
184. 512ch VHF 134 174MHz 5W limited keypad Handheld 512ch UHF 400 470MHz 5W limited keypad Handheld 512ch VHF 134 174MHz BW full keypad Handheld 512ch UHF 400 470MHz 5W full keypad 134 151MHz helicoil 15cm RED for VX 821 824 82 150 163MHz helicoil 15cm BROWN for VX 821 824 829 161 174MHz helicoil 15cm BLACK for VX 821 824 829 400 430MHz whip 16cm BROWN for VX 821 824 829 420 450MHz whip 16cm YELLOW for VX 821 824 829 450 485MHz stubby 8cm RED for VX 821 824 829 440 470MHz whip 16cm BLUE for VX 821 824 829 Lithium lon battery 7 4V 1150mAh for VX 821 824 829 Lithium lon battery 7 4V 2000mAh for VX 821 824 829 Lithium lon battery 7 4V 3000mAh for VX 821 824 829 Deski Deski op rapid charger for FNB V86 V87 V92 230C 2 pin Euro plug op rapid charger for FNB V86 V87 V92 230C 3 pin UK plug Multi unit charger for FNB V86 V87 V92 230C 2 pin Euro plug Multi unit charger for FNB V86 V87 V92 230C 3 pin UK plug Vehicl e charger mounting adaptor for VAC 300 Speaker microphone noise cancelling for VX 821 824 829 Speaker microphone submersable for VX 821 824 829 Speaker microphone submersable with PF key toggle for VX 821 824 829 Digital voice storage for VX 821 824 829 Rolling code encryption unit for VX 821 824 829 Inversion encryp MDC ion unit for VX 821 824 829 200 GE STAR ANI encoder only unit for VX 821 824 829 MDC1200 GE STAR ANI encoder lecoder unit for VX 821 824 829 Leather case with belt loop for
185. 5KHz 1 25W 512 CH UHF 400 470MHz 12 5 20 25KHz 1 25W 512 CH FleetSync PC windows software for NEXEDGE and TK 7180 8180 FleetSync PC windows software for TK 7180 8180 Hand microphone standard for TK 7180 8180 Hand microphone with DTMF keypad for TK 7180 8180 Hand microphone heavy duty for TK 7180 8180 Hand microphone with keypad heavy duty for TK 7180 8180 Control station desktop microphone for TK 7180 8180 Horn alert public address relay unit for TK 7180 8180 DC cable remote mount 7m for TK 7180 8180 Radio interface cable for KDS 100 KGP 2A 2B for TK 7180 8180 Ignition sense cable for TK 7180 8180 DIN size vehicle mount for TK 7180 8180 External speaker for TK 7180 8180 External speaker needs KAP 2 for TK 7180 8180 AVL software for TK 7180 8180 Line noise filter for TK 7180 8180 Key lock adaptor for TK 7180 8180 DC power supply for TK 7180 8180 Control head remote kit 7m for TK 7180 8180 Voice guide amp storage unit for TK 7180 8180 Serial to USB adaptor with drivers for TK 7180 8180 PC programming interface cable for TK 7180 8180 269 95 314 95 294 95 269 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 18 95 39 95 39 95 49 95 38 95 28 95 319 95 6 95 194 95 41 95 47 95 91 95 16 95 50 95 33 95 219 95 352 95 14 95 61 95 49 95 48 95 457 00 457 00 30 95 36 95 38 95 57 95 62 95 43
186. 5L KRA 27M needs charger UHF handy 400 470MHz 12 5 20 25KHz 1 4W 16 CH KNB 55L KRA 23M needs charger VHF short antenna 146 162MHz for TK 2360 3360 VHF short antenna 162 174MHz for TK 2360 3360 VHF short antenna 136 150MHz for TK 2360 3360 UHF short antenna 440 490MHz for TK 2360 3360 UHF short antenna 400 450MHz for TK 2360 3360 VHF antenna 146 162MHz for TK 2360 3360 VHF antenna 162 174MHz for TK 2360 3360 VHF antenna 136 150MHz for TK 2360 3360 UHF antenna 440 490MHz for TK 2360 3360 UHF antenna 400 450MHz for TK 2360 3360 Li lon battery 1480mAh for TK 2360 3360 Ni MH battery 1400mAh for TK 2360 3360 Li lon battery 2000mAh TK 2360 3360 6 way charger for TK 2360 3360 Rapid charger for TK 2360 3360 Regular charger for TK 2360 3360 Optional wall hanging bracket for KSC 256E Spare belt clip for TK 2360 3360 Nylon case for TK 2360 3360 Heavy leather case with swivel belt loop for TK 2360 3360 Water resistant bag for TK 2360 3360 Clip microphone with D type earpiece was EMC 6 for TK 2360 3360 Dry cell case 6 x AA for TK 2360 3360 Acoustic tube earpiece for connection to speaker mic for TK 2360 3360 Headset with VOX PTT for TK 2360 3360 Over the head heavy duty headset with boom microphone for TK 2360 3360 Headset boom mic less VOX for TK 2360 3360 Headet with PTT for TK 2360 3360 Boom microphone with D type earpiece and PTT for TK 2360 3360 Single headset with boom microphone no PTT for TK 2360 3360 Single head
187. 5N ZZ2ZZ2222222Z22222Z20Z 20m 14MHz mobile whip 220W SSB 1 2m long PL 259 16m 18MHz mobile whip 220W SSB 1 2m long PL 259 15m 21MHz mobile whip 220W SSB 1 2m long PL 259 12m 24MHz mobile whip 220W SSB 1 1m long PL 259 10m 28MHz mobile whip 220W SSB 1 1m long PL 259 6m 50MHz mobile whip 250W 1m long PL 259 80m 3 5 3 8MHz mobile whip 120W SSB 2 22m long PL 259 40m 7 7 2MHz mobile whip 200W 2 2m long PL 259 14MHz mobile whip 200W 2 2m long PL 259 21MHz mobile whip 200W 2 2m long PL 259 18MHz mobile whip 200W 2 2m long PL 259 15m mobile whip 200W 2 2m long PL 259 10m mobile whip 200W 2 2m long PL 259 6m 50 54MHz mobile whip 2 15dBi gain 250W 2 2m long PL 259 Optional element for SD330 screwdriver antenna to cover 7 50Mhz 0 77m long 2m 70cm dualband 50W 2 15dBi 3 4dB 44cm long for trunk lid base use PL 259 2m 70cm dualband 50W 0 2 15dBi 39cm long silver metal whip PL 259 2m 70cm dualband 50W 0 2 15dBi 39cm long black flexible whip PL 259 2m 70cm dualband 50W 0 2 15dBi 40cm long black flexible whip PL 259 2m 70cm dualband 50W 0 2 15dBi 39cm long whip with built in spring PL 259 2m 70cm dualband 50W 2 15dBi 3 8dBi 47cm long PL 259 2m 70cm dualband 50W 2 15dBi 3 8dBi 47cm long N type socket 2m 70cm dualband 50W 0 3 8dBi 47cm long whip with built in spring PL 259 2m 70cm dualband 50W 2 5dBi 3 8dBi 67cm long PL 259 2m 70cm dualband 50W 2 15 4 5dBi 67cm long whip with built in spring PL 259 2m 70cm dualband 50W 2 15 4 5dBi 67cm l
188. 6 long 9 95 A WR G305i WFM Intemal PCI card wide band receiver with standard demodulator and Wide FM option 9KHz 1 8GHz 789 95 USB SER USB to RS232 male adaptor 19 95 A WR G305i PD internal PCI card wide band receiver with professional demodulator 9KHz 1 8GHz 789 95 AN CBL 3 5mm stereo jack plug to 3 5mm stereo jack plug patch lead 6 feet long 5 95 A WR G305i WFM PD Intemal PCI card wide band receiver with professional demodulator and wide FM option 9KHz 1 8GHz 839 95 MINI EX CBL Cable 6 feet long 3 5mm stereo plug to socket extension lead 7 95 A WR G305e External USB wide band receiver with standard demodulator 9KHz 1 8GHz 669 95 IA CLB Lead for Icom ACC1 jack 6 long to provide a fixed level output 12 95 A WR G305e WFM External USB wide band receiver with standard demodulator and wide FM option 9KHz 1 8GHz 789 95 IA FSK CBL Lead fixed level audio from ACC1 to soundcard FSK 18 95 A WR G305e PD External USB wide band receiver with professional demodulator 9KHz 1 8GHz 789 95 1A13 FSK CBL com data port audio cable 6 feet long fixed level receive audio and FSK using 13 pin data port 18 95 A WR G305e WFM PD Extemal USB wide band receiver with professional demodulator and wide FM option 9KHz 1 8GHz 839 95 YA CBL Yaesu fixed level audio cable 6 long 12 95 A WR G33EM Marine HF receiver 995 95 817 CBL Yaesu data port audio cable 6 feet long fixed level receive audio using data port jack 13 95 A WR G33EM GPS Marine HF receiv
189. 67 230V 3 pin UK plug Multi unit charger for FNB 83 FNB V94 230V 2 pin Euro plug Multi unit charger for for FNB 83 FNB V94 230V 3 pin UK plug Multi unit charger for FNB V67 230V 2 pin Euro plug Multi unit charger for FNB V67 230V 3 pin UK plug Vehicle charger mounting adaptor for VAC 10 Vehicle charger mounting adaptor for VAC 810 Earpiece with in line microphone for VX 414 417 424 427 Speaker microphone noise cancelling for VX 414 417 424 427 Speaker microphone small type for VX 414 417 424 427 Speaker microphone miniature type for VX 414 417 424 427 VOX headset for VX 414 417 424 427 Digital voice storage for VX 414 417 424 427 DTMF paging and encryption for VX 414 417 424 427 Rolling code encryption unit for VX 414 417 424 427 MDC1200 GE STAR ANI encoder only unit for VX 414 417 424 427 MDC1200 GE STAR ANI encoder decoder unit for VX 414 417 424 427 Leather case and belt loop for VX 414 417 Leather case and swivel belt loop for VX 414 417 Leather case and belt loop for VX 424 427 Leather case and swivel belt loop for VX 424 427 Cloning cable for VX 414 417 424 427 Programming kit for VX 414 417 424 427 USB interface adaptor for use with CT 106 Programming cable interface for VX 414 417 424 427 connects to FIF 10A Programming software for VX 414 417 424 427 Antenna connector adaptor SMA BNC for VX 414 417 424 427 Handheld 16ch VHF 134 174MHz 5W no display Handheld 16ch UHF 400 470MHz 5W no display Handheld
190. 69 95 169 95 139 95 25 95 27 95 19 95 19 95 119 95 44 95 11 95 14 95 14 95 32 95 109 95 299 95 329 95 89 95 99 95 179 95 49 95 139 95 139 95 59 95 219 95 G 00 GOGO GGOGOGOGOGOGOGOGOGOGOGOGOGOGOGOGOGOGOGOGOOOOOOOGOGO O GO TK O H T e K T T K T T T K T OOO KK KO 0000 CP62 F61 CP610 CP 725H A1430S7 ASO2HBR A144S5R A144S10R A430S10R A430S15R B144 B430 KB144 KB430 8144 S8430 BB6W W 721 W 735 W 8010 WD 330 WD 330S WD 330J DP 7RH DPC 21H HFVS BB7V D 3000N HFV 8040 VX 30 VX 1000 VX 4000 X 30 X 50 X 50N X 200N X 300 X 510N X 510MH X 520M X 700H X 700HN V 2000 X 5000 X 6000 X 7000 D 777 D5080 D 303 SE 300 6m 50MHz vertical 5 5dBi gain 500W PL 259 6 8m long 6m 50 54MHz vertical fibre glass 2 7dBi gain 150W SSB 50W FM 3 2m long PL 259 type 10 6m 50MHz 5 8 amp 28MHz 2 x 5 8 vertical 3 4 5 5 dBi gain 500W PL 259 6 8m long Quad band trap vertical antenna 6 10 15 40m 11 8 tall 71 long radials 6 6lbs 2m 70cm 7 5 9 3dBi 100W 1 25m long SO 239 3 5 element dual band beam antenna 50 53MHz 6m 2 elements phased drive beam 6 3dBi 400W SSB PL 259 144 146MHz 2m 5 element yagi 9 1dBi gain 100W PL 259 95cm long 144 146MHz 2m 10 element yagi 11 6dBi gain 100W PL 259 213cm long 430 440MHz 70cm 10 element yagi 13 1dBi gain 100W PL 259 119cm long 430 440MHz 70cm 15 element yagi 14 8dBi gain 100W PL 259 224 5cm long Support boom elem
191. 6S 6m 6 element beam 11 6dB gain 6 1m long A148 3S 2m 3 element beam 7 8dB gain 0 85m long A148 10S 2m 10 element beam A148 20T 2m 10 ele each crossed beam 11 1 dB gain 3 3m long A430 11S 70cm 11 element beam 13 2dB gain 1 35m long A449 6S 440 450MHz 6 element yagi A449 11S 440 450MHz 11 element yagi MASV6M 6m Add on kit for MARV DISC R 7000TFK Trap field kit for R 7000 DISC CUSHCRAFT ACCESSORIES PD 2 Power divider for 2 x 13B2 PD 4 Power divider for 4 x 13B2 26B2VPK Boom amp phasing harness for stacking 2 x 13B2 Yagis DD AMTEK FILTERS ETC ATT 20 n line variable attenuator 20dB 0 1 1000MHz BNC plug to BNC socket BPF 1632 in line band pass filter 1 6 32MHz BNC plug to BNC socket BPF 7084 in line band pass filter for 70 84MHz BNC plug to BNC socket BPF AIR n line band pass filter for the air band 112 140MHz BNC plug to BNC socket BPF UHF n line band pass filter 440 512MHz BNC plug to BNC socket BPF VHF n line band pass filter 137 174MHz BNC plug to BNC socket HPN 30118 n line 87 108MHz notch filter and 30MHz high pass filter BNC plug to BNC socket HPN 30118T in line 87 108MHz notch filter and 30MHz high pass filter F plug to F socket LNA 2000 n line low noise amplifier 30 2000MHz 2 x F sockets powered via the coax cable LNA 2000B n line low noise amplifier 30 2000MHz 2 x F sockets needs separate 12v supply LNA AIR n line low noise amplifier 118 137MHz BNC plug to BNC socket powered via coax LNA AIR B n line low noise amplifier
192. 7 BC 194 CP 18E SP 13 SP 27 EARPIECE 003 HP 4 OPC 474 OPC 478 OPC 478UC AD 92SMA CS R6 CT 17 FA S270C BC 119N 121 charger adaptor for BP 209 210 211 222 Fast charger includes AD 101 amp BC 146 for BP 209 210 211 6 way fast charger including 6 x AD 101 adaptors and BC 124 for BP 209 210 211 Rapid charger with AC adaptor BC 145 and AD 99 AC adaptor for BC 119N amp BC 144N UK 3 pin AC adaptor for BC 119N amp BC 144N Euro 2 pin Slow drop in charger Spare AC adaptor for BC 121 Dry cell case 6 x AA for IC V U82 NiMH battery pack 1650mAh for IC V U82 Earphone microphone for IC V U82 GS style speaker microphone for IC V U82 Heavy duty hand held microphone Speaker microphone with up down for IC V U82 Earphone microphone Lightweight headset with VOX PTT TOT Headset ear piece type for IC V U82 Headset neck arm type needs VS 1L for IC V U82 Earphone with throat mic for IC V U82 Swivel belt clip for IC V U82 Fixed type non swing leather belt hanger for IC V U82 Swivel type leather belt hanger for IC V U82 Cloning cable radio to radio for IC V U82 Cloning cable radio to PC for IC V U82 Cloning cable radio to PC USB for IC V U82 Cloning software for IC V82 Earphone for IC V U82 DSTAR unit for IC VU82 VOXIPTT unit for IC V U82 Service manual for IC V82 and IC U82 Spare VHF antenna for IC V82 Spare UHF antenna for IC U82 Handheld scanner with Ni MH rechargeable batts and charger 0 1 1309 995MHz S
193. 75 95 74 95 14 95 14 95 36 95 14 95 18 95 18 95 49 95 18 95 83 95 12 95 28 95 46 95 21 95 75 95 75 95 79 95 19 95 14 95 14 95 52 95 11 95 14 95 TO OGY T TC CD CC e ET C3 e DIC C1 C C3 P e C3 C CC CC e TE e E C C C E C EC CC CC E EC IE E poe pe e Leal alas 1 0 1 1 E A 1 ala I L L 1 0 16 PEYO p gt BC 1578 009 BC 166 CIGAR 001 CP 23L BP 245N BCM71 001 CASE 035 FA S64V HM 167 OPC1729 001 HS 94 HS 95 HS 97 MB 103Y MB 86 OPC 1392 OPC 478 OPC 478UC OPC 515L OPC 656 OPC 922 CS M71 SM M71 IC M87 AD 100 BC 01 BC 119N 004 BC 121N 001 BC 145 BC 145SE 006 BC 152 BC 1578 009 BC 190 UK BC 190 EU CIGAR 001 CP 23L BP 226 BP 227 CASE 051 FA S59V FA S62VS FA S63VS HM 138 HM 168 HS 94 HS 95 HS 97 VS 1 IC MB 86 MB 98 OPC 515L OPC 966 OPC 966 002 CS M87 SM M87 IC M87ATEX BP 227AX FA S59V HM 138 MB 86 MB 98 AD 100 BC 01 BC 119N BP227 BC 121N BP227 BC 145 BC 152 BC 157 CP 23 BP 226 BP 227 HM 168 FA S62VS FA S63VS OPC 515L OPC 966 OPC 966 002 CS M87 SM M87 IC M90E AD 109 BC 119N BP224 BC 121NIBP224 BC 145 BC 147E BC 157 BC 158 BC 162 CP 23 BP 252 HM 167 HS 94 HS 95 HS 97 MB 103 MB 86 OPC 478 OPC 515L OPC 656 OPC 922 OPC 1392 FA S59V CS M90 SM M90 IC F61M AD 100 BC 01 BC 119N BP227 BC 121N BP227 BC 145 BC 152 BC 157 CP 23 BP 226 BP 227 HM 168 AC mains PSU for BC 121N and IC M71 Desktop slow charger needs BC 01
194. 785 10 95 UBC 360CLT Base scanner 25 174 406 512 806 960MHz AM NFM WFM 99 95 UBC 3500XLT Handheld scanner 25 512 806 1300MHz SMA 2500mems batt charger aerialbelt cdip BNC adptrlanyard 209 95 BC CASE BC3500 Soft case for UBC 3500XLT 28 95 SW UBC 3500 BuTel control software for UBC 3500XL 34 95 25435 Programming cable serial PC to UBC 3500XLT amp USC 230 19 95 WEP 300MKIl Over the ear earpiece 3 5mm mono jack plug Black for UBC 3500 XLT 3 95 UBC 6V Cigar lighter lead DC to DC converter 12V to 6V for UBC 69 72 92 3500XLT 9 95 NXC 3AA Battery set 3 x AA cell Ni MH rechargeable 2600mAh 1 2V for UBC 3500XLT 3 95 WCN 3 Spare aerial socket adaptor SMA to BNC for UBC 3500XLT 4 95 USC 230 Handheld scanner 25 87 108 174 216 225 400 512 806 960 1240 1300MHz BNC batt chgr antbelt cip 124 95 SW UBC 230 BuTel control software for USC 230 23 95 25435 Spare programming cable serial PC to UBC 3500XLT amp USC 230 19 95 WEP 300MKIl Over the ear earpiece 3 5mm mono jack plug Black for UBC 230 3 95 UBC 6V Cigar lighter lead DC to DC converter 12V to 6V for USC 230 9 95 NXC 2AA Spare battery set 2 x AA cell Ni MH rechargeable 2600mAh 1 2V for USC 230 2 95 RD U220 Spare rubber duck aerial for USC 230 160mm long 9 95 17 0576 Spare in the ear earpiece 3 5mm mono jack plug White for UBC 280XLT 0 95 WEP 300MKIl Over the ear earpiece 3 5mm mono jack plug Black for UBC 280 XLT 3 95 RD U220 Spare rubber duck aerial for UBC 220 280XL
195. 8 pin radios KAM HF port to Icom 8 pin radios MFJ packet to Kenwood and Alinco 8 pin radios PK 232 to Kenwood and Alinco 8 pin radios KAM HF port to Kenwood 8 pin radios PK232 to Kenwood 8 pin modular KAM HF Kenwood 8 pin round KAM VHF port KPC3 KPC9612 to Kenwood 8 pin modular PacComm to Kenwood 8 pin modular MFJ Paccomm other TNC2 to Radio Shack 8 pin modular PK232 to Radio Shack 8 pin modular MFJ Paccomm other TNC2 to MFJ 8621 data radio LED Flashing Name Badge Ki PK 232 to MFJ 8621 data radio KAM VHF port KPC3 KPC 9621 to MFJ 8621 data radio Open end cable with 8 pin mic plug Open end cable with 6 pin mini din 200W auto tuner interface cable with Alinco 200W auto tuner interface cable with Icom 200W auto tuner interface cable with Kenwood 200W auto tuner interface cable with Yaesu FT 2000 200W auto tuner interface cable with Yaesu 200W auto tuner interface cable with Yaesu 200W auto tuner interface cable with Yaesu FT 2000 Patch cable 2 1mm to FT 817 pwer connector Alinco interface cable for MFJ 993 991 994 atu Icom interface cable for MFJ 993 991 994 atu Kenwood interface cable for MFJ 993 991 994 atu 55555 0 0 0 0 0 0 Yaesu interface cable for MF J 993 991 994 atu amp FT 100 FT 857 FT 897 FT 450 FT 950 Yaesu interface cable for MFJ 993 991 994 atu amp FT 847 only 22 95 22 95 22 95 329 95 249 95 22 95 34 95
196. 800 etc 9 95 TS 062 816 11 15 Microphone cable for Motorola RJ 45 1 5m long GM 300 350 680 1280 9 95 TS 062 817 11 15 Microphone cable with open end 9 95 TS 062 818 11 15 Microphone cable for Kenwoo Alinco 8 pin round 1 5m long 9 95 TS 062 819 11 15 Microphone cable for Icom Yaesu 8 pin round 1 5m long 9 95 PG 801 PowerGizzmo Controller interface between operator and various Gizzmo devices 199 95 DG 20 34 VHF head 100MHz 250MHz 200 Watts SO 239 Connectors 79 95 DG 50 34 UHF head 400 500MHz 200 Watts max N type connectors 79 95 DG 40 34 Dual VHF UHF head 144 148 amp 430 440MHz 200 Watts max N type connectors 89 95 SG 10 21 2 1 switch for 1 8 55 MHz 55 148MHz reduced spec with static protection 800W 74 95 SG 10 41 4 1 switch for 1 8 55 MHz 55 148MHz reduced spec with static protection 800W 88 95 BB 06 Breakout box total 6 outlets from Power Gizzmo 19 95 PGDS Optional PowerGizzmo desk stand with rubber feet 17 95 CAPP04 Cable assembly 5 pin lockable din plug to plug 4m long 6 95 SAGANT ANTENNAS SPROD 2BNC 2m 5 8th telescopic whip the original SUPER ROD BNC 26 95 SPROD 7 2m 70cms telescopic whip BNC 26 95 SCANNER ACCESSORIES 20 009 Clip on mini speaker with curly lead for handhelds 9 95 M 75 Mizuho 24 2150 MHz active variable pre amp for receivers BNC 89 95 SET PROTECTORS SP PRL Protective soft cover for President Lincoln transceiver 14 95 SP MDF Protective soft cover for Magnum Deltaforce Cobra 148 Su
197. 81 SOLAR code A14C 8681 HTT MKI Spare humidity temp sensor amp transmitter for W 8681 MKIl code 7 8681 HTT MKIl Spare humidity temp sensor amp transmitter for W 8681 MKIl code 14 8681 RGC Spare rain guage with cable for W 8681 8681 SHR Spare shroud only for humidity amp temperature sensor transmitter for W 8681 MKII 8681 SOL Spare solar panel with shroud for transmitter for W 8681 SOLAR 8681 WDC Spare wind direction indicator with cable for W 8681 8681 WSS Spare wind speed sensor with cups with cable for W 8681 8681 USB Spare USB lead for W 8681 8681 MSM Spare two part metal stub mast for W 8681 8681 SOLAR SHB Spare handbook for W 8681 SOLAR 8681 MKII SHB Spare handbook for W 8681 MKIl 8682 LCD Spare LCD display for W 8682 8682 H Spare humidity amp temperature sensor with built in transmitter for W 8682 needs 8681 SHR shroud 8683 LCD Spare LCD display for W 8683 8683 H Spare humidity amp temperature sensor with built in transmitter for W 8683 8684 H Spare or extra temperature sensor with built in transmitter for W 8684 8684 LCD Spare LCD display for W 8684 8685 H Spare temperature sensor with built in transmitter for W 8685 WATSON MOBILE ANTENNAS W VAW Mobile whip stainless steel adjustable 136 174MHz with cutting chart PL 259 base W UAW Mobile whip stainless steel adjustable 390 500MHz with cutting chart PL 259 base MULTI RANGER 9 Mobile whip 80 40 20 15 10 6 2m 70cm Airband PL 259 base 120 Watts 1 9m long max 1kg M
198. 83 FNB V94 FNB V67LI VAC 10C VAC 10U VAC 810C VAC 810U VAC 6010C VAC 6010U VAC 6810C VAC 6810U VCM 3 VCM 1 MH 37A4B MH 45B4B MH 450S MH 360S VC 25 DVS 5 FVP 25 FVP 35 VME 100 VMDE 200 LCC 410 LCC 410S LCC 420 LCC 420S CT 27 CT 42 FIF 10 CT 106 VX 414E 2 5 CN 3 VX 821E D0 VX 821E G6 VX 824E D0 VX 824E G6 VX 829E D0 VX 829E G6 ATV 8A ATV 8B ATV 8C ATU 6A ATU 6B ATU 6DS ATU 6C FNB V86LI FNB V87LI FNB V92L1 VAC 920C VAC 920U VAC 6920C VAC 6920U VCM 2 MH 50D7A MH 66A7A MH 66B7A DVS 5 FVP 35 FVP 36 VME 100 VMDE 200 LCC 820 LCC 820S LCC 820S TT CT 116 CT 109 FIF 10 CT 108 VX820 920 CN 3 VX 924E ATL 2A ATL 2B ATL 2C ATL 2D FNB V86LI FNB V87LI FNB V92LI VAC 920C VAC 920U VAC 6920C VAC 6920U VCM 2 MH 50D7A MH 66A7A MH 66B7A DVS 5 FVP 35 FVP 36 VME 100 VMDE 200 LCC 920S LCC 920TT LCC 920S TT CT 116 CT 109 FIF 10 CT 108 VX924 CN 3 VX 2100 D0 25 VX 2100 G6 25 VX 2200 D0 25 VX 2200 G6 25 MH 67A8J MH 75A8J MH 53A8J MD 12A8J MLS 100 MLS 200 VX 2100 MM VX 2100 SS LF 1 FVP 25 FVP 35 Spare NiMH battery pack 1400mAh 7 2V FOR VX 414 417 424 427 NiMH battery pack for 1800mAh 7 2V for VX 414 417 424 427 Lithium lon battery 7 4V 2000mAh for VX 414 417 424 427 Desktop rapid charger for FNB 83 and FNB V94 230V 2 pin Euro plug Desktop rapid charger for FNB 83 and FNB V94 230V 3 pin UK plug Desktop rapid charger for FNB V67 230V 2 pin Euro plug Desktop rapid charger for FNB V
199. 840 FT 100 YA C X cable set for Yaesu mini din to mini din FT 817 FT 857 FT 897 FT 900 FT 840 FT 100 YA D X cable set for Yaesu RCA RS232 FT 847 YA E X cable set for Yaesu FT 990 YA F X cable set for Yaesu RCA DIN FT 767 FT 736R YA G RX cable for Yaesu receiver FRG 100 KW A X cable set for Kenwood TS 2000 KW B X cable set for Kenwood TS 480 KW C X cable set for Kenwood TS 440 450 690 790 850 950 KW D X cable set for Kenwood TS 570 TS 870 KW E X cable set for Kenwood TS 50 KW F RX cable set for Kenwood R 5000 R 2000 AR A RX cable set for AOR AR 3000A AR B RX cable set for AOR AR 3030 5000 8200 8600 AR C RX cable set for AOR AR 7030 JRA RX cable set for JRC NRD 345 535 545 BONITO MARINE SOFTWARE Computer controlled receiver 0 04Mhz to 30MHz SSB CW FM DRM USB BONITO AMATEUR RADIO SOFTWARE METEOCOM 6UNI WM_ Meteorological data decoder amp analyser for all radios except PCR100 1000 inc 1yr Meteo Service METEOCOM 6PCR WM Meteorological data decoder amp analyser for PCR100 1000 only inc 1yr Meteo Service METEOCOM 6UNI NM Meteorological data decoder amp analyser for all radios except PCR100 1000 no Meteo Service 359 95 METEOCOM 6PCR NM Meteorological data decoder amp analyser for PCR100 1000 no Meteo Service METEOCOM 6WEB WM_ Meteorological data decoder amp analyser for web only no radio features inc 1yr Meteo Service PROMETEO 2UNI PROMETEO 2PCR Nautical weather data decoder for all radios except PC
200. 9 1dBd gain ZX 6 4 6m 4 element beam boom length 2 75m 11 4dBd gain ZX 6 5 6m 5 element beam boom length 4 35m 12 1dBd gain ZX 6 6 6m 6 element beam boom length 6 4m 12 5dBd gain ZX 11 2 11m 2 element beam boom length 0 9m 6 3dBd gain ZX 11 3CL 11m 3 element beam boom length 3 0m 9 1dBd gain ZX 11 4CL 11m 4 element beam boom length 5 0m 11 4dBd gain ZX 11 4DX 11m 4 element beam boom length 5 8m 12 0dBd gain ZX 11 5DX 11m 5 element beam boom length 8 0m 12 7dBd gain ZX 11 5ITB 11m 5 element beam boom length 5 6m 11 7dBd gain ZX 11 6DX 11m 6 element beam boom length 11 4m 12 5dBd gain ZX 11 7 11m7 element beam boom length 14 0m 14 1dBd gain ZX 10 2 10m 2 element beam boom length 0 9m 6 3dBd gain ZX 10 3CL 10m 3 element beam boom length 3 0m 9 1dBd gain ZX 10 3DX 10m 3 element beam boom length 3 6m 10 3dBd gain ZX 10 4CL 10m 4 element beam boom length 5 0m 11 4dBd gain ZX 10 4DX 10m 4 element beam boom length 5 8m 12 0dBd gain ZX 10 5DX 10m 5 element beam boom length 8 0m 12 7dBd gain ZX 10 6CL 10m 6 element beam boom length 11 4m 12 5dBd gain ZX 10 7 10m 7 element beam 14 1dBd gain ZX 12 2 12m 2 element beam boom length 1 1m 6 3dBd gain ZX 12 3 12m 3 element beam boom length 3 5m 9 1dBd gain ZX 12 4 12m 4 element beam boom length 5 5m 11 4dBd gain ZX 12 5 12m 5 element beam boom length 8 6m 12 1dBd gain ZX 12 6 12m 6 element beam boom length 14 5m 12 7dBd gain ZX 15 2 15m 2 element beam boom length 1 3m 6 3dBd gain ZX 15 3 15m 3 element beam
201. 9 socket 4m cable amp BNC plug Magnetic mount SO 239 socket 4m cable amp PL 259 plug Magnetic mount SO 239 socket 4m cable amp SMA plug Triple magnetic mount needs cable kit Motor driven antenna mount needs either KRS or KRR or KTH Strong magnetic mount 2 axis adjustable needs cable kit Strong magnetic mount needs cable kit Magnetic mount BNC socket 3m coax amp BNC plug Heavy duty magnetic mount SO 239 socket coax amp PL 259 plug Deluxe heavy duty magnetic mount SO 239 base coax and N plug Deluxe heavy duty magnetic mount N socket coax and N plug Deluxe heavy duty bootlip mount with angle adjust needs cable kit Mount for mirror or roof bar needs cable kit 54 95 27 95 34 95 41 95 36 95 38 95 29 95 31 95 34 95 32 95 36 95 42 95 27 95 31 95 36 95 34 95 42 95 35 95 42 95 44 95 49 95 64 95 54 95 52 95 52 95 52 95 59 95 69 95 43 95 24 95 36 95 39 95 49 95 49 95 29 95 14 95 AADDADAADADAADAAAAAADADAAADAADDADADDADADAADADADADDDDDDADTDAADADAADAADADAADAAAAAAADAADAAAADADASFADADAAAAAAAAVQIAIAIAA FEAQDAQDAADAAAAADAAAAAAADAAAADAAAAAAAAAAAAO a S ABBAaS IOD x 3613 Cable kit for mobile antenna SO 239 socket base coax amp PL 259 plug 4m long Cable kit for mobile antenna N socket base coax amp N plug 5m long Cable kit for mobile antenna SO 239 socket base coax amp N plug 5m long Cable
202. 938 220921 220922 699 95 599 95 639 95 829 95 119 95 119 95 44 95 129 95 159 95 459 95 99 95 119 95 149 95 239 95 119 95 189 95 279 95 119 95 279 95 859 95 99 95 99 95 99 95 99 95 99 95 99 95 99 95 99 95 99 95 99 95 99 95 99 95 99 95 99 95 19 95 19 95 19 95 19 95 19 95 19 95 19 95 19 95 19 95 19 95 19 95 11 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 7 95 8 95 11 95 17 95 12 95 11 95 1 50 4 95 7 95 5 95 7 95 0 95 47 95 34 95 21 95 3 95 13 95 7 95 6 95 4 95 7 49 14 95 22 95 109 95 49 95 54 95 229 95 118 95 73 95 98 95 79 95 88 95 139 95 114 95 168 95 148 95 139 95 179 95 289 95 228 95 74 95 94 95 143 95 119 95 119 95 gt 000000 E EE EE E EE B y LS E A A A A E E A A E L La O Laa a a a a lara PE EE ee E I E E D E H T C02 gt gt gt is vev0000000000000000 220901 70cm 430 440MHz low profile patch antenna 8dBi gain N socket 119 95 220319 70cm 430 440MHz 19 element PRO XL series N socket 152 95 220329 70cm 430 440MHz 27 element PRO XL series
203. 94 Spare belt clip 11 95 MB 96 Swivel belt hanger 18 95 MB 96F Fixed type non swing belt hanger 18 95 MB 96N Swivel type leather belt hanger 18 95 OPC 478 Cloning cable computor 28 95 OPC 478UC Cloning cable for radio to PC USB cable 46 95 OPC 656 DC cable 12 20V for BC 121N 8 95 EARPIECE 003 Rubber D style earpiece 10 95 VS 1 IC VOXIPTT unit 30 95 CS F4029SDR Programming software for IC F4029SDR on CD ROM 82 95 SM F4029SDR Service manual for IC F4029SDR on CD ROM 68 95 ICOM PMR HANDHELD TRANSCEIVERS amp ACCESSORIES IC F1000 PMR transceiver 136 174MHz VHF 16 channel c w battery charger amp aerial no display 159 95 IC F1000S PMR transceiver 136 174MHz VHF 128 channel c w battery charger amp aerial 4 key display 189 95 IC F1000T PMR transceiver 136 174MHz VHF 128 channel c w battery charger amp aerial display amp keypad 209 95 IC F2000 PMR transceiver 400 470MHz UHF 16 channel c w battery charger amp aerial no display 159 95 IC F2000S PMR transceiver 400 470MHz UHF 128 channel c w battery charger amp aerial 4 key display 189 95 IC F2000T PMR transceiver 400 470MHz UHF 128 channel c w battery charger amp aerial display amp keypad 209 95 BC 157S PSU for BC 214 six way charger 92 95 AD 130 Charger adaptor as supplied with BC 214 14 95 OOO OOO K OOGOGOOOOOOOOK OO KO CTC b r C E E E E C3 C1 PC PC EC CTC PCT CT EC C D PE DP TC I C P C3 C3 C C3 Ci CT CT CC E ERE CC TCC E PCT PET C3 Or FARQRQ
204. 95 128 95 31 95 15 95 15 95 47 95 5 95 21 95 47 95 21 95 46 95 57 95 36 95 18 95 99 95 0 00 52 95 126 95 9 95 41 95 62 95 31 95 0 00 18 95 21 95 27 95 57 95 21 95 10 95 28 95 46 95 21 95 51 95 279 95 31 95 52 95 128 95 31 95 47 95 12 95 31 95 15 95 18 95 57 95 10 95 46 95 19 95 36 95 0 00 52 95 126 95 253 95 34 95 28 95 46 95 19 95 62 95 31 95 27 95 18 95 14 95 57 95 21 95 19 95 45 95 4 95 70 95 41 95 62 95 31 95 46 95 52 95 27 95 57 95 21 95 10 95 28 95 21 95 18 95 25 95 189 95 70 95 19 95 14 95 18 95 25 95 14 95 31 95 15 95 20 95 31 95 OOO OOO EE alaa alaa lalalala TK O TO TO OOO OOO OOO KO e O T T K D T T T LS 1 1 A 1 A 1 1 FWorrrrrrarannnd gt s TK T T T K T AD 92SMA Antenna connector adaptor SMA plug to BNC socket for IC T70E FA S270C Spare flexible aerial for IC T70E HM 131 Compact type speaker microphone for IC T70E HM 153 Durable type earphone microphone for IC T70E HS 94 Headset earpiece type for use with VS 1 IC and IC T70E needs OPC 2006 HS 95 Headset with boom microphone for use with VS 1 IC and IC T70E needs OPC 2006 HS 97 Earphone with
205. 95 18 95 18 95 10 95 8 95 104 95 129 95 83 95 69 95 586 96 586 96 124 95 18 95 14 95 18 95 18 95 18 95 94 95 11 95 11 95 18 95 14 95 66 95 394 95 14 95 POOR E PCT P P I CI C1 OD C ea E CT T C E CC T P OOOO OODO HOPP E OD TC C C C3 E PEPER E P OD ECC CC CTET CC OO C3 PODPRETE CH E C3 BC 152 BC 157 CP 23L BP 226 FA S62VS OPC 515L OPC 966 OPC 966 002 HM 168 CS F51 61 SM F51 62 IC F44GS MPT IC F44GT MPT AD 106 BC 119N F34 44 BC 121N F34 44 BC 145 BC 157 BC 160 BP 232N FA SC25U FA SC57US FA SC73US HM 153L HM 158LA HM 159L HM 166L HS 94 HS 95 HS 97 VS 1L MB 93 MB 94 MB 96 MB 96F MB 96N CP 23L OPC 515L OPC 656 OPC 478 OPC 478UC UT 109 UT 110 EARPIECE 003 CS F44G MT SM F44G MT IC F3162S IC F3162T IC F4162S IC F4162T AD 106 AD 52 BC 119N 15 25 BC 121N 15 25 BC 145 BC 157 BC 160 BNC 021 BP 231 BP 232N BP 240 FA SC25U FA SC55V FA SC57US FA SC57VS FA SC73US HM 131SC HM 159SC HM 168 HM 169 HM 170GP GPSMIC 001 HS 94 HS 95 HS 97 MB 93 MB 94 MB 96F MB 96N OPC 966 OPC 966 002 UT 96R UT 109R UT 110R UT 126H UT 124R VS 1SC EARPIECE 003 CS F3160 SM F3160 Desktop charger for IC F51 Spare AC adaptor for BC 121 12V cigarette lighter lead for charging or 12V supply Dry cell case for IC F51 5 x AA cells Aerial VHF 150 162MHz Bare ends DC lead for battery charging or 12 V supply Cloning cable serial Cloning cabl
206. 95 216 95 216 95 55 95 55 95 259 95 289 95 299 95 104 95 GGOGOGOOOOGOGOOOOOGOGOGOGOGOGOGOOOGOGOGOGOGOGOGO OOO GO GGO GOGOGOOGO TG T K T T GGG OOO vv00000 GOGO EA E T EG MISCELLANEOUS ITEMS W 898 X1M PLATINUM TN 90 CHA 250BX2 CAT 273 F 50MR 422 OPB4U1 QBM500PMKII LA150PLUS LA150VPLUS LA300PLUS LA300VPLUS LA 350 787 267 RM KL203P 421 753 421 741 SPPT 171A IKL EU IKL 240 B 13A B EU CP 23 14 3477 MLP 32 C 993 SS 10 MPFC C SEAL FS 50A FS 60B INSUL 8M INSUL 8L EGG SQ EGG PL APE SBS 3 RMX SIIIIQVJIOQO S SG muy Leixen 2m 70cm 10w mobile dualband transceiver QRP HF transceiver 80 10m 5W out 12V Panel meter Comet Vertical no ground plane 3 5 57MHz 250W SSB 23 5 long 2m 70cm ATU 250W Low pass filter 1KW PEP 500W CW 0 54MHz SO 239 HF multiband dipole 7 14 21 28 Tait Orca Battery 1500mAh 2m 70cm colinear 2 5m long 200W N socket 1 8 30MHz 150 W amplifier all mode 1 10W in 1 8 30MHz 150 W amplifier all mode 1 10W in with fan 1 8 30MHz 300 W amplifier all mode 1 15W in 1 8 30MHz 300 W amplifier all mode 1 15W in with fan 1 8 30MHz amplifier all mode 300W out built in 230V PSU 20mm quick blow glass fuse 5 Amp HF linear amp 12 14V 20 30MHz 0 5 10W in AM FM or 1 20W SSB in 100W AMFM 200W SSB out Car lighter plug PSU with USB port 12V 5 2V out 1000mA max Switch mode PSU with USB port 3 pin UK mains plug 100 240V 5 2V out 10
207. 95 31 95 22 95 17 95 99 95 44 95 09 95 17 95 44 95 17 95 18 95 39 95 59 95 219 95 3 59 95 319 95 2 2 2 M M M D D D MD D mm D D MD M 49 95 99 95 219 95 99 95 79 95 99 95 69 95 09 95 49 95 59 95 49 95 49 95 49 95 39 95 99 95 99 95 69 95 89 95 99 95 99 95 69 95 419 95 419 95 3 3 2 3 7 7 7 4 4 4 1 0 1 0 7 T 2 3 2 1 i 3 4 69 95 59 95 99 95 29 95 39 95 39 95 39 95 69 95 69 95 69 95 199 95 99 95 39 95 39 95 39 95 84 95 99 95 79 95 89 95 27 95 27 95 27 95 27 95 27 95 27 95 27 95 27 95 27 95 27 95 27 95 27 95 27 95 29 95 89 95 69 95 49 95 79 95 91 95 19 95 D 61 95 99 95 44 95 7 95 13 95 12 95 1 39 95 26 95 24 95 29 95 09 95 89 95 89 95 12 95 21 95 16 95 1 fi 42 95 46 95 39 95 69 95 26 95 5 95 34 95 219 95 99 95 79 95 22 95 19 95 1 99 95 TO O O T K e T C3 ET EEE CE3 CC CCC CAEC CC CC CET EE C C3 CE3 CCC CTE C3 CTC C3 e e T e T e e e HE al a FLOR SESE G TWO TOOT T TOOT TOOT T T GOGO TOO GOGO W3 MGK W3 CAP W3 STK W3 BMA W3 CWA W3 BIF W3 6KIT W3 50 Mast guying kit Folding capacity hat Soft touch knob Bud
208. 95 729 95 1 199 95 849 95 899 95 1 699 95 35 95 899 95 1 389 95 999 95 1 049 95 129 95 79 95 49 95 33 95 419 95 69 95 169 95 434 95 329 95 169 95 219 95 109 95 299 95 1 199 95 399 95 134 95 379 95 479 95 569 95 479 95 EG ECE C3 CT CC CE EE EEE CE C OO OOD PPDP ELL Laa ELl GG Qm mOOOOmOOOOOOOOOM O EBED GG GGG GGG G G DX 88 10 12 15 17 20 30 40 80m Vertical 1 5kW 25 KIT 160 88 160m add on kit for DX 88 GRK 88 Ground radial system for DX 88 RRK 88 Roof radial system for DX 88 LC 160Q 160m mod kit for AV 18HT 150 W MK 160A 160m mod kit for AV 18HT 1 KW MK 6 6m add on kit for most HF yagis and rotatable dipoles MK 17 17m add on kit for AV 14AVQ MK 80 80m add on kit for AV 14AVQ HYGAIN BEAM amp WIRE ANTENNAS DIS 71 30 40m rotatable dipole 1 5kW 45 element length DIS 72 30 40m beam 1 5kW 44 8 element length 2 elements DIR 73K Add on director kit for DIR 72 to make 3 element beam LJ 103BA 10m beam 1 5kW 8 boom 3 elements LJ 105CA 10m beam 1 5kW 24 boom 5 elements LJ 153BA 15m beam 1 5kW 12 boom 3 elements LJ 155CA 15 12m beam 1 5kW 26 boom 5 elements LJ 203BA 20m beam 1 5kW 16 5 boom 3 elements LJ 204BA 20 17m beam 1 5kW 26 boom 4 elements LJ 205CA 20 17m beam 1 5kW 34 boom 5 elements LP 1009A Log periodic 13 30MHz 1 5kW 39 longest element PL 259 plug LP 1009AN Log periodic
209. 95 A AOR SAMPLER PC windows software on CD ROM for 8600 4 95 A AR ONE Mobile desk top scanner 10KHz 3 3GHz 12v 240V PSU extra if req 3 969 95 D AR ONE C Frequency and phase coherent version of AR ONE 4 299 95 D AR ONE BB Black box receiver version of AR ONE for computer control List 3 699 95 D AR ONE RPF AR ONE with additional remote front head 4 199 95 D ONE PSU Mains power supply for AR ONE special DC plug 230V 12V 59 95 C ONE DC DC lead with plug for AR ONE 13 95 A CABLE ONE Heavy duty data cable for AR ONE 79 95 C EXT ONE Remote kit for AR ONE 449 95 C CONTROL HEAD ONE Control head with CPU front panel 699 95 C ONE PLATE Spare blanking plate for AR ONE BB 35 95 A MM 8600 Mobile mount for AR ONE 79 95 C SM ONE Service manual for AR ONE 39 95 C OP ONE Spare operating manual for AR ONE 6 95 C SR 2000PC Custom RS232 lead for PC 9 pin female to female for SR 2000A 22 95 A SM SR2000 Service information for SR 2000 CD PDF 44 95 A SM SR2000A Service information for SR 2000A printed 39 95 C SM SR2000A CD Service information for SR 2000A on CD ROM 19 95 C SRUB Substitute PC socket mounts on SDU 5600 to convert to USB driver disc supplied 59 95 C SR 2200 Black box receiver 25MHz 3GHz for use with PC no PSU 25MHz 3GHz 1 199 95 D PSU 5500 230V mains UK power supply for SR 2200 48 95 C CONTROL HEAD ONE Control head with CPU front panel 769 95 C CABLE ONE Heavy duty data cable for SR 2200 88 95 C EXT ONE Rem
210. 99 95 69 95 49 95 39 95 34 95 1 479 95 479 95 3 999 95 22 95 6 95 6 95 5 95 TT T T T T T 0333 OOO OOO TT T TOOT OOO TOO OD OO OOG GO EC CTC OOO T GOGO TGO GO Lae a Kar a La La a a a a a L 000 rrr FLEX RADIO FLEX 1500 Software defined radio QRP 500mW 5 Watts 160 6m 599 95 MH 31A8J Hand mic for FLEX 1500 8 pin modular 32 95 ACC 1500 PWR Spare power cable for FLEX 1500 14 95 FLEX 3000 Software defined radio 100 Watt PEP 160 6m HF SSB CW FM AM trevr for PC built in ATU DSP himic 1 199 95 MH 31A8J Hand mic for FLEX 3000 8 pin modular 32 95 ACC F3KF5K PWR Spare power cable for FLEX 3000 5000 27 95 FLEX 6300 ATU High Performance SDR transceiver HF amp 6m 100W DSP SmartSDR optional ATU up to 2 RX 2 259 95 FLEX 6300 High performance SDR transceiver HF amp 6m 100W DSP SmartSDR up to 2 RX 1 969 95 ATU 6300 Automatic antenna tuning unit upgrade 160 6m for FLEX 6300 299 95 HANDLES 6300 Cabinet handles for Flex 6300 69 95 FLEX 6500 Advanced performance SDR transceiver HF amp 6m 100W DSP ATU for PC with SmarfSDR up to4 RX 3 499 95 FLEX 6700 Ultimate performance SDR transceiver HF amp 6m 100W DSP ATU for PC with SmartSDR up to8 RX 5 799 95 FLEX 6700R SDR HF amp VHF receiver for PC with SmartSDR up to 8 RX 0 3 77 amp 135 165MHz RX 4 699 95 FLEX 6000 GPSDO Optional GPS disciplined Oscillator 899 95 FLEX CONTROL Interface for FLEX
211. 99 A NISSEI SWR amp POWER METERS RX 103 SWR POWER meter fwd ref average PEP X needle 1 6 60MHz 20W 200W 2kW SO 239 12v 49 95 C RX 203 SWRI POWER meter fwdiref average PEP X needle 1 8 200MHz 2 20 200W SO 239 12v 49 95 C RX 403 SWR POWER meter fwdiref average PEP X needle 125 525MHz 2 20 200W SO 239 12v 49 95 C OM POWER OM 1500 Linear amplifier for HF amp 6m 1 5kW built in PSU Tube is a GS23B Ceramic tetrode 2 895 95 D OM 2000 HF Linear amplifier for HF 1 8 29 7MHz 40 60w in max 2kW out 3 295 95 D OM 2000 Linear amplifier for HF 1 8 29 7MHz inc WARC amp 50MHz 40 60w in max 2kW out 3 795 00 D OM 4000 A Linear amplifier for HF 1 8 29MHz 60 80W in max 4000W out 5 995 95 D OM 4000 HF Linear amplifier for HF 4kW solid state built in PSU 1 8 29 7MHz 4 999 95 D OM 2500 HF Linear amplifier for HF 1 8 29MHz 40 60W in max 2500W out 3 995 95 D OM 2500 A Linear amplifier for HF 1 8 29 7 MHz 60 80W in max 2 5kW out 4 895 95 D OM 2006 Linear amplifier for 6m 50 52MHz 30 40w in max 2kW out 3 180 95 D OM 3006 Linear amplifier for 6m 50 52MHz 40 60w in max 3kW out 4 140 95 D OM 1002 Linear amplifier for 2m 1kW solid state built in PSU 144 146MHz 2 295 95 D OM 1006 Linear amplifier for 6m 1kW solid state built in PSU 50 54MHz 2 295 95 D REMOTE 2500 4000 Remote control for OM 2500 A amp OM 4000 A 349 95 D OM 6BPF HF band filter 1 8 29MHz 200 Watts 795 95 D OPTOELECTRONICS DIGITAL FREQUENCY COUNTERS AND ACCESSORIES V SWEEPER FM Nearf
212. 9DACX MFJ 269C accessory pack MFJ 39D soft case MFJ 66 dip coils MFJ 1312DX PSU 79 95 MFJ 39DABCX MFJ 269C accessory pack MFJ 39D soft case MFJ 66 dip coils MFJ 1312DX PSU amp 10 AA Ni MH 119 95 MFJ 43 Optional real time clock for MFJ 1278 12 95 MFJ 45B 128K extra mailbox memory for 1270C 1276 1278 34 95 MFJ 45C 512K extra mailbox memory for 1270C 1276 1278 109 95 MFJ 47A 32K mailbox memory expansion board for older MFJ TNC s 55 95 MFJ 47B 128K mailbox memory expansion board for older MFJ TNC s 77 95 MFJ 47C 512K mailbox memory expansion board for older MFJ TNC s 179 95 MFJ 48 Eprom firmware upgrade for MFJ 1278 1278T 29 95 MFJ 49BM MultiCom 3 1 upgrade 45 95 MFJ 52B TNC2 deviation meter board tests deviation temperature amp voltage 45 95 MFJ 56B 128K mailbox expansion for MFJ 1278 99 95 MFJ 57B PVC cross unit to mount antenna on MFJ935 936 20 15m 39 95 MFJ 58B PVC cross unit to mount ant on MFJ935 936 extra wire loops for 10 12 15 20 40m 58 95 MFJ 63 80 40m coil assembly for MFJ 1644 45 95 MFJ 66 Dip coil set for MFJ 249 MFJ 259 MFJ 269 1 8 170 MHz only 29 95 MFJ 66C Dip coil set for MFJ 249 MFJ 259 MFJ 269 1 8 220 MHz 32 95 MFJ 70 Remote control for MFJ 495 32 95 MFJ 72 MFJ 616 accessory pack headphones 2 speakers PSU 84 95 MFJ 73 Remote control pad for 434 voice keyer 42 95 MFJ 78 Full function remote control for MFJ 492 41 95 MFJ 80 8k memory for MFJ 492 25 95 O e CC EC CCC CT CE EE EE EC C C
213. 9N AD 101 CP 20 Handheld airband transceiver VOR NAV BP 208N CP 20 MB 103 FA B02AR Handheld airband transceiver BP 210N Ni MH OPC 499 BC 119N AD 101 CP 20 Handheld airband transceiver BP 208N dry cell case CP 20 MB 103 FA B02AR BC 119N 121 charger adaptor for BP 209 210 211 222 Charger for IC A6 A24 2 pin 220V Fast charger includes AD 101 amp BC 145 for BP 209 210 211 6 way fast charger including 6 x AD 101 adaptors and BC 124 for BP 209 210 211 Rapid charger with AC adaptor BC 145 and AD 99 AC adaptor for BC 119N amp BC 144N Spare AC adaptor for BC 121 Cigarette lighter cable with DC DC converter for ICA6 A24 Dry cell case 6 x AA for IC A6 A24 NiMH battery pack 7 2V 1650mAh Spare flexible aerial for IC A6 24 Carry case for IC A6 24 Spare Belt clip alligator type Swivel belt clip Swivel type leather belt hanger Fixed type non swing leather belt hanger Cloning cable for radio to PC USB cable Headset adaptor with PTT socket DC cable 12 20V for BC 121N Speaker mic for IC A6 and IC A24 Programming software needs OPC 478 U Service manual for IC A6 24 ICOM MARINE TRANSCEIVER AND ACCESSORIES IC M23 AD 123 BC 07 BC 119N 004 BC 145 CP 24 BP 266 FA SC58V MB 124 OPC 2091 OPC 478 OPC 478UC SM M23 CS M24 IC M35 BC 01 BC 145 BC 162 BC 173 CP 23L BP 251 BP 252 FA SC58V HM 165 MB 109 OPC 478 OPC 478UC OPC 1655 SM M35 CS M35 IC M73EURO IC M73PLUS Handheld marine transceiver small and light
214. A 23M3 RA 27M RA 27M3 KNB 33L KNB 54N KBP 6 KSC 32T KSC 326T KMB 30M KMC 38GPS KLH 125 KLH 135 KLH 136 KBH 11 KCT 48VU KEP 1 KHS 11BL KHS 12BL KHS 14 KHS 15 OH KMC 41 VGS 1 KPG 36A KCT 53U KPG 92D TK 7360E BBABBAAAAAAAAABZAAZZZZZZZZZZABBBBqB VHF handy 136 174MHz 12 5 25KHz 1 5W 250 CH needs aerial battery charger UHF handy 440 470MHz 12 5 25KHz 1 4W 250 CH needs aerial battery charger UHF handy 400 430MHz 12 5 25KHz 1 4W 250 CH needs aerial battery charger Rapid charger for Ni Cd Ni MH Li lon batteries for TK 2140 3140 6 way charger for KNB 35L 26N 25A TK 2140 3140 Optional wall hanging bracket for KSC 256T for TK 2140 3140 Li lon battery 1480mAh Ni MH battery 1400mAh replaces KNB 25A and KNB 26N Li lon battery 2000mAh replaces KNB 35L and KNB 26N Ni Cd battery 7 2V 1200mAh for TK 2140 3140 Ni MH high capacity battery 7 2V 2000mAh for TK 2140 3140 Dry cell case 6 x AA for TK 2140 3140 Accessory adaptor to twin jack fitting for TK 2140 3140 Earphone for use with KMC 25 for TK 2140 3140 Palm microphone kit 2 wire for TK 2140 3140 Mini lapel microphone kit 3 wire for TK 2140 3140 Headset with boom microphone for TK 2140 3140 Heavy duty headset for TK 2140 3140 Speaker microphone for TK 2140 3140 VHF short antenna 146 162MHz for TK 2140 VHF short antenna 162 174MHz for TK 2140 VHF short antenna 136 150MHz for TK 2140 UHF short antenna 440 490MHz for TK 3140 UHF short antenna 470 520MHz for TK 3140 green U
215. A 35RSRPW 400W type lightning surge protectors Antenna splitter amp combiner for receiver 0 5 500 MHz 3 x SO 239 Wide band pre amplifier 0 5 1500MHz 20dB gain 2 x SO 239 2m 70cms duplexer 1 x N type socket to 1 x PL259 amp 1 x N plug 2m 70cms duplexer 1 x SO 239 to 2 x PL259 2m 70cms duplexer 1 x SO 239 to 1 x N plug amp 1 x PL 259 HF and 6m 2m and 70cm duplexer 1 x SO 239 amp 2 x PL 259 HF and VHF UHF duplexer 1 x SO 239 amp 2 x PL 259 500 600W FT 8900 HF one side 6 2 70 other 6m 2m 70cm triplexer three x PL 259 6m 2m 70cm triplexer 2 x PL 259 1 x N Plug 1 x N socket 1 6 60 110 170 amp 300 950MHz 2m 70cms 23cms triplexer two PL 259 amp 1 X N 2m 70cms 23cms triplexer N connectors Dummy Load DC 1000MHz SO 239 type Dummy Load DC 1500MHz 15W average 100W peak N type Mobile speaker 8 Ohm 5W 75wx69hx31d mm Mobile speaker built in preamp volume control noise filter 12v 3W 85wx75hx43d mm Mobile speaker built in preamp volume control noise filter 12v 6W 142wx113hx57d mm Mobile speaker with noise filter 8 Ohm 6W 113wx93hx43d mm with mute 8dB switch Mobile speaker built in preamp volume control noise filter 12v 6W 113wx93hx49d mm Glass fibre telescopic pole DIAMOND SPEAKER MICROPHONES amp EARPIECES MS 800M MS 800K Hand held speaker microphone 2 pin straight plug for Icom Standard Yaesu Alinco Hand held speaker microphone 2 pin right angled plug for Kenwood 11 95 49 95 51 95
216. ADCOMS RC 08 CD ROM of all 2008 RADCOMS CS2014 CD Callseeker RSGB UK amp Europe Amateur Radio Callbook 2014 edition CD MAPS WPMM MAP World prefix map wall A2 size full colour WPMD MAP World prefix map desk A3 size full colour GRTW MAP Great Circle DX wall map A2 size full colour GRTD MAP Great Circle DX desk map A3 size full colour GRTS MAP Great Circle DX desk map M size full colour LOCW MAP European Locator map wall A2 size full colour LOCD MAP European Locator map desk A3 size full colour LOCS MAP European Locator map desk M size full colour BOOKS OTHER CS2009 BK Callsign 2009 Civil amp Military UK amp Nato callsigns WRTVH 14BK World Radio amp TV Handbook 2014 edition SCAN 6BK Scanners 6 by Peter Rouse amp Bill Robertson June 2009 Edition HR BK The Ham Radio Handbool SSQR BK How To Get Started In QRP UIWD BK e UK amp Ireland Waypoint Directory Seldec 2010 Edition AACC BK Airport amp City Codes Seldec NAWA BK e North Atlantic Waypoints Atlas with colour charts Seldec CASH BK Calling Shanwick Seldec 7th Edition DOAC BK Directory Of Airline Codes amp Call Signs Seldec 2010 Edition LTTB BK HF Airband Frequency Guide 2 30MHz Seldec 1st Edition October 2006 DOAS BK Directory Of Aircraft Selcals Seldec 8th Edition TRBC BK e Radarbox Companion Seldec GTAR BK Guide To The AirNav RadarBox Seldec WATL BK Atlantic Airline Routes Seldec October 2009 8th Edition PAMF BK e Pocket UK amp Ireland VHF Ma
217. AK 3 MC 100 CB DS CB PCR CB C15 CB R20 RAKKER CRO RF 1 BATT A 100S C 100 0PTO PTO PSU UK PTO PSU EU PL PSU C 06 PSU a ie oow lt W x PALM RADIO MP S MP 817 TRAVEL CASE PPK PK MAGNETS CC M CC M SOLO HK CC PEG LEG 70 tenna 50 54MHz tenna 144 165MHz BNC Rubber duck antenna 440 480MHz BNC Rubber duck antenna 500 1000MHz BNC Rubber duck antenna 2 4 2 5GHz BNC 150 1000MHz receive mini rubber duck antenna BNC Rubber duck antenna 100MHz 2GHz BNC RD 27 RD 150 RD 440 RD 800 amp DB 32 RD 27 RD 150 RD 440 RD 800 DB 32 amp BB 85 RD 27 RD 150 RD 440 RD 800 DB 32 BB 85 amp RD 2400 Separate antenna for micro counter Download amp datalogging cable for Digital Scout Reaction tune cable for Digital Scout amp Icom PCR 1000 Reaction tune cable for Scout amp Icom IC R10 Reaction tune cable for Scout Digital Scout Spectrum Scout CD100 Xplorer Xsweeper Icom and IC R20 Communications decoder including trunk tracking Micro RF decoder Spare nicad battery pack for Optoelectronics M1 M1TCXO elescopic whip BNC 100 600MHz Universal belt clip self adhesive for cub etc Spare charger for Optoelectronics counters 3 pin UK plug Spare charger for Optoelectronics counters 2 pin Euro plug Spare charger for Optoelectronics Xplorer Spare power supply for X SWEEPER Spare power supply for V SWEEPER Rubber duck an Rubber duck an Mini Paddle key Elecraft grey Mini Paddle key black w
218. AL 572XCE Linear Amplifier 10 160m 1 3kW 4 x 572B AL 572XQCE Linear Amplifier 10 160m 1 3kW 4 x 572B with QSK 5 installed AL 80BXCE Linear Amplifier 10 160m 4kW 1 x 3 500Z AL 80BXQCE Linear Amplifier 10 160m 1kW 1 x 3 500Z with QSK 5 installed AL 811XCE Linear Amplifier 10 160m 600W 3 x 811A AL 811HXCE Linear Amplifier 10 160m 800W 4 x 811A AL 811HDXCE Linear Amplifier 10 160m 800W 4 x 572B ALS 1300X Linear Amplifier solid state HF 1200W ALS 600X Linear Amplifier solid state 10m 160m 600W with 220V AC PSU Export only ALS 500MXCE Linear Amplifier solid state 12V mobile 10m 160m 500W ALS 500MRXCE ALS 500MXCE plus ALS 500RC remote controller ALS 500RC Remote controller for AL SOOMXCE ARF 500K Remote kit for ALS 500MXCE with serial numbers below 13049 ARF 500K2 ALS 500M upgrade kit ARI 500 amp ARF 500 ARI 500 Ameritron ALS 500M radio interface ADL 1500 1 5kW dummy load with oil ADL 1500X 1 5kW dummy load without oil ADL 2500 2 5kW dummy load with cooling fan ARB 704 Amplifier to radio interface for most rigs ARB 70412 Amplifier to radio interface for Icom IC 706 only ARF 1000 RF filter 1 5 30MHz 1KW PEP ATP 100 Tuning pulser for amplifiers ATP 102 Tuning pulser for amplifiers deluxe version ATR 20X 1 8 30MHz 1 5kW ATU SWR PWR meter 220 Volts ATR 30X 1 8 30MHZz roller inductor ATU SWR PWR meter 220 Volts AWM 20 SWR POWER meter 1 6 60MHz 3KW AWM 22 SWR POWER meter 1 8 200MHz 200 Watts AWM 24 SWR POWER meter 1 8 60 amp 143 525MHz
219. AQAQ00 BC 214 BC 123S BC 213 UK6WAY BP 278 BP 279 FA SC55V FA SC57U FA SC57VS FA SC73US HM 168LWP HS 94 HS 95 HS 97 VS 4LA HM 153LA HM 166LA MB 133 MB 130 CP 23L OPC 656 OPC 478UC CS F2000 HM 158LA HM 159LA IC F3002 IC F4002 UK6WAY BC 06 BC 193 BP 263 BP 265 FA SC55V FA SC57U FA SC57VS FA SC73US HM 158L HM 158LA HM 159L HS 94 HS 95 HS 97 OPC 2004 CS F3000 OPC 474 OPC 478 OPC 478UC CP 23L OPC 515L LC 174 MB 124 IC F25S AD 106 BC 119N 15 25 BC 121N 15 25 BC 145 BC 157 BC 160 BP 231 BP 232N CASE 056 CASE 062 BNC 021 FA SC24V FA SC25U FA SC55V FA SC57US FA SC57VS FA SC73US HM 46L HM 75A HM 128L HM 131L HM 153L HM 158LA HM 159L HM 166L HS 94 HS 95 HS 97 EARPIECE 003 MB 93 MB 94 MB 96 MB 96F OPC 478 OPC 478UC OPC 656 UT 109 UT 110 UT 113 UT 124 VS 1L CS F15 25 SM F15 25 IC F3022S IC F3022T IC F4022S IC F4022T IC F4032S AD 106 BC 119N 15 25 BC 121N 15 25 BC 145 BC 157 BC 160 BP 231 BP 232N FA SC25U FA SC55V FA SC57US FA SC57VS FA SC73US HM 153L HM 158LA HM 159L 6 way charger PSU for BC 213 single charger Single fast charger 6 way charger excluding pods Li ion battery pack 7 2V 1130mAh approx 10 hours operating time Spare Li ion battery pack 7 2V 1485mAh approx 14 hours operating time VHF antenna for 150 174MHz UHF antenna for 430 470MHz 80mm Stubby antenna 160 174MHz 60mm Stubby antenna 450 490MHz Waterproof speaker microphone IP67 Headset ear pi
220. All the staff here work hard to assure that you receive their best attention at all times please put them to the test EXTENDED GUARANTEES NOW AVAILABLE ON ALL AMATEUR RADIO PURCHASES N B ALL PERIODS INCLUDE THE MANUFACTURERS GUARANTEE For Items with 2 Year Guarantee ICOM Yaesu For Items with 1 Year Guarantee a A a a a Product Code Description RRP Carr EBC 18 Spare belt clip for DJ X3 4 95 ADI MOBILE HANDHELD ACCESSORIES ALINCO HF VHF MOBILE BASE STATION TRANSCEIVER DTF 146 DTMF unit for any ADI mobile rig 1795 A DX SR9E All band HF SDR 100W 12V mobile transceiver 599 95 MB ADI Mobile mount for ADI VHF or UHF mobile transceiver 15 95 A EDX 2 Auto ATU for DX SR9E for wire antenna 289 95 DTF 145 DTMF unit for any ADI handheld 15 95 A EDS 17 Front control remote kit 5m long for DX SR9E 49 95 SLC 600S Leatherette case for AT 600 amp RBP 607 and AT 201 400 amp RBP 607 15 95 A EMS 14 Desk top microphone for DX SR9E 89 95 DM 330MW Switch mode 25 Amp continuous for DX SR9E 99 95 ADONIS MICROPHONES AND ACCESSORIES ERW 7 PC programming cable USB port for DX SR9E needs either EDS 10 or EDS 14 39 95 WX 2400 Wireless mobile microphone 159 95 C ERW 4C Programing cable for DX SR9E 39 95 AK 8S Universal microphone selector 2 way microphone switch 8 pin round 79 95 C DX SR8E All band HF 100W 12V mobile transceiver
221. BCC Set of 3 extra coil clips W3 RAK Rotating arm ki W3 VAC MKII Deluxe vertical antenna clamp for use as inverted V or vertical W3 CHOKE BALUN 7 150MHz BNC W3 MINI COIL Smaller and lighter replacement for standard coil W3 SCAW Rigid shock cord adjustable whip 4 section 22 inches W3 SCM S Short shock cord mast for Buddistick amp Buddipole 33cm collapsed 2 4m extended W3 SCM L Long shock cord mast for Buddistick amp Buddipole 58cm collapsed 3 3m extended W3 IT ADAPTOR W3 XAA W3 XAA 1 2 W3 DKB W3 AMBL W3 BS W3 BS DELUXE W3 BS TRI W3 KWS W3 MK W3 MBP W3 MWA 4 W3 LBC W3 LBCP W3 LTW W3 LBVK Joiner for 2 x 3 8ths studs with hole in the middle for 3 8th stud Extra antenna arm 22 long Extra antenna arm 11 long Carry bag with strap for Buddipole antenna and accessories Carry bag for 16 extended 40 collapsed antenna mast or Deluxe Buddipole pack Buddistick portable vertical antenna kit 7 54MHz continuous 250W Kit Buddistick with vertical antenna clamp 2 x telescopic whips and 3 coil clips Tripod for Buddistick Knurled whip sleeve for increased strength at the base of the telescopic whips Mounting kit Mini Buddipole Pair of military style shockcord whip antenna 4 section Low band coil 80m 3 5MHz for W3 BP Buddipole Counterpoise kit including 66 wire for W3 LBC Long telescopic whip for W3 LBC Low band vertical kit 1 x W3 LBC 1 x W3 LTW amp 1 x W3 LBCP amp TRSB fi 3 2 19
222. BL Mini lapel earphone microphone kit 3 wire for NX 200S 300S 129 95 KHS 14 Lightweight single muff headset with boom microphone for NX 200S 300S 70 95 KHS 15 OH Heavy duty over the head headset for NX 200S 300S 229 95 KMC 38GPS GPS speaker microphone for NX 200S 300S 219 95 KMC 41 Speaker microphone for NX 200S 300S 33 95 VGS 1 Voice guide amp storage unit for NX 200S 300S 86 95 KPG 36A Programming interface serial cable for NX 200S 300S 49 95 KPG 36U Programming interface USB cable for NX 200S 300S 101 95 KPG 111D Programming software for NX 200S 300S 49 95 KCT 53U Serial to USB adaptor with drivers for nx 200S 300S 61 95 NX 200E Digital and analogue FM hand held transceiver VHF 136 174MHz 1 5W 512ch full keypad dwy bet clip 478 00 NX 200E3 Digital amp analogue FM hand held transceiver VHF 136 174MHz 1 5W 512ch 6 control keys Qw belt clip 452 00 NX 300E Digital and analogue FM hand held transceiver UHF 400 470MHz 1 5W 512ch full keypad cw beltcip 478 00 NX 300E4 Digital amp analogue FM hand held transceiver UHF 400 470MHz 1 5W 512ch 6 control keys cw bei dp 452 00 KRA 23M UHF short antenna 440 490MHz for NX 200E 300E 9 95 KRA 23M3 UHF short antenna 400 450MHz for NX 200E 300E 9 95 KRA 27M UHF antenna 440 490MHz for NX 200E 300E 9 95 KRA 27M3 UHF antenna 400 450MHz for NX 200E 300E 9 95 KRA 22M VHF short antenna 146 162MHz for NX 200E 300E 9 95 KRA 22M2 VHF short antenna 162 174MHz for NX 200E 300E 9 95 KRA 22
223. Battery eliminator adaptor 10 99 WO CCO 001 Cigar car charger 10 19 WO SMO 001 Speaker microphone 15 99 WO HEO 001 Over the ear earpiece with microphone amp PTT 12 95 WO HEO 002 Over the ear earpiece with low profile acousic tube microphone amp PTT 15 95 WO PSO 110 Programming software and USB cable 20 39 WO CASE Leather case for KG 699 old series 10 19 WO CASE KGUV6D Leather case for KGUVED new series 10 95 WO AAO 002 SMA socket to BNC Socket same as WCN 2 6 60 WO AAO 001 SMA socket to SO 239 same as WCN 4 5 50 WO CHO 001 Standard charger for Wouxun 19 39 WO CHO 004 Dual slot charger 23 50 WO CHO 006 6 way charger 153 95 WO BC Spare belt clip for Wouxun handhelds 2 95 X1M transceiver amp Accessories X1M 5 band QRP transceiver kit 80 40 20 15 10m SSB CW 5w out0 1 30MHz receive 279 95 X1M CA CAT interface for X1M 14 95 RT SYSTEMS ACCESSORIES KRS V7 Programming software for TM V71 comes with USB K5G USB cable 39 95 KRS 2000 Programming software for TS 2000 comes with USB 63 USB cable 49 95 ADMS BAO 5R Programming software for Baofeng UV 5R comes with USB K4Y USB cable 49 95 KGS KGUV920P Programming software for Wouxun KG UV920P comes with USB W5R USB cable 49 95 RPS KGUVD1P Programming software for Wouxun KG UVD1P comes with USB K4Y USB cable 49 95 KGS KGUV8D Programming software for Wouxun KG UV8D comes with USB K4Y USB cable 49 95 ADMS 847 Programming software for FT 847 comes with USB 65 USB
224. C 910 9MHz SSB narrow filter 1 8KHz for IC 706 Man down unit for IC F3 4 French version will full 5 tone DTMF mobile microphone Spare hand microphone 600 Ohm telephone plug for IC 706 Speaker microphone for A22 3 Remote speaker microphone Earphone microphone single pin 4 pole ODO Q ooo 99 ON ON yoyo 3 29 4 95 2 50 8 60 2 95 0 79 4 95 1 35 0 99 0 15 4 95 0 75 7 95 1 69 54 95 1 29 3 95 0 69 2 29 1 99 2 95 6 95 4 50 45 95 7 50 4 50 0 10 1 00 1 95 24 95 0 95 0 95 8 95 9 95 8 95 0 95 2 95 25 95 2 95 5 95 429 95 3 95 3 95 24 95 2 95 45 95 179 95 61 95 49 95 44 95 49 95 294 95 294 95 364 95 15 95 15 95 12 95 29 95 26 95 15 95 22 95 2 95 2 95 2 95 69 95 1 95 8 95 94 95 51 95 30 95 2 95 4 95 26 95 26 95 8 95 8 95 9 95 0 95 7 95 7 95 8 95 21 95 91 95 6 95 21 95 21 95 24 95 21 95 24 95 24 95 21 95 24 95 74 95 74 95 83 95 53 95 48 95 12 95 11 95 16 95 11 95 15 95 15 95 13 95 13 95 60 95 61 95 93 95 93 95 73 95 82 95 40 95 39 95 39 95 105 95 29 95 m mMm m m m m m m m m m m m m m mm m m m m TOHO OOO T T T T K T T D T O W0 0 T T O T T T T T C1 T T T T T T T T T T T
225. C C DE LS A A A 11 11 TK e e K T T T OH 3 K OD C3 pr P rr CG0 GG GG oO a0 C3 C3 C1 CCC C3 CTC CC C3 Lae aaa CCC C3 C3 C3 C3 BATTERIES Ni Cd HP 2 2D HP 11 2C BATTERIES Ni MH AA TAG NXC 1AA NXC 4AA NXC 4AAA NXC 2C NXC 2D NXC PP3 2x D size Ni Cd rechargeable 1500 mAh 1 2V 2x C size Ni Cd rechargeable 2800 mAh 1 2V 1x AA cell Ni MH rechargeable 2100mAh 1 2V with solder tags 1x AA cell Ni MH rechargeable 2600mAh 1 2V 4x AA cells Ni MH rechargeable 2800mAh 1 2V 4x AAA cells Ni MH rechargeable 1100mAh 1 2V 2x C cell Ni MH rechargeable 5000mAh 1 2V 2x D cell Ni MH rechargeable 10 000mAh 1 2V 1x PP3 size Ni MH rechargeable 155 mAh 8 4V BATTERIES CHARGERS NXC CHG V 1000 V 868 02 7157 Charger for 4 x AA or AAA Ni MH batteries Fast Charger for 4 x AA or AAA Ni MH or Ni Cd batteries 240V or 12V Charger for 8 x AA or AAA Ni Cd or Ni MH batteries Charger for 4 x AA or AAA or C or D size or 1 x PP3 Ni Cd or Ni MH batteries BATTERIES PORTABLE POWER TANKS AT 715 Power Tank 12V 17Ah rechargeable lead acid batt USB air comp 200W inverter light etc AT 715 PSU Spare UK power supply for AT 715 PSU 4 150 Spare UK power supply for CH 4 150 FD 7021 HL Halogen light for FD 7021 BENCHER MORSE KEYS HEX PADDLE lambic paddle key BY 1 lambic twin paddle key on a black base with chrome components BY 2 lambic twin paddle key on a chrome base with chrome components DCBY Dust cover for BY series pad
226. C mic PCBA NEDSP1068PCBAMIC Commercial noise eliminating DSP module AGC mic PCBA mic NNTDSP ANEM M 1042 MINI SWI CAT MA 004 Kil TCH E RADIOMATE PSU12 1 PSU12 1 PSU12 2 1030 UKI 1030 EU 1030 VE 1030 VE 1030 FPL 1030 2W 1030 EXI 1030 EXI A A EU A PA PA PL PL6 VA LE LE3 1030 MOEP ROTARY1031 SPKR8 LSPKR NCH2 1031 STAND 1030 STHDP ALD 100 ALD 001 ALD 002 ALD 003 ALD 004 ALD 005 ALD 006 ADP P002 ADP P003 ADP P004 ADP P005 ADP P006 ADP P008 ADP P009 ADP S001 ADP S002 ADP S003 ADP S004 ADP S005 BBRP BBRP KIT BBA MD6L MDS FT817 VEPL FT817 VEPL6 FT817 FPL POCKETI POCKETI POCKETI POCKETI POCKETI POCKETI POCKETI SP 21BH REFFT817 REFVX7R REFVX5R REFVX2R REFVX6R REFVX8DR REFVX8R IDSP SP 23 I BHIDSP SP 23 K BHIDSP Noise eliminating DSP board for most Icom PMR radios Noise Away amplified module DSP noise elimination module Switch box to connect 6 pieces of equipment to BHI speaker c w 2 x ALD 001 2 way switch box to connect for example 2 radios to your bhi noise cancelling product Electronic Y splitter for FT 817 FT 857 amp FT 897 plug 2 acc s into your CAT port Compact keypad for Yaesu FT 817 857 897 12V DC 1A power supply for DSPKR 3 pin UK 12V DC 1A power supply for DSPKR 2 pin EU 12V DC 2A power supply for DESKTOP 3 pin UK UK Power supply for any BHI unit 500mAh 12V DC unregulated 2 1mm DC plug EU Power s
227. CEIVERS amp ACCESSORIES TK 3304 Handheld PMR 446 transceiver scrambler Li ion battery and charger 149 95 KNB 29N Spare Ni MH battery 1500mAh for TK 3201 3301 29 95 KNB 30A Ni Cd battery 1100mAh for TK 3201 3301 23 95 KNB 53N Ni MH battery 1400mAh for TK 3201 3301 29 95 KNB 45L Li ion battery 2000mAh for TK 3201 3301 39 95 KSC 31T Rapid charger for KNB 29N KNB 30A amp TK 3301 33 95 KSC 35ST Rapid charger for KNB 45L amp TK 3301 41 95 KSC 316T 6 way charger for KNB 29N 30A amp TK 3301 319 95 KSC 356T 6 way charger for KNB 45L amp TK 3301 319 95 KMB 30M Optional wall hanging bracket for KSC 356 316 amp TK 3301 16 95 KLH 120 Soft leather case for TK 3201 3301 11 95 KLH 131 Nylon case for TK 3301 9 95 KWR 1 Water resistant bag for TK 2202 3202 3301 14 95 EMC 12 Clip microphone with D type earpiece was EMC 6 for TK 3301 37 95 KBH 10 Spare belt clip for TK 3201 3304 6 95 KEP 2 Acoustic tube earpiece for connection to remote speaker mic 70cm long amp TK 3301 26 95 KHS 1 Headset with VOX PTT fro TK 3301 41 95 KHS 10 OH Heavy duty noise cancelling headset with PTT for TK 3201 3301 194 95 KHS 21 Headset boom mic less VOX for TK 3201 3301 41 95 KHS 22 Headet with PTT for TK 3201 3301 23 95 KHS 29F Boom mic with D type earpiece and PTT for TH F7E was KHS 28F for TK 3301 30 95 KHS 7 Single headset with boom microphone for TK 3201 3301 41 95 KHS 7A Single headset with boom microphone with PTT for TK 3
228. CMF 2000 CMF 5000 AM 385 CX 310A CX 310N CX 210A CX 210N BU 50 BU 55 GSV 3000 GZV 2500 GZV 4000 GZV 6000 SX 20C SX 40C SX 240C SX 100 SX 200 SX 400 SX 400N SX 600 SX 1100 SP 1000 SP 3000 SP 3000P SP 1000PW SP 3000W FUSE 23 FUSE 35 S 500 DMAXS0 MX 72A MX 72H MX 72N MX 62M MX 610 MX 2000 MX 2000N MX 3000 MX 3000N DL 50A DL 50N P610 P710 P1010 P810 P810 A W GR 1000H BNC 2m 70cm helical 4 5cm long wide band receive BNC 70cm flexible whip 10W 17cm BNC 2m telescopic whip 5 8ths wave 134cm long BNC 2m 70cm 10W 20cm long flexible whip plus wide band receive BNC 2m 70cm incredibly flexible whip BNC 12 1 2 long BNC 2m 70cm 8 band receive 21cm long BNC 2m 70cm 10W 21cm long wide band receive BNC 2m 70cm dualband telescopic whip 3 5 5db gain 93cm long BNC 2m 70cm helical 8 band receive 40cm long BNC 2m 70cm telescopic whip 41W cm long BNC 95 1100MHz transmit receive telescopic whip max 80 5cm AM FM 10W BNC 70 1000MHz transmit receive telescopic whip max 115cm AM FM 10W BNC 70 1000MHz transmit receive telescopic whip max 113 5cm AM FM 10W with hinge BNC 2m 70cm 23cm 10W helical 35cm long wind band receive BNC amp SMA adaptor 6m 2m 70cm 23cm 4 band handheld antenna 51 5cm long wide band receive BNC 2m 70cm 7 5cm long wide band receive SMA amp BNC 2m 70cm flexi 21 5cm long wide band receive SMA amp BNC 2m 70cm flexi 40 5cm long wide band receive SMA socket 2m 70cm TX 120 150 300 450 800 900MH
229. CR RJ 45 CR RJ 45 SJ RJ 11 SJ KAK EM d KAKA RM d d CREATIVE DESIGN ANTENNAS amp ROTATORS RC5 1 RC5 3 RC5A 3 RCSB 3 AER 5 ERC 5A MC 2 218 B CREATE P1 CREATE R30 CREATE MO75 CLP5130 1N Ad Ad Ad Ad Ad Ad Ad japtor 1 4 stereo jack socket to 1 4 mono jack plug ay ay ay ay ay ay Adat ay ay ay ay ay ay tor 1 4 mono jack plug to 3 5mm mono jack socket tor 1 4 stereo jack plug to 3 5mm mono jack socket tor 1 4 mono jack socket to phono plug tor 1 4 mono jack plug to phono socket tor 3 5mm stereo jack plug to 3 5mm mono jack socket tor phono plug to 3 5mm mono jack socket tor phono socket to 3 5mm mono jack plug tor 2 5mm mono jack plug to 3 5mm mono jack socket tor 2 5mm stereo jack plug to 3 5mm mono jack plug needs ADP P003 tor 3 5mm stereo jack socket to 3 5mm mono jack plug tor 1 4 mono jack socket to 3 5mm mono jack plug Adaptor 1 4 stereo jack socket to 3 5mm mono jack plug Adaptor 2 5mm stereo jack socket to 3 5mm mono jack plug Adaptor 2 5mm mono jack socket to 3 5mm mono jack plug T piece 3 x N socket T piece 3 x SO 239 T piece 2 x SO 239 1 x PL 259 T piece 3 x BNC sockets T piece 2 x BNC sockets 1 x BNC plug 8 pin in line microphone plug with pins 7 pin in line microphone plug with pins 8 pin microphone plug 7 pin microphone plug 6 pin microphone plug 5 pin microphone plug 4 pin microphone plug 3 pin microphone plug 2 pin microphone plug 8 pin microphone
230. D Vertical omni directional FM 88 108MHz wall mountable in outdoor complete kit AF OMNI Omni directional FM 88 108MHz for in outdoor complete with mounting clamp ANYTONE AT 5189MKIl 4m mobile transceiver 25W 66 88MHz with DTMF microphone AT 5555 10m mobile transceiver 12W AM FM CW 21W PEP SSB 25W AOR RECEIVERS SCANNERS ETC 64 95 14 95 14 95 14 95 14 95 14 95 14 95 9 95 12 95 11 95 29 95 4 195 95 4 499 95 2 995 95 3 799 95 4 189 95 2 999 95 3 299 95 2 499 95 3 599 95 1 949 95 1 989 95 1 649 95 1 939 95 929 95 1 069 95 1 399 95 2 695 95 1 549 95 989 95 1 029 95 59 95 209 95 329 95 135 95 79 95 59 95 219 95 69 95 69 95 178 95 79 95 89 95 489 95 639 95 99 95 99 95 129 95 159 95 169 95 169 95 44 95 48 95 56 95 45 95 89 95 7 95 17 95 64 95 16 95 9 95 449 95 339 95 174 95 219 95 189 95 239 95 198 95 235 95 195 95 249 95 329 95 255 95 389 95 549 95 679 95 699 95 729 95 129 95 154 95 169 95 125 95 28 95 34 95 1 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 19 95 29 95 269 95 17 95 MD M M MDM MD M M D D 249 95 139 95 18 95 19 95 149 95 149 95 rrrrrrrrrroa TO T T K T T T T T T T T T T HHG GOGO GO GOGOGOGOGOGOGOGOGO OOO GOGO OO OOO GO OOO OOO GOGO mmm mmm mmm
231. EFRAISFANQAIDAADIADIADINNSOYSYSYSYSFYFrYrVYSFyYSrYrYrrrrrror gt yS CT T K T T e TK T T T K T T AAAARAADAAAAAAAAAAAAD Qa HW 40HP HF off centre fed dipole with 4 1 balun 80 10m inc WARC 21 27m long 400W 45 95 HW 20HP Multiband HF off centre fed dipole with 4 1 balun 20 10m inc WARC 10 64m long 400W 45 95 HW 42HP HF off centre fed dipole with 4 1 balun 40 6m no ATU inc WARC 21 27m long 400W 80m with ATU 56 95 LW 40 End fed multiband HF long wire antenna with 9 1 UNUN 160 6m inc WARC 40m long 400W 50 95 LW 20 End fed multiband HF long wire antenna with 9 1 UNUN 80 6m inc WARC 20m long 400W 45 95 LW 10 End fed multiband HF long wire antenna with 9 1 UNUN 40 6m inc WARC 10m long 400W 45 95 DELTA 40HP Delta loop aerial with 4 1 balun 40 56m long resonant on 40 10m 52 50 DELTA 20HP Delta loop aerial with 4 1 balun 20 28m long resonant on 20 6m 52 50 DELTA 15HP Delta loop aerial with 4 1 balun 14 6m long resonant on 15 6m 52 50 DELTA 10HP Delta loop aerial with 4 1 balun 10 14m long resonant on 6 10m 52 50 DBD 2040 Loaded dipole for 20 amp 40m 23m long incudes 1 1 balun 12m long 550W SSB 59 95 DBD 4080 Loaded dipole for 40 amp 80m 550w 23m long incudes 1 1 balun 74 95 MD 20HP Mono band 20m HF dipole for portable fixed station use 400W CW 1 1 balun SO 239 10 14m long 45 95 MD 17HP Mono band 17m HF dipole for portable fixed station use 400W CW 1 1 balun SO 239 7 95m long 45 95 MD 15HP Mon
232. EPRPRPRPPRPPRPRERPRERERROOBROOCOOCOOPRPRPRERPEPROPRPRPRPRPRERERERPROBROOCOOBPRPRPRPROOPRPRPRPREPEPROPRPRPRPRPRERPRERERRO MH 73A4B MH 57A4B VC 24 VC 27 CD 50 PA 45U PA 45C CLIP 22 FNB 115LI E DC 30 CN 3 CAT 460 CE 129E CT 111 HX 751E MH 73A4B MH 57A4B VC 24 VC 27 CD 39 CN 3 NC 88C PA 48U PA 48C FBA 38 FNB V99LI E DC 19A E DC 6 CAT 460 CE 120 CT 111 HX 760E BH 2 CD 40 PA 46U PA 46C MH 73A4B MH 57A4B VC 24 VC 27 CD 39 CN 3 NC 88C PA 48U PA 48C FBA 38 FNB V99LI E DC 19A E DC 6 CAT 460 CE 98 CT 111 HX 851E MH 73A4B MH 57A4B VC 24 VC 27 CD 38 CN 3 NC 88C PA 48U PA 48C FBA 38 FNB V99LI E DC 19A E DC 6 CAT 460 CE 100 FIF UK1 YAESU MARINE MOBI GX 2100E BK GX 2100E WH MMB 84 CMP30B BK CMP30B WH RA052520A RA0458800 8101512 CT 100 CVS2500 220SW 240SW MLS 300 MLS 3001 MLS 310 HC 2000 CE 67 CT 99 CT 62 GX 2000E BK GX 2000E WH MMB 84 CMP30B BK CMP30B WH RA052520A RA0458800 8101512 CT 100 CVS2500 220SW 240SW MLS 300 MLS 3001 MLS 310 HC 2000 CE 67 CT 99 CT 62 GX 1600E BK GX 1600E WH MMB 97 CMP30B BK CMP30B WH RA052520A RA0458800 Waterproof speaker microphone for HX 400E Speaker microphone for HX 400E Vox headset for HX 400E Earpiece microphone for HX 400E Charging cradle for HX 400E Spare charger for HX 400E 3 pin UK new style Spare charger for HX 400E 2 pin EU new style Spare belt clip for HX 400E Spare 7 2V 2400mAh Lithium lon battery pack for HX 4
233. F3002 4002 on CD ROM Cloning cable set to set for IC F3002 4002 PC cloning cable RS 232C type for IC F3002 4002 Cloning cable for radio to PC USB cable for IC F3002 4002 Cigarette lighter cable for use with BC 191 or BC 193 for IC F3002 4002 Bare ends DC lead for battery charging or 12 V supply for IC F3002 4002 Leatherette carry case for IC F3003 4002 Spare aligator type belt clip for IC F3002 4002 PMR transceiver 400 470MHz UHF 2 channel c w BC 160 BC 145 BP 231 MB 94 Charger adaptor for BC 119N 121N and BP 209 210 21 1 222 Fast charger includes AD 106 amp BC 145 for IC F15 15S 25 25S 6 way fast charger includes 6 x AD 106 amp BC 124 for IC F15 15S 25 25S UK mains PSU for BC 119N fast charger Spare AC adaptor for BC 121 Spare Desktop rapid charger Spare Li ion battery pack 7 4V 1150mAh High capacity Li ion battery pack 7 4V 2000mAh Hard leather case for IC F15 15S 25 25S Soft leather case for C F15 15S 25 25S BNC J adaptor for F3 30 M21 31 AD 98FSC converts aerial socket to BNC VHF antenna for 136 150MHz UHF antenna for 400 430MHz VHF antenna for 150 174MHz UHF antenna for 430 470MHz Spare Stubby antenna 160 174MHz Spare Stubby antenna 450 470MHz Mini hand held speaker microphone Speaker microphone with up down Earphone Microphone GS style speaker microphone L type plug Earphone microphone screw type connector Heavy duty hand held microphone Splash proof full sized speaker microphone durable Earpho
234. G7 144 G7 150 2 MO 1 MO 2 MO 3 MO 4 SSM 1 SSM 2 SSM 3 HOT RSS 2 QD 2 VP 1 Leatherette case for C 408 Nicad battery pack 12 V 600 mAh for C 150 Leatherette case for C 150 Belt clip for C 150 10 15 20 30 40 80m base vertical 25 high 1kW 10 15 20 40 80m base vertical 25 high 1kW 10 15 20 40m Base vertical 21 high 1kW 2m 70cm dual band colinear 100W 7 6 long N type 10MHz add on kit for 5BTV amp 4BTV Spider assembly converts 4 BTV to 5 BTV needs RM 80 S as well Replacement base assembly bracket for any BTV Spare poly black collar trap cover 10m Standard resonator 400W 11m Standard resonator 400W 12m Standard resonator 400W 15m Standard resonator 400W 17m Standard resonator 400W 20m Standard resonator 400W 30m Standard resonator 400W 7 0MHz Standard resonator 400W 40m Standard resonator 400W 5 7MHz Standard resonator 400W 60m Standard resonator 400W 80m Standard resonator 400W 10m Super resonator 1kW 11m Super resonator 1kW 15m Super resonator 1kW 20m Super resonator 1KW 40m Super resonator 1KW 80m Super resonator 1KW 2m base station colinear antenna 7dB gain VHF marine 154 161MHz base station colinear antenna 7dB gain Mast section 54 folds at 22 Mast section 54 folds at centre Mast section 54 non folding Mast section 27 plus 3 whip sections Ball mount with stainless steel spring and stud Ball mount Stainless steel spring and stud Trunk lip mount Stainless steel resonator impa
235. GSA M285S M285H NR2C NR22L NR22LH CL2E MC100 MC101 MC101S MC103A MC103B MC200 MC201 MC202 MG200 134 174MHz 2 15cBi 200W 0 6m long PL 259 1 4 wave 144 174MHz 2 15dBi 200W 0 51m long PL 259 1 4 wave with spring base 144 174MHz 3 4dB 200W 1 33m long PL 259 5 8ths wave 134 174MHz 3 4dB gain 250W 1 4m long PL 259 5 8ths wave 144 174MHz 4 1dB 150W 1 41m long PL 259 6 8ths wave 144 174MHz 6 5dB 100W 2 46m long PL 259 2 x 5 8ths wave radialess 144 174MHz 6 5dB 280W 2 46m long PL 259 2 x 5 8ths wave radialess 144 174MHz 4 1dB 200W 1 45m long PL 259 6 8ths wave 134 174MHz 2 15dB 70W 0 52m long PL 259 1 4 wave mobile whip and mag mount 134 174MHz 3 4dB 200W 1 42m long PL 259 5 8ths wave 117 174MHz 3 4dBi 200W 1 62m long PL 259 5 8ths wave 132 155MHz 3 2dBi 200W 1 515m long PL 259 5 8ths wave 150 172MHz 3 2dBi 200W 1 41m long PL 259 5 8ths wave 340 520MHz 3 4dB 250W 0 57m long PL 259 5 8ths wave 340 520MHz 2 15dBi 100W 0 31m long PL 259 1 4 wave mobile whip and mag mount 340 520MHz 2 15dBi 200W 0 54m long PL 259 1 4 wave 2350 2450MHz 7 0dBi 10W 0 60m long N type 3x1 2 wave coaxial dipole mobile whip vS 99 999 v S DIAMOND MOBILE WHIP ANTENNA COMPLETE WITH MAGNETIC MOUNT CABLE amp PLUG R 73SJ R 75B R 75M R 75S R 75SJ R 77 R 77SJ R 77B R 77S SSSS225225222 2m 70cm 10W 50cm long black metal whip magmount 3m cable fitted SMA socket 2m 70cm 35W 50cm long black metal whip magmount 3m cable fitt
236. HF 6V and HF 9V RMK II Roof mount kit including T 2 tripod STR II and MPS for HF 6V and HF 9V MPS Mounting post sleeve T 2 2 foot tripod tower 290 00 Butter It s Not Anti oxide anti seize paste 10z 290 02 Konnektor Kote 6 weatherproof sealer 290 05 Capacitor 200PF 290 06 Capacitor 67PF 290 07 Capacitor assembly 80 40m 290 08 Coax 75 Ohms matching unit CABLE amp WIRE DRG 58 100m drum of RG 58 50 Ohm coaxial cable DRG 58 50 50m drum of RG 58 50 Ohm coaxial cable RG 58 50 Ohm coaxial cable per metre 14 99 13 99 9 99 19 99 19 99 13 99 14 99 12 99 8 99 25 99 27 99 34 99 10 99 3 99 22 99 12 99 4 99 9 99 7 99 26 99 13 99 14 99 9 99 15 99 12 99 14 99 19 99 10 99 10 99 39 95 39 95 39 95 39 95 39 95 39 95 39 95 39 95 29 95 29 95 29 95 29 95 29 95 29 95 29 95 29 95 29 95 16 95 5 99 4 99 4 99 2 99 1 99 4 99 2 99 1 99 11 95 29 95 10 95 9 95 9 95 9 95 15 95 15 95 16 95 12 95 17 95 13 95 14 95 15 95 12 95 5 95 7 95 14 95 12 95 8 95 11 95 16 95 6 95 10 95 7 95 5 50 29 95 339 95 459 95 539 95 599 95 199 95 79 95 27 95 229 95 66 95 239 95 114 95 189 95 239 95 28 95 69 95 8 95 16 95 69 95 69 95 129 95 49 95 45 95 23 95 0 70 Te r e H R
237. HF short antenna 400 450MHz for TK 3140 emerald green VHF antenna 149 159MHz for TK 2140 black VHF antenna 156 162MHz for TK 2140 orange VHF antenna 162 174MHz for TK 2140 white UHF antenna 430 472MHz for TK 3140 green UHF antenna 410 430MHz for TK 3140 white VHF stubby antenna 149 159MHz for TK 2140 black VHF stubby antenna 156 162MHz for TK 2140 orange VHF stubby antenna 162 174MHz for TK 2140 white UHF stubby antenna 430 472MHz for TK 3140 green UHF stubby antenna 410 430MHz for TK 3140 white Soft leather case for TK 2140 3140 Serial to USB adapter with drivers for TK 2140 3140 Programming interface cable for TK 2140 3140 Programming software for TK 2140 3140 VHF handy 136 174MHz 12 5 20 25KHz 1 5W 512 CH needs aerial battery charger UHF handy 440 470MHz 12 5 20 25KHz 1 4W 512 CH needs aerial battery charger VHF short antenna 146 162MHz for TK 2180 VHF short antenna 162 174MHz for TK 2180 VHF short antenna 136 150MHz for TK 2180 VHF antenna 146 162MHz for TK 2180 VHF antenna 162 174MHz for TK 2180 VHF antenna 136 150MHz for TK 2180 UHF short antenna 440 490MHz for TK 3180 UHF short antenna 400 450MHz for TK 3180 UHF antenna 440 490MHz for TK 3180 UHF antenna 400 450MHz for TK 3180 Li lon battery 1700mAh for TK 2180 3180 Ni MH 2500mAh battery for TK 2180 3180 Dry cell battery case 6 x AA for TK 2180 3180 Rapid charger for TK 2180 3180 6 way tri chemistry charger for TK 2180 3180 Optional wall
238. HN 5 7 MPX70 6HN 7 9 MPX70 6HN 9 43 MPX70 6HN 13 16 UHF repeater 430 470MHz 240v UHF repeater 430 470MHz 240v VHF repeater 136 172MHz 240v Cross band repeater 136 172 amp 430 470MHz 240v VHF repeater for commercial use 136 172MHz 240v PSU for IC FR5100 UHF repeater for commercial use 400 480MHz 240v Standard mobile microphone Desk microphone Cloning cable dealers only USB type Scrambler unit inversion for IC F3022 4022 Scrambler unit inversion and rolling VHF channel module 25W UHF channel module 25W Cloning software Service manual on CD ROM for IC FR5100 6100 Frequency range 138 156MHz duplex spacing range 4 6MHz Frequency range 138 156MHz duplex spacing range 6 16MHz Frequency range 152 175MHz duplex spacing range 4 6MHz Frequency range 152 175MHz duplex spacing range 6 16MHz Frequency range 406 440MHz duplex spacing range 5 7MHz Frequency range 406 440MHz duplex spacing range 7 9MHz Frequency range 406 440MHz duplex spacing range 9 13MHz Frequency range 406 440MHz duplex spacing range 13 16MHz Frequency range 430 470MHz duplex spacing range 5 7MHz Frequency range 430 470MHz duplex spacing range 7 9MHz Frequency range 430 470MHz duplex spacing range 9 13MHz Frequency range 430 470MHz duplex spacing range 13 16MHz ICOM LLOC SECURITY MANAGEMENT SYSTEM ILOCSUITE001 ILOC 001 ILOC 003 IREAD 003 F1710 005 OPC 966 OPC 966 002 PS 1508 001 PS 1508 005 LOC READ software suite LOC receiver and man down un
239. IT ball drive 1 with screws 11 95 CK 8045ABM Curtis keyer chip 36 95 MFJ TC11 Kit turn counter 3 digits 17 95 MFJ TC12 Kit turn counter 5 digits 74 95 MFJ 15 Belt radio holder 14 95 MFJ 16B01 Coax center insulator with SO 239 23 50 MFJ 16C01 Glazed ceramic dogbone insulator 1 10 MFJ 16C06 Glazed ceramic dogbone insulator pack of 6 5 95 MFJ 16D01 450 Ohm fibre glass centre insulator 10 95 MFJ 16E01 Ladder line insulator end feed point with SO 239 12 95 MFJ 16F01 Ladder line insulator mid feed point with SO 239 10 95 MFJ 17A01 3 16ths guy wire strain ceramic insulator 3 50 MFJ 17B01 4 16ths guy wire strain ceramic insulator 6 95 MFJ 18 Chest hamess for hand held 29 95 MFJ 19 Low loss butterfly loop tuning capacitor as built in MFJ 935 amp 936 75 95 MFJ 20 Mobile mount for MFJ 945E 7 95 MFJ 21 1 gallon industrial grade transformer oil 38 95 MFJ 23 Butterfly loop air variable capacitor 18 136 pf 4 2KV 94 95 MFJ 26B Soft leather case for MFJ 418 461 12 95 MFJ 27 Handle for CW transceiver station 8 95 MFJ 29C Soft case for 209 249 259B with window cut outs 27 95 MFJ 29D Soft case for MFJ 259C 33 50 MFJ 31 Oscar satellite book 10 95 MFJ 32 Packet made easy book 12 95 MFJ 33 Mobile handbook 14 95 MFJ 35 World of ham radio book 10 95 MFJ 37 Ham communications files book 12 95 MFJ 38 Easy up antennas book 16 95 MFJ 39C Carry case for MFJ 269 29 95 MFJ 39D Carry case for MFJ 269C 32 95 MFJ 3
240. J 802R combo RFI detector pocket size 144 220 MHz 30 300 Watts VSWR POWER meter SWR POWER meter 0 5 50W 1 8 50MHz 1 8 60 MHz cross needle SWR PWR meter 2KW max PEAK RMS 1 8 30 MHz 30 300 Watt VSWR POWER meter 2m 70cm cross needle illuminated PEAK RMS meter 200W Mobile SWR amp POWER meter rugged construction 1 8 30MHz 6 30 60 300 Watts HF VHF 300 Watts cross needle SWR POWER meter Digital SWR Power meter 1 8 60MHz 100mW 1500W Peak or average power Digital SWR Power meter X needle with frequency counter RF current meter 1 8 30MHz coax in line simple RF ammeter up to 3 Amps RF current meter 1 8 30MHz coax in line simple RF ammeter up to 30 Amps Balanced line RF current meter 1 8 30MHz up to 3 Amps cross needle Cross needle VSWR Power meter with RF ammeter 1 8 30MHz up to 3 Amps Cross needle VSWR Power meter with RF ammeter 1 8 30MHz up to 30 Amps VHF UHF 150 Watts cross needle SWR Power meter for 2m 70cm 200W SO 239 ideal for mobiles AC line voltage monitor with AC socket USA only AC power line noise meter Clamp on RF current meter 3 Amp version Clamp on RF current meter 30 Amp version Deluxe clamp on RF current meter Directional noise finder with 3 element beam 1 8 60MHz SWR POWER meter cross needle 2m 70cm VSWR POWER meter 30 300W X needle 1 8 60 144 amp 440MHz VSWRIPOWER meter 30 300W X needle 144 220 440MHz 20 200 400W giant SWR POWER meter 1 8 54MHz 20 200 2000W giant SWR POWER meter 1 8 60MHz 20 200 2000W g
241. Li lon for IC E7 Soft leather case for IC 446S Leatherette case for IC F3 4GS amp GT Hard case Hard case New style soft case Was CASE 044 Soft case Dry cell case for 10 x AA cells for A22 3 Cigar lighter lead for BC 133 137 was CP 1 Cigarette lighter cable with noise filter Cigarette lighter cable with noise filter Cigar lighter lead for W 2E Cigarette lighter cable with noise filter for IC E7 High stability crystal for IC 706 Crystal for IC 820 loning software for IC E7 rogramming software for IC R2 loning software for IC R5 needs OPC 478 rograming software for IC R10 rogramming software for IC T3 loning software for IC 2725 rogramming software for IC 2800 loning software for IC E208 needs OPC 478 rogramming software for IC F31GS V IC F31GT VK IC F41GS U IC F41GT UK rogramming software for IC F41GSMTE IC F41GTMTE K irect Selcall entry software for C F3 4GT only urable full sized microphone with internal speaker im speaker microphone Programming software for A22 3 Panorama 169 MHz helical rubber duck type aerial J type connector Spare flexible aerial for A22 3 Rubber duck aerial for IC R10 BNC Spare flexible aerial for IC M3EURO Spare flexible aerial for IC F40 UHF 430 470MHz J type connector Spare Flexible aerial for IC T8 Spare Flexible aerial for C T81 9MHz CW filter 500Hz for IC 706 9MHz SSB wide filter 2 8KHz for 1C 706 CW narrow filter for main band IC 910 CW narrow filter for sub band and satellite operation for I
242. M KBH 10 KLH 181PC KLH 182PG KWR 1 EMC 12 KHS 1 KHS 10 OH KHS 21 KHS 22 KHS 29F KHS 7 KHS 7A KHS 8BL KHS 9BL KMC 21 KMC 45 KPG 22A KCT 53U KPG 22U KPG 134DM TK 2360E TK 2360ESP5L6M2 TK 2360ESP5L2M2 TK 3360E TK 3360ECP5L7MT TK 3360ECP5L3MT TK 3360ESP5L7M TK 3360ESP5L3M KRA 22M KRA 22M2 KRA 22M3 KRA 23M KRA 23M3 KRA 26M KRA 26M2 KRA 26M3 KRA 27M KRA 27M3 KNB 55L KNB 56N KNB 57L KSC 256T KSC 25T KSC 30T KMB 30M KBH 12 KLH 169NC KLH 170PG KWR 1 EMC 12 KBP 5 KEP 2 KHS 1 KHS 10 0H KHS 21 KHS 22 KHS 29F KHS 7 KHS 7A KHS 8BL KHS 9BL KMC 21 KMC 45 KSL 3SF KPG 22A KCT 53U KPG 128D TK 2170E TK 2170E3 TK 3170E TK 3170E4 TK 3170E3 TK 3170E6 KRA 22M KRA 22M2 KRA 22M3 KRA 26M KRA 26M2 KRA 26M3 KRA 23M KRA 23M3 KRA 27M KRA 27M3 KNB 25A KNB 26N KBP 5 KSC 25T KSC 30T KSC 256T KMB 30M KLH 140NC KLH 140PC KLH 140PG EMC 6 KBH 12 KEP 2 KHS 1 KHS 10 0H KHS 21 KHS 22 KHS 29F KHS 7 KHS 8BL KHS 9BL KMC 21 KMC 45 KCT 53U KPG 101D KPG 22A KPG 22U 6 way charger for KNB 45L amp TK 2312 3312E Rapid charger for KNB 29N KNB 53N and TK 2312 3312E 6 way charger for KNB 29N KNB 53N amp TK 2312 3312E Optional wall hanging bracket for KSC 316 356 amp TK 2312 3312E Spare belt clip for TK 2312 3312E Leather case with belt clip for TK 2312 3312E Leather case with swivel belt loop for TK 2312 3312E Water resistant bag for TK 2312 3312E Clip microphone with D type earpiece for TK
243. M 153L Earphone microphone screw type connector for IC V80E HM 158LA Heavy duty hand held microphone for IC V80E HM 159L Splash proof full sized speaker microphone durable for IC V80E HS 94 Headset earpiece type for use with VS 1 IC and IC V80E needs OPC 2004 HS 95 Headset with boom microphone for use with VS 1 IC and IC V80E needs OPC 2004 HS 97 Earphone with throat microphone for use with VS 1 IC and IC V80E needs OPC 2004 OPC 2004 Plug adaptor cable for HS 94 95 97 when using with IC V80E CS V80 Cloning and programming software for IC V80E OPC 474 Cloning cable set to set for IC V80E OPC 478 PC cloning cable computor to radio RS 232C type for IC V80E OPC 478UC PC cloning cable computer to radio USB type for ID V80E CP 23L Cigarette lighter cable for use with BC 191 or BC 193 OPC 515L DC power cable for use with BC 191 BC 192 BC 193 LC 174 Leatherette carry case for IC V80E MB 124 Spare aligator type belt clip for IC V80E SM V80 Service manual on CD for IC V80E FA B2E Spare VHF antenna for IC V80E ID 51E PLUS 2m 70cm DSTAR handy tevr 5W GPS rx micro SD card slot cw CS 51 clone suae Enhanced DV func BP 271 Spare Li lon battery pack 7 4V 1150mAh for ID 51E BP 272 Li lon battery pack 7 4V 1880mAh for ID 51E BP 273 Dry cell case for ID 51E 3 x AA not supplied BC 02 Spare UK 12V 300mAh charger for D 51E BC 202 I Rapid desktop charger charges BP 271 in 2 hours for ID 51E CP 12L Cigarette lighter cable with noise filter for ID 51E
244. M for IC E208 Service manual on CD for IC 703 ation speaker Service manual on C manual on CI manual on CI manual on Cl pe extension speaker manual on CD for IC F31GS V IC F31GT VK IC F41GS U IC F41GT UK Base si Service Service Service Mobile Service large with audio filters for IC 7400 ROM for IC 756 PROIII for C 706MkIIGDSP ROM for IC 910H for IC T3 D D D D Disassembling tool ant bush IC F51 61 Voice scrambler for M15 M58 M59 5 tone unit for IC F3 4 Scramb ler for IC T3 Zone software with man down req IF31 001 Liquid rubber sealant water tight barrier at antenna feedpoints Elemen 3e 4el 3e 4el 5el 4el 5el 5el 6e Be 6e 3e 4el 5el 6e 3e 4el 5el 5el 6e Te 3e 4el 4el 5el 6e Te 2e 2e 3e 3e 5el 4el 5el 6e Te 2e 2e 3e 3e 4el 5el 5el emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni emeni joining paste for maximum conductivity 10MHz LFA yagi 9m long 5kW 8 54dBi gain comes in 2 boxes 10MHz LFA yagi 16 4m long 5kW 9 92dBi gain comes in 3 boxes 14MHz OP DES yagi 4 2m long 5kW 7 46dBi gain 14MHz OP DES yagi 8 2m long 5kW 9 12dBi gain 14MHz OP DES yagi 9 3m long 5kW 9 1
245. M3 VHF short antenna 136 150MHz for NX 200E 300E 9 95 KRA 26M VHF antenna 146 162MHz for NX 200E 300E 9 95 KRA 26M2 VHF antenna 162 174MHz for NX 200E 300E 9 95 KRA 26M3 VHF antenna 136 150MHz for NX 200E 300E 9 95 KNB 47L Li ion battery 1950mAh for NX 200E 300E 50 95 KNB 48L Li ion battery 2550mAh for NX 200E 300E 59 95 KSC 32T Rapid charger for NX 200E 300E 38 95 KSC 326T 6 way tri chemistry charger for NX 200E 300E 319 95 KMB 30M Optional wall hanging bracket for NX 200E 300E 16 95 KAS 10 AVLidispatch software for NX 200E 300E 274 95 KBH 11 Belt clip for NX 200E 300E 9 95 KEP 1 Earphone for NX 200E 300E 26 95 KHS 11BL Palm earphone microphone kit 2 wire for NX 200E 300E 87 95 KHS 12BL Mini lapel earphone microphone kit 3 wire for NX 200E 300E 129 95 KHS 14 Lightweight single muff headset with boom microphone for NX 200E 300E 70 95 KHS 15 OH Heavy duty over the head headset for NX 200E 300E 229 95 KLH 156NC Nylon case for NX 200E 300E keypad versions 17 95 KLH 157NC Nylon case for NX 200E3 300E3 non keypad versions 17 95 KLH 158PC Leather case with belt clip for nx 200E 300E keypad versions 24 95 KLH 159PC Leather case with belt clip for NX 200E3 300E3 non keypad versions 24 95 KLH 160PG Leather case with swivel loop for NX 200E 300E keypad versions 27 95 KLH 164PG Leather case with swivel loop for NX 200E3 300E3 non keypad versions 27 95 KMC 38GPS GPS speaker microphone for NX 200E 300E 219 95
246. MH 42C6J Hand microphone for FTM 350E CT 132 Control cable 6m for FTM 350E BH 1A Bluetooth mono headset for FTM 350E BH 2A Bluetooth stereo headset for FTM 350E BU 2 Bluetooth adaptor unit for FTM 350E CAB 1 Headset charger sleeve for BH 1A BH 2A for FTM 350E FEP 4 Ear phone for BH 1A for FTM 350E MLS 200 M10 High power external mobile type speaker waterproof FTM 350E CT 133 GPS extension cable 3m for FT 350E FVS 2 Voice guide unit for FTM 350E FPR 1 Monitor unit for FTM 350E FGPS 1 Internal GPS receiver unit for FT 350E FGPS 2 External GPS receiver unit for FTM 350E needs CT 136 amp CT 133 MMB 98 Bracket for FTM 350E CT 136 External GPS antenna adaptor for FGPS 2 for FTM 350E CT 135 Clone cable for FTM 350E CT 140 Packet cable DIN 8 pin to DIN 6 pin Dsub 9 pin for FT 350M CT 141 Packet cable DIN 8 pin to DIN 6 pin for FT 350M CT 142 Packet cable DIN 8 pin to Dsub 9 pin for FT 350M 79022815 Spare DC lead for FTM 350E amp FT 1500 ACCESSORIES FOR FTM 10E BU 2 Bluetooth adaptor unit for FTM 10 BH 1A Bluetooth mono headset for FTM 10 29 95 69 95 299 95 79 95 209 95 239 95 269 95 189 95 59 95 119 95 119 95 119 95 109 95 29 95 12 95 34 95 9 95 18 95 1 95 448 95 599 95 189 95 99 95 29 95 49 95 29 95 69 95 209 95 59 95 119 95 119 95 119 95 34 95 9 95 9 95 109 95 29 95 12 95 17 95 23 95 12 95 15 95 5 95 9
247. MHz 1kW 8 5kg 2m boom 6m el 589 95 MV 75 5 section antenna mast 7 5m glass fibre including guy rope 229 95 K 75 Mounting kit and base plate for MV 75 109 95 HARI ANTENNAS AND TRAPS HB 1 10 Balun 10 1 for end fed wire 200W SSB CW 1 30MHz 49 95 HB 1 200 Balun 1 1 500hms 200W 29 95 HB 4 200 Balun 4 1 500hms 200W 29 95 HB 6 200 Balun 6 1 500hms 200W 29 95 HB 1 1 Balun 1 1 500hms 1kW 42 95 HB 4 1 Balun 4 1 500hms 1kW 49 95 HB 6 1 Balun 6 1 500hms 1kW 49 95 R 200 28 5 Pair of 10m traps 200W CW SSB 100W FM AM resonance 3 tolerance 54 95 R 200 24 9 Pair of 12m traps 200W CW SSB 100W FM AM resonance 3 tolerance 54 95 R 200 21 1 Pair of 15m traps 200W CW SSB 100W FM AM resonance 3 tolerance 54 95 R 200 18 1 Pair of 17m traps 200W CW SSB 100W FM AM resonance 3 tolerance 54 95 TR 200 14 1 Pair of 20m traps 200W CW SSB 100W FM AM resonance 3 tolerance 54 95 R 200 10 1 Pair of 30m traps 200W CW SSB 100W FM AM resonance 3 tolerance 58 95 TR 200 7 Pair of 40m traps 200W CW SSB 100W FM AM resonance 3 tolerance 61 95 R 200 3 6 Pair of 80m traps 200W CW SSB 100W FM AM resonance 3 tolerance 65 95 R 1000 28 5 Pair of 10m traps 1000W CW SSB 500W FM AM resonance 3 tolerance 72 95 R 1000 24 9 Pair of 12m traps 1000W CW SSB 500W FM AM resonance 3 tolerance 72 95 R 1000 21 1 Pair of 15m traps 1000W CW SSB 500W FM AM resonance 3 tolerance 72 95 R 1000 18 1 Pair o
248. NDANADADADANDTDVAANAANAAANVAVAANANTDVAAAO L222 Se 2 2S 2 ee ee Ee ee ee ee Se Se 2 ee 2 ee ee Se Se ee ee eS eS 2 2 Se E ee ee ee ee ee ee eee Se Se 2 eS ee ee ee ee ee ee ee ee ee ee ee ee ee e ee 2340T 2360T 2375T 2386 2389 2400 2620T 2640T 2703 2772K 2774K 2822 2911 2982 2990 3036 3101 3301 3302 3303 3305 3306 3307 3400 3501 3502 3504 3506 3507 3508 3509 4103 4110X 4114X 4116 4116P 4117 4403 4416B 4416BRC 4601N 4602 4704 4706 4712 4714 4714RC 4716 4716RC 4724 4724RC 4726 4726RC 5000 5004 5012 5020X 5022X 5022YV 5024 5024X 5024YV 5026X 5026YV 5060 5060YV 5060YQ 5063 5064 5064YV 5064YQ 5065 5065YH 5065YV 5066 5080 5080X 5080YH 5080YV 5080M 5080MX 5084 5084M 5084MX 5084MYV 5084X 5084YV 5084YH 5086 5086X 5086YH 50886MX 5086MYH 5086MYV 5086MZ 5088M 5088MX 5100 5100K 5100X 5100YV 5082 5106 5114A 51141 5114K 5114Y 5114Y2 5114Y3 5114Y4 5117 5124A 51241 5124K 5124Y 5124Y2 HF mini stick for 40m 3 8ths stud HF mini stick for 60m 3 8ths stud HF mini stick for 75m 3 8ths stud HF compact broadband vertical 80 6m 250w PEP no ground radials SO 239 23 5 feet tall HF compact vertical 80 40 20 15 10 2 6 70 ground radial system built in SO 239 8 5 feet tall 2400 baud internal modem Base loaded 20m HF mobile whip antenna Base loaded 40m HF
249. NICS DC POWER DC 35 High current DC multi outlets VEC 316 DC multi outlets VECTRONICS SHORT WAVE LISTENER PRODUCTS AT 100 Active indoor SWL antenna 300KHz 30MHz 10dB gain 9V VEC 162 Multi reader RTTY ASCII CW VEC 1613 Computer interface JVFAX Hamcom VECTRONICS ANTENNAS VEC 896 2 6 10 15 20 40 6 band vertical antenna VEC 1862 6m Yagi antenna VECTRONICS KITS VEC 101K Shortwave converter kit converts AM FM radios to shortwave receivers VEC 101KC Metal case for VEC 101K VEC 102K Shortwave receiver kit with case VEC 104K 2m FM receiver kit with case VEC 121K Crystal radio set kit with earphone VEC 131K Aircraft receiver kit VEC 131KC Metal case for VEC 131K VEC 201K Keyer kit VEC 201KC Metal case for VEC 201K VEC 221K CW memory Keyer kit VEC 221KC Metal case for VEC 221K VEC 412K Battery charger kit VEC 412KC Metal case for VEC 412K VEC 422K SCA decoder VEC 422KC Metal case for VEC 422K VEC 483K Voice activated recorder switch kit VEC 483KC Metal case for VEC 483K VEC 820K Super CW audio filter kit VEC 820KC Metal case for VEC 820K VEC 821K CW filter with 1W amplifier kit VEC 821KC Metal case for VEC 821K VEC 830K SSB audio filter kit VEC 830KC Metal case for VEC 830K VEC 841K Tuneable SSB CW audio filter VEC 841KC Metal case for VEC 841K VEC 1002K 2m receiver kit VEC 1006K 6m receiver kit VEC 1010K 10m receiver kit VEC 1012K Emeregency and business BD receiver kit VEC 1016K 49MHz
250. OWOWWOYSYSYSYSYrYrrrrrrrrrrrrrrrowrrrrrrrroaraoa gt gt OOO Qa L R R Er CTET ET ET OOO OOO EA a L L R 28 LFA 5 28 DES 6 28 OWA 6 28 DES 7 28 DES 8 50MHz 50 LFA 10 XPOL LFA 12 XPOL 50 LFA 14 XPOL 50 LFAQ 2 RM 50 LFA2 7 HD 50 LFAQ 7 50 LFA2 7 WOS 50 LFA2 7 WOS HD 50 DES 8 50 LFA2 8 S T0 LFA 11 88MHz 88 DES 8 88 DES 11 88 DES 14 88 DES 16 88 DES 17 88 DES 20 144MHz 144 LFAQ 2 144 LFAQ 3 144 OWL 3 144 OWL 4 144 OWL 4 RM 144 OWL 5 144 OWL 5 RM 144 OWL 6 144 OWL 6 RM 144 OWL 7 144 OWL 8 144 144 144 144 144 LI 144 LI 144 144 144 144 144 144 144 144 144 144 144 144 144 144 144 144 144 144 5 element 6 element 6 element 7 element 8 element 10 elemen 12 elemen 14 elemen 2 elemen 2 elemen 3 elemen 2 elemen 3 elemen 3 elemen 3 elemen 5 elemen 4 elemen 4 elemen 4 elemen 5 elemen 5 elemen 5 elemen 5 elemen 6 elemen 6 elemen 6 elemen 6 elemen 6 elemen 6 elemen 6 elemen 6 elemen 7 elemen 7 elemen 7 elemen 7 elemen 7 elemen 8 elemen 8 elemen 9 elemen 8 elemen 10 elemen 9 elemen 10 elemen 11 elemen 2 elemen 2 elemen 2 elemen 3 elemen 3 elemen 3 elemen 5 elemen 4 elemen 4 elemen 5 elemen 5 elemen 6 elemen 6 elemen 6 elemen 6 elemen 7 elemen 7 elemen 7 elemen 8 elemen 9 elemen 10 elemen 11 elemen 8 elemen 11 elemen 14 elemen 16 elemen 17 elemen 20 elemen 2 elemen
251. PC cloning cable computer to radio USB type for ID 5100E OPC 440 Microphone extension cable 5m for ID 5100E OPC 647 Microphone extension cable 2 5m for ID 5100E OPC 1156 Controller extension cable 3 5m with joiner for ID 5100E CT 17 CI V level converter RS 232 computer interface for ID 5100E RS MS1A Android application for ID 5100E free download from Google play UT 133 Bluetooth unit for ID 5100E VS 3 I Bluetooth headset for ID 5100E ID E880 Accessories MBR 100 Spare mobile mount for IC E880 HM 103 Light weight hand microphone 600 Ohm for ID E880 HM 133 Spare remote control microphone for ID E880 Needs OPC 589 HM 154 Mobile hand microphone with up down buttons for ID E880 CS 880 Software for D E880 download free from www icomco jp world supportindex html OPC 1132A Spare DC power cable 3m for ID E880 OPC 1529R Data connection cable for PC or GPS receiver connection RS 232C type for ID E880 OPC 347 DC power cable 7m for ID E880 OPC 440 Microphone extension cable 5m for ID E880 OPC 441 Speaker extension cable 5m for IC D880 OPC 474 Cloning cable set to set for ID E880 OPC 478 PC cloning cable computor to radio RS 232C type for ID E880 OPC 478UC PC cloning cable computer to radio USB type for ID E880 OPC 589 Microphone adaptor cable for ID E880 to 8 pin round SP 10 Mobile speaker 5W 4Ohms for ID E880 IC 2730E 2m 70cm 50 50W dual band mobile transceiver bluetooth optional HM 154 Mobile hand microphone HM 207 Spare mobile hand micr
252. Programming aid for HX 270 Nicad battery pack for VX10 Lithium lon battery 7 4V 1600mAh for VX 800 PC SuperControl rig control software not Yaesu for FT 100 PC SuperControl rig control software not Yaesu for FT 847 PC SuperControl rig control software not Yaesu for FT 1000MPMKV amp Field WIRES II computer interface unit with software Speaker microphone For FT 23 411 811 911 Speaker microphone for VX 246 Microphone Microphone Heavy duty speaker microphone for VX 246 Microphone for VX 10 FT 50 Mobile mounting bracket for main unit of FT 100 43 95 12 95 33 95 49 95 9 95 1 95 6 95 41 95 18 95 38 95 169 95 169 95 123 95 8 95 99 95 99 95 9 95 9 95 9 95 12 95 33 95 42 95 9 95 9 95 1 95 7 95 41 95 18 95 38 95 109 95 8 95 33 95 49 95 9 95 9 95 1 95 41 95 23 95 8 95 99 95 99 95 9 95 9 95 9 95 12 95 28 95 31 95 33 95 42 95 49 95 9 95 9 95 1 95 7 95 41 95 18 95 38 95 224 95 8 95 28 95 31 95 33 95 42 95 49 95 9 95 9 95 1 95 7 95 25 95 20 95 20 95 10 95 6 16 17 95 1 95 23 95 6 95 0 99 0 99 1 95 1 95 3 95 1 95 6 95 33 95 83 95 41 95 3 95 4 95 10 95 10 95 16 95 9 95 14 95 23 95 13 95 18 95 5 95 41 95 23 95 39 95 43 95 59 95 59 95 59 95
253. R HA SSK KH 30 ESM 02 hand held Citizens Band AM FM SSB transceiver 10m FM AM USBILSB mobile repeater shift 1750Hz tone 25 Watts Albrecht Mobile 80 channel CB 4 Watts FM UK amp CEPT frequencies with CTCSS Albrecht Mobile 80 channel CB 4 Watts FM UK amp CEPT frequencies top of the range Handheld 80 channel CB 4 Watts FM selectable any of Europes CB bands 1 7 30 MHz 10 100 Watt SWR and power meter HF amplifier 26 30MHz 0 3 4W in 25W out on AM 50W out on SSB 12v AM FM SSB CB base station aerial 18 fibre glass tuneable 25 32MHz 5 8dB gain CB base station aerial 5 8 wave alloy 8 radials 26 29MHz 6 85m long 2500W max 7 5dB gain Sigma Sirio fibreglass CB base station antenna Sirio Signalkeeper loft aerial for CB DC power cord for Eurosonic KH 104 Speaker microphone for Eurosonic KH 104 COMPUTER AIDED TECHNOLOGIES SCANNER CONTROL SOFTWARE SGW FD BGW SE SCANCAT LITE MAGIC COMMRADIO CR 1 Scancat Gold for Windows Version 8 5 Scancat Gold for Windows Surveillance Enhanced version 8 5 Scancat Lite Plus for most Tandy scanners and BC 246 BC396 BC996 Uniden Converts frequency listings in a format for use with the IC PCR1000 SDR receiver S00KHz 30MHz 64 260MHz 437 468MHz SSB CWI FM AM no PC needed 89 95 1 30 279 95 3 95 4 95 5 95 5 95 6 95 0 95 1 25 1 49 1 49 2 25 4 95 0 95 1 25 1 49 1 49 2 25 4 95 19 95 199 95 54 95 59 95 159 95 199 95
254. R100 1000 Nautical weather data decoder for all PCR100 1000 only METEOCOM UP2 WMMeteocom 6 Update from ProMeteo2 inc 1yr Meteo Service METEOCOM UP2 NM Meteocom 6 Update from ProMeteo2 no Meteo Service METEOCOM UMS5 WM Meteocom 6 Update from Meteocoms Boardterminal98 Prometeo98 inc 1yr Meteo Serv METEOCOM UMS5 NMMeteocom 6 Update from Meteocomd Boardterminal98 Prometeo98 no Meteo Service BOOKS SPA MORSE LBVA B LBMP BI BOOKS RSGB HBCB BI VREX BI HFAE B MC11 B ABOC BI AFLM BI AFVA B ANTO B ARAS BI ARES BK AREX2 BK BKYA B BOXS BI BSHA BI CAMM BK CIRO B COMM BK DMFA BI EXSE B FDLN BI HART BI HFAR BK 2 HFAL B OTA 2009 OTA 40 BK OTA 07 BK D15 BK EXM BI MD6 BK MHB B MA2 BK NAC BK2 NAC BK RFD BK LBRX BI LFT 2BK LPSB BI The Secret of Learning Morse Code 4th edition 1997 Log book for licensed amateurs base station edition Log book for licensed amateurs mobile portable edition Homebrew Cookbook Virtual Radar Explained HF Antennas For Everyone Morse Code For Radio Amateurs 1 1th edition ABit Of Controversy Pat Hawkers life story By Steve White Advance The Full Licence Manual Antennas for VHF and Above Antenna Topics Amateur Radio Astronomy Amateur Radio Essentials George Brown Amateur Radio Explained 2nd edition Backyard Antennas 1940 s Amateur Radio Box Set Building Successful HF Antennas FJ Camm the Practical Man Circuit Overload Bumper Book of Circuits Comm
255. S GPS Waterproof VHF DSC marine transceiver with HM 162 AIS IC M603 AIS 162 GPSWaterproof VHF DSC marine transceiver with HM 162 AIS GPS OPC 1000 OPC 1541 OPC 478 OPC 478UC OPC 980 HM 126RB HM 162E MB 75 UT 112 GPS ANT CS M603 SM M603 MXA 5000 IC GM651 250 IC GM651 250 240 Extension cable for back panel microphone with bulkhead mount Extension cable for HM 162B SW E 6m long 20 feet Cloning cable PC to transceiver Cloning cable for radio to PC USB cable Cloning cable adaptor Remote control hand microphone standard Remote control hand microphone COMMANDMIC 3 Flush mount ki Voice scrambler unit with 32 codes GPS antenna Programming software for IC M603 on CD ROM Service manual on CD ROM for IC M603 AIS receiver dual receive capability 3rd party connection PC GPS input MED GMDSS class A VHF marine transceiver with PS 250 MED GMDSS class A VHF marine transceiver with PS 250 and PS 240 66 95 179 95 93 95 18 95 124 95 27 95 41 95 11 95 11 95 18 95 18 95 10 95 8 95 104 95 104 95 83 95 74 95 449 95 2 95 57 95 339 95 4 95 9 95 79 95 3 95 8 95 169 95 79 95 5 95 112 95 24 95 9 95 9 95 6 95 5 95 28 95 9 95 6 50 29 95 47 95 82 95 62 95 189 95 339 95 94 95 154 95 39 95 21 95 19 95 28 95 46 95 21 95 21 95 51 95 35 95 82 95 62 95 141 95 174 95 21 95 28 95
256. SC 35SE Spare rapid charger for KNB 63L and TH K20 40ET 2 pin EURO plug KVC 22W DC vehicle charger adapter needs KSC 35S for TH K20 40ET KNB 63L Spare Li ion battery 1130mAh for TH K20 40E KNB 65L Li ion battery 1520mAh for TH K20 40E BT 16W Dry cell case for TH K20 40T 6 x AAA cells EMC 12 Clip microphone with D type earpiece for TH K20 40E EMC 11 Clip microphone with earphone and PTT for TH K20 40E HMC 3 Headset boom microphone for TH K20 40E KHS 21 Headset with boom microphone less VOX for TH K20 40E KHS 29F Boom microphone with D type earpiece and PTT for TH K20 40E SC 56 Nylon carry case with steel belt clip built in for TH K20 TH K40E SMC 32 Speaker microphone for TH K20 40E SMC 33 Speaker microphone with 3 functions for TH K20 40E SMC 34 Speaker microphone with 3 functions and volume control for TH K20 40E KBH 18M Spare belt clip for TH K20 40E PG 4Y PC interface cable D Sub 9 pin for TH K20 40E KCT 53U Serial to USB adaptor with drivers for TH 20 40E MCP 5A Memory control program software for TH K20 40E free download from www kenwoodusa com TH K2E 2m FM 5W portable transceiver c w Ni MH battery charger TH K2ET 2m FM 5W portable transceiver c w keypad Ni MH charger TH K4E 70cm FM 5W portable transceiver c w Ni MH battery charger Listed 479 95 419 95 37 95 24 95 10 95 14 95 12 95 66 95 31 95 42 95 249 95 86 95 65 95 16 95 299 95 37 95 37 95 24 95 10 95 14 95 12 95 66 95 31
257. SET and Yaesu 4 pin round AD 1 YM Cable for PROSET and Elecraft K3 Yaesu modular AD 1 AP Cable for PROSET and Apache ADMY 817 8 pin round mic plug to 8 pin modular FT 817 mic socket adaptor HSTA IC8 Interface cable for Traveler to Icom 8 pin round HSTA IM Interface cable for Traveler to Icom modular eg IC 706 was ADM 706 HSTA K8 Interface cable for Traveler for Kenwood 8 pin round HSTA KM Interface cable for Traveler to Kenwood modular HSTA PC Interface cable for Traveller to Personal Computer HSTA YM Interface cable for Traveller to Yaesu 8 pin modular such as FT 817 HSTA YM6 Interface cable for Traveller to Yaesu FT 1500 FT 2800M FT 7800 F T 8800 FT 8900 6 pin modular HSTA KHT Interface cable for Traveler to Kenwood handhelds HSTA IHT Interface cable for Traveler to Icom handhelds HSTA VX Interface cable for Traveler to Yaesu handhelds CH 1 18 Coil cable for HM 4 5 IC PRO PRO PLUS and Icom 8 pin round CH 1 IM Coil cable for HM 4 5 IC PRO PRO PLUS and Icom modular CH 1 K8 Coil cable for HM 4 5 IC PRO PRO PLUS and Kenwood 8 pin round CH 1 KM Coil cable for HM 4 5 IC PRO PRO PLUS and Kenwood modular CH 1 Y8 Coil cable for HM 4 5 IC PRO PRO PLUS and Yaesu 8 pin round CH 1 YM Coil cable for HM 4 5 IC PRO PRO PLUS and Yaesu modular CC 1 C Cable 4 pin XLR female for GM4 5 amp HM 10 4 5 DUAL and Collins 3 16ths R A plug CC 1 D Cable 4 pin XLR female for GM4 5 amp HM 10 4 5 DUAL and Drake 4 pin CC 1 18 Cable 4 pin XLR female for GM4 5 a
258. SSB CW FM GaAsFET pre amp RU 432 95 70cm amplifier 6 12in 80 95W maximum out SSB CW FM GaAsFET pre amp RU 500 70cm amplifier 10 25W in 500W maximum out SSB CW FM built in psu CMSR 100 VHF marine amplifier 151 161MHz 4 25W in 100W maximum out GaAsFET pre amp CMSR 200 VHF marine amplifier 151 161MHz 8 50W in 200W maximum out GaAsFET pre amp MICROTELECOM PERSEUS Software defined radio 10KHz 30MHz MIRAGE 6M AMPLIFIER A 1015G 6m amplifier 1 15W in 150W max out 50 52MHz all mode preamp MIRAGE 2M AMPLIFIERS B 34 2m amplifier 0 2 8W in 35W out 2m FM only no pre amp MB B34 Mobile mounting bracket Z brackets set of 4 for Mirage B 34 amplifier B 34G 2m amplifier 0 2 8W in 35W out GaAsFET pre amp FM SSB B 310G 2m amplifier 0 2 8W in 100W out GaAsFET pre amp all mode B 320G 2m amplifier 25 10W or 10 50W in up to 200W out all mode pre amp B 1018G 2m amplifier 0 25 10 Watts in up to 160W out B 2518G 2m amplifier 0 5 35W in up to 160W out B 5018G 2m amplifier 5 50W in up to 160W out B 2530G 2m amplifier 25W in 300W out B 5030G 2m amplifier 20 60W in 300W out MIRAGE DUAL BAND 2m 70cm AMPLIFIER BD 35 2m 70cm dualband amplifier 4 Watts in 45 35 Watts out 12V MIRAGE HANDHELD TRANSCEIVER DOCKING BOOSTER ADAPTOR PLATES MI 2 Icom adaptor for 24 25 and 2S 2SAT 2SR 3S 3SAT 3SR 24 W2 X2 MI 3 Icom adaptor for 24 25 and W21 X21 W21T X21T etc MY 1 Yaesu adaptor for 24 25 and FT 23 204 73 704 104 728 etc MY 2 Yaesu adaptor for 24 25 and 24 74 2
259. SrKrKSrrErKSrESESFIVIVIVIFSSFODDVSDSESAWVIVIIAIDADIDIIVIIVDIIIDAADAAADAIDADADADANDNDDVVVVVVVVDDVIDIDDADADADDFSKSEVDDVIIVIIAVAAAAADAIDADAADADADAADAAAAAIAANIAINNIAN A i E A A a a A E A 9000000000000 00 1742 1748 1750 1754 1756 1762 1763 1764 1765 1766 1767 1768 1770B 1770C 1771B 1772B 1773B 1774B 1775 1775W 17754 17758 1776B 1777 1778 1778M 1779A 1779B 1779C 1780 1782X 1785 1786X 1788X 1976 1792 1793 1795 1795W 1796 1796W 1797 1797LP 1798 1800 1801 1805 1806 1810 1811 1812 1812 1815 1817 1817 1818 1820 1830 1840 1866 1868 1880 1890 1899 1903 1904 1904P95 1904HG18 1906 1906H 1907 1908 1908H 1908HD 1910 1911 1913 1915 1916 1917 1918 1919 1925 192512 1926 1932 1934 1953 1964 1964K 1965 1966 1977 1979 2010 2012 2013 2014 2016 2206 2210 2215 2217 2220 2230 2240 2275 2286 2289 2306T 2310T 23127 2315T 2317T 2320T 2330T 20 meter extended double Zepp antenna 80 meter end fed Zepp antenna 2m 5 8th base vertical 2m 70cm ground plane home base aerial 6m vertical aerial 3 element 6m beam 3 element 2m beam Stacked 5 8th wave radiators for 2 meters Phasing cables for 2 x MFJ 1764 2 x MFJ 1764 with phasing cables 3 element yagi for MFJ 856 RFI noise finder Dual band yagi 7 element 2m 70cm 15m single band folded dipole aerial
260. T 160mm long 9 95 JUP 4 Spare charger psu for UBC 280XLT 9 95 OP 5 Cigar lighter lead 12V with on off switch for UBC 280 220XLT 23 95 UBC 92XLT Handheld 25 88 108 174 406 512 amp 806 960MHz 200 mems BNC charger 2 x AA bett cliplant close call 119 95 RD U220 Spare rubber duck aerial for UBC 92XLT 160mm long 9 95 WEP 300MKI Over the ear earpiece 3 5mm mono jack plug Black for UBC 92XL 3 95 UBC 6V Cigar lighter lead DC to DC converter 12V to 6V for UBC 69 72 92 3500XLT 9 95 NXC 2AA Spare battery set 2 x AA cell Ni MH rechargeable 2600mAh 1 2V for UBC92XLT 2 95 UBC 72XLT Handheld 25 87 2625 amp 108 173 99 amp 406 512 MHz 100 mems BNC ciw charger 2x AA label dp 109 95 RD U220 Spare rubber duck aerial for UBC 72XLT 160mm long 9 95 WEP 300MK Over the ear earpiece 3 5mm mono jack plug Black for UBC 72XL 3 95 UBC 6V Cigar lighter lead DC to DC converter 12V to 6V for UBC 69 72 92 3500XLT 9 95 NXC 2AA Spare battery set 2 x AA cell Ni MH rechargeable 2600mAh 1 2V for UBC72XLT 2 95 UBC 69XLT 2 Handheld 25 88 137 174 406 512MHz 80mems BNC c w aerialbelt clip needs 2 x AA not supplied 79 95 WEP 300MKI Over the ear earpiece 3 5mm mono jack plug Black for UBC 69XL 3 95 UBC 6V Cigar lighter lead DC to DC converter 12V to 6V for UBC 69 72 92 3500XLT 9 95 NXC 2AA Battery set 2 x AA cell Ni MH rechargeable 2600mAh 1 2V for UBC69XLT 2 95 RD U220 Spare rubber duck aerial for UBC 69XLT 160mm long 9 95 UBC 30XLT Handheld 87 5 108
261. T C CET E CC C3 CCA OOOO COG T e T TK OD O TOO GO KKO T e e T K T OH HHOHOO TeO OD K PPOO p L CC C E C EC C3 CH CC CE e P P P Pr 98X 98BX 99X 99BX 99CX 99CXPRO 105D 107B 108B 112B 115 116DC 126B 129 201 202B 204B 207 208 209 212 217 219B 220A 220B 220C 220D 220E 220F 220G 224 225 226 229 249C 250 251 250X 259C CHG 259 260C 260CN 261 261N 263 264 264N 265 266C 267 269C 269PRO 270 270MF 270N 272 272MF 272N 280 281 282 282K 282R 282Y 2831 283K 283Y 284 284K 284Y 2851 285K 285R 285Y 286 288 288K 288R 288Y 290 290 290 14 290M1 290K 290K4 290MK 290 290 290Y 290Y4 290MY 291 291K 291Y 292 292K 292R 292Y 2931 293K 293R 293Y 294 294K 294Y 2951 295K 295R 295Y 2961 Fy MFJ 1922 SW sensor for High Sierra 1 x rechargeable 1 2Ah NiMH AA batteries 10 x rechargeable 1 2Ah NiMH AA battery Re mounting kit for MFJ 1734 and MFJ 1738 Replacement gas discharge tube for MFJ 270 270N Replacement gas discharge tube for MFJ 272 series MFJ 269 accessory pack MFJ 39C soft case MFJ 66 dip coils MFJ 1312DX PSU MFJ 269 accessory pack MFJ 39C soft case MFJ 1312DX PSU amp 10 AA Ni MH MFJ 259B accessory pack MFJ 29C soft case MFJ 66 dip coils MFJ 1312DX PSU MFJ 259B accessory pack MFJ 29C soft case MFJ 1312DX PSU 10 AA Ni MH MFJ 259B 269 acces
262. TEUR RADIO HEADSETS MICROPHONES amp ACCESSORIES Goldline Vintage Studio high imp Drake Collins etc narrow wide switch 4 pin XLR needs CC 1 Gold Elite dual element hand microphone HC 5 1 narrow amp Elite wide elements 4 pin XLR needs CC 1 149 95 Handy microphone with dynamic element 4 pin XLR needs CC 1 Hand microphone full range dynamic element needs AD 1 Hand microphone with IC electret element needs AD 1 GM V GM ELITE HM 12 HMM HMM IC HM IC HM PRO ICM PR 10RPKG PR 10PKG PR 781 PR 781 G HTH I HTH K HTH Y BM 10 BM 10 IC PMD 6 PMD IC PMS 6 PMS IC RO 7BK RO 7BU RO 7PK RO 7RD RO 7IC BK RO 7IC BU RO 7IC PK RO 7IC RD RO SET 3 RO SET 6 RO SET IC RO SET ELITE 6 RO SET ELITE IC RO SET K2 PSM MB 1 6 MB 1 IC CB 1PTT FS 2 FS 3 9999999999999 v Handy mic with Icom insert 4 pin XLR Handy mic with cardoid broadcast element witi needs CC 1 PTT PRO 4 pin XLR needs CC 1 Handy microphone with Icom element comes with 8 pin round Icom cable attached Dynamic Studio Quali Dynamic Studio Quali Deluxe microphone needs base complete with SM 3 3 pin XLR needs CC 1XLR Deluxe microphone needs base complete with SM 3 3 pin XLR Gold screen needs CC 1XLR Lightweight headset with reversible earpiece and in line PTT for 2 pin Icom transceivers Lightweight headset with reversible earpiece and in line P Lightweight headset with reversible earpiece and in line P Dynamic li
263. ULTI RANGER 200 Mobile whip 80 40 30 20 17 15 12 10 6 2m PL 259 base 200 Watts 1 9m long max 1kg WAB 6 Mobile antenna for 6 10 15 20 40 80m 3 8 WHF 160B 160m mobile whip 3 8 thread WHF 80B 80m mobile whip 3 8 thread WHF 40B 40m mobile whip 3 8 thread WHF 30B 30m mobile whip 3 8 thread WHF 20B 20m mobile whip 3 8 thread WHF 17B 17m mobile whip 3 8 thread WHF 15B 15m mobile whip 3 8 thread WHF 12B 12m mobile whip 3 8 thread WHF 11B 11m CB mobile whip 3 8 thread WHF 10B 10m mobile whip 3 8 thread WHF 6B 6m mobile whip 3 8 thread WHF 4B 4m mobile whip 3 8 thread WHF 2B 2m mobile whip 3 8 thread HFPL 4 4m mobile whip PL 259 base 96cm long 70 71MHz 200W HFPL 6 6m mobile whip PL 259 base 1 33m long 50 52MHz200W HFPL 15 15m mobile whip PL 259 base 1 25m long HFPL 20 20m mobile whip PL 259 base 1 25m long HFPL 40 40m mobile whip PL 259 base 1 25m long W 614 6m 1 4 wave mobile whip 200W PL 259 base 1 32m long HFPL 80 80m mobile whip PL 259 base 1 25m long WBP 1 38 Base plate to use mobile aerials as base aerials 3 8th socket WBP 1 PL Base plate to use mobile aerials as base aerials SO 239 socket W 285 2m 5 8ths whip SO 239 fold over base W 77LS 2m 70cms dualband whip SO 239 0 2 15dBi gain 0 39m long W 770HB 2m 70cms dualband whip SO 239 fold over base 3 5 5db gain 1 1m W 7900 2m 70cms dualband whip SO 239 fold over base 5 7 6db gain 1 5m W 627 6m 2m 70cms triband whip SO 239 fold over base 2 15 4 8 7 2dBi 1 62m
264. USB 29A USB cable kit 49 95 WCS D5100 DATA Programming software for ID 51E comes with USB RTS 05 USB cable 49 95 WCS 7100 U Programming software only for IC 7100 29 95 WCS 7100 USB Programming software for IC 7100 comes with USB RT 501 USB cable kit 49 95 WCS 9100 Programming software for IC 9100 comes with USB RT 501 USB cable kit 49 95 WCS D51 Programming software for ID 51E comes with USB RTS 05 USB cable 49 95 WCS 91 Programming software for IC E91 comes with USB 29A USB cable kit 49 95 WCS 92 USB Programming software for IC E92D comes with USB 92 USB cable kit 69 95 USB 92 USB cable only for IC E92D 49 95 ADMS 5888UV Programming software for Anytone AT 5888UV comes with USB A5R USB cable kit 49 95 YAESU HF TRANSCEIVERS AND ACCESSORIES FT DX9000MP Deluxe base station 400W HF amp 6m transceiver amber display 6 999 95 FT DX9000D Deluxe base station 200W HF amp 6m transceiver amber display 6 399 95 MD 200A8X Desk microphone for FT DX9000 189 95 MD 100A8X Desk microphone for FT DX9000 99 95 MH 31B8 Hand mic 8 pin scan adjustable tone for FT DX9000 34 95 SP 9000 External speaker with dual speakers and audio filter 239 95 YH 77STA Open air type stereo headphones for FT DX3000D 69 95 79101556 Control cable between FT 9000 and G 1000DXC 14 95 MTU 160 RF y tuning unit A 160m band unit for FT DX9000CONTEST installation option 399 95 MTU 80 40 RF y tuning unit B 80 40m band unit for FT DX9000CONTEST installation
265. V 1100mAh 39 95 EDS 12 Remote controller for DJ X30 24 95 A EBP 64 Li ON battery pack DC 7 4V 1600mAh 44 95 EA 154 Spare aerial for DJ X30 9 95 A EBP 65 Spare Ni MH battery pack DC 7 2V 700mAh 27 95 EBC 18 Spare belt clip for DJ X30 4 95 A EBP 66 Ni MH battery pack DC 7 2V 2000mAh 42 95 DJ X7E Handheld scanner AM NFM WFM 100kHz 13000MHz 179 95 C EDC 16B Mobile DC power cable with active noice filter amp cigar lighter plug 20 95 EA 133 Spare aerial for DJ X7E 11 95 A EDC 37 12V DC cable bare ends 6 95 EBP 58N Spare Li lon battery pack 3 7V 600mAh for DJ X7E 24 95 A EDC 43 12V DC cigarette lighter cable for charging Ni MH battery packs 8 95 EME 25 Spare curly cord earphone for DJ X7E 13 95 A EDC 144 Multiple 2 fast charger basket 39 95 WCN 3 Aerial adaptor SMA to BNC for DJ X7E 4 95 A EDC 148 Spare wall charger230V UK plug 9 95 EDH 32 Cigar lighter cable for DJ X7E 9 95 A EDH 34 Dry cell case 6 x AA 12 95 EME 18 Earphone for DJ X7E 9 95 A EDS 10 Speaker microphone cable adaptor 2 pin to 1 pin 8 95 ESC 38 Leatherette case for DJ X7E 14 95 A EDS 11 Clone cable 8 95 ERW 4C Programing cable for DJ X7E 39 95 C EME 12 Headset with single headphone VOX PTT 52 95 DJ X3E 100kHz 13000MHz Scanner Listed 149 95 149 95 C EME 13 Headset inner ear type with microphone and VOX 52 95 AL 330 Cloning cable for DJ X3 3 5mm stereo jack plug to 3 5mm stereo jack plug 1 2m 4 95 A EME 15 Tie pin microphone with VOX
266. W 8900 10m 6m 2m 70cm 2 15dBi 144mHz 5 5dBi 430mHz 60W FM 1 32m long W 2723 2m 70cm 23cm 2 15dBi 144mHz 5 5dBi 430mHz 7 5dBi 23cm 60W FM 0 85m long MR 777 2m 70cm 2 8dB 144mHz 4 8dB 430mHz gain 100W 1 5m long 3 8ths fitting WGM 270 2m 70cms on glass antenna 0 8m with 3 7m coax amp PL 259 50W TG MKD Kit for re mounting Watson on glass antennas WMW 500 VHF adjustable 1 4 wave whip SO 239 50 500MMHz PL 259 TAXI BNC 169 175MHz VHF high band taxi aerial c w mag mount coax amp BNC plug TAXI PL 169 175MHz VHF high band taxi aerial c w mag mount coax amp PL 259 plug WSM 270 2m 70cm antenna on a micro mag mount BNC 460mm long WSMA 270 2m 70cm antenna on a micro mag mount SMA 460mm long WSM 1900 25 1900MHz mobile gainer antenna on micro mag BNC 400mm long WSM 225 AVIATOR 2 VHF UHF airband antenna on micro mag receive and transmit WSM 138 Mobile VHF antenna on a micro mag mount BNC 138 500MHz adjustable GPS 150 Active magnetic mount aerial for GPS cable and BNC plug GPS 160 Active magnetic mount aerial for GPS cable and MCX plug WS MOBILE Sky Scan mobile scanning antenna amp magmount 25 1300MHz BNC plug TG SP On glass scanner antenna and cable kit 25 1300MHz PL 259 SCAN FORCE MOB Mobile whip for scanner complete with magnectic mount cable and BNC plug 25 2000MHz WATSON COAXIAL SWITCHES amp DUMMY LOADS DM 15W DM 15WN DM 150PL DM 200N CX 201N CX 201 CX SW2PL CX SW2N CX SW3PL CX SW3N CX SW4PL CX SW4N DC 800MHz dummy loa
267. X with BP 132 174 herette carry case for A22 3 case for BP 170 171 172 and IC T22 case for BP 173 180 and IC T22 herette case for IC T7 amp BP 170 171 172 herette case for IC T8 leatherette carry case for IC E91 Lone worker software Service manual on CD for IC M1EURO Bel clip for IC T3 Mobile mounting bracket for IC 706 front panel Carrying handle for IC 706 Aligator style belt clip for IC T3 Hook for Icom hand microphones with square type hole Mini CIV connection lead for remote control programing lead for IC M710 13 pin din plug wit Spare AT 180 lead Separation cable 3 5m for IC E208 Cloning cable for IC 207 CIV lead for IC PW 1 7 pin accessory cal short cable length model number is 706 039 3 pin to 13 pin to IC 706 model number is OPC597 001 le for IC PW1 Speaker microphone adaptor cable for Q 7 Spare AC cable with EMC for IC PW1 EURO EU version DC lead for IC M50 Programming cable Spare DC power cable for IC M60 10M control cable for AT 140 and IC M 802 Spare DC lead for IC 703 Power supply adaptor cable for IC 703 Software on CD ROM amp dongle for IC PCR 1000 IC amp Windows XP RSSI software Remote control software for IC E91 includes OPC 1529R Waterproof easet fits inside ear muffs for IC M1EURO Service manual on CD ROM for IC 2725 Service manual for IC E7 Service manual for IC R5 Service manual on CD for IC E91 Service manual on CD RO
268. X3 fully assembled 1 049 95 KXPA100 AT K 100W Power Amplifier amp KXAT 100 K ATU for KX3 modular kit 999 90 KXPA100 F 100W Power Amplifier for KX3 fully assembled 749 95 KXPA100 K 100W Power Amplifier for KX3 modular kit 699 95 KXAT100 F Internal auto ATU for KXPA100 fully assembled 349 95 rrrrrrrrrrrrrrrrrrrrrrrrrrrroanorrrrrrrrrr gt Y AVIV VDWADSVINDAAAVAAADATDTAVAADATATSESDDAAVAVDAVDAAVDAAAASFDWDSFOAOVQAQOQQAQAQAQAQVIGVRVANVIVNANQVVVVIVIVIYS KXAT100 K Internal auto ATU for KXPA100 modular kit KXPACBL KX3 to KXPA100 Integrated Adapter Cable allows automatic operation with KX3 of amplifier and ATU KXFL3 Dual Passband Roofing Filter 500Hz 1500Hz for Improved Dynamic Range on CW Data SSB for KX3 KXAT3 Internal 20W Automatic Antenna Tuner for KX3 KXPD3 Precision lambic Keyer Paddle for KX3 KXBC3 Internal NiMH Charger with Real Time Clock for Charging 8 x AA in radio for KX3 KX3 PCKT Transmit audio cable receive audio cable l Q output cable ACC2 IO module KXSERA PC Connection Cable 3 5mm to RS232 DB9 F for KX3 KXUSBA Spare PC Connection Cable 3 5mm to USB for KX3 E850524 Spare KX3 Power Cable CAT6CABLE CATE cable KXPA100 KX3 KXPA100 to KX3 cable KXFT817CBL KXPA100 to FT817 interface cable K2 K 15W 80 10m CW Transceiver Kit Requires soldering K2 100 K 100W 80 10m CW Transceiver Kit Requires Soldering KPA100 100W Option for K2 Transceiver KSB2 SSB Option f
269. XT 420 460 8 95 A XT180 Pair of PMR 446 transceivers with batteries Charger 16ch and earpieces 89 95 C TLKR T40 Pair of PMR 446 transceivers 8ch up to 4km range need 3 x AAA batteries not supplied 29 95 C TLKR T60 Pair of PMR 446 transceivers 8ch 121 codes up to 8km range rechargeable NiMH supplied 49 95 C TLKR T80 Pair of PMR 446 transceivers 8ch 121 codes up to 10km range rechargeable NiMH supplied 79 95 C 00115 Remote speaker microphone for XTNI XTNID Now MDPMMN4008 29 95 A 00173 Nylon carry case for XTR 446 29 95 A 00179 Headset with swivel boom mic for TLKR T5 T7 29 95 A 00242 Spare battery for T40 T60 T80 14 95 A GM 340BASE U Transceiver base station 4ch 25W UHF with desk mic and power supply 403 470MHz 489 95 D CM 140 V Mobile transceiver 219 95 C GPN6145 Desktop power supply for CM 140 340 160 360 189 95 C GSN6059A Extension speaker square 13w for GM 350 29 95 A HLN8153B Standard nylon carry case with belt loop for P 110 19 95 A HLN8255 7 5cm spring action belt clip for CP040 5 95 A HLN9665A Standard leather carry case with belt loop for GP 320 340 360 380 29 95 A HLN9714A Spare belt clip for GP 320 340 360 380 2 95 A HLN9756 Adaptor to BNC socket from GP 320 340 360 380 12 95 A HMN9754D Earpiece with microphone and PTT combined 2 wire beige for CP 040V U 70 95 C MDPMNLN4455 Audio adaptor for GP 344 388 28 95 A NAD6502R VHF antenna heliflex 146 174MHz for CP 040V U 9 95 A PMAD4015 VHF 14cm antenna 155
270. able per metre lack 25 amp DC power cable DC power cable per metre 50m drum of red b Red black 40 amp 100m drum of 3 co lack 40 amp DC power cable DC power cable per metre re rotator control cable 75 3 core rotator control cable per metre 100m drum of 7 co re rotator control cable medium duty 0 5 7 core rotator control cable per metre medium duty 100m drum of 8 co re rotator control cable heavy duty 7 x 1mm 1 x 2mm 8 core rotator control cable per metre heavy duty 50m drum of 10mm green yellow earth cable 7 strand 10mm green yellow earth cable 7 strand per meter 100m drum of Flexweave multi stranded copper wire Flexweave multi stranded copper wire per metre 100m tranded PVC covered tinned copper equipment wire 0 75mm for long wire aerials etc 50m stranded PVC covered tinned copper equipment wire 0 75mm for long wire aerials etc 139 95 69 95 1 50 44 95 0 79 159 95 2 50 79 95 39 95 1 00 169 95 2 00 49 95 0 80 85 95 0 89 49 95 0 80 85 95 1 00 89 95 1 20 49 95 1 00 19 95 0 35 29 95 0 50 39 95 0 80 39 95 0 60 39 95 0 60 11 95 0 20 24 95 0 25 24 95 0 40 39 95 0 40 49 95 0 80 89 95 1 50 84 95 2 99 54 95 0 80 89 95 1 30 149 95 2 00 79 95 1 75 72 95 1 00 29 95 14 95 Stranded PVC covered tinned copper equipment wire 0 75mm f
271. acy from ppm to 0 01ppm LAN box external Service manual for AR 2300 Custom RS232 lead for PC 9 pin female to female for SDU 5600 Substitute PC socket mounts on SDU 5600 to convert to USB driver disc supplied USB PC lead type A to B 2m long for SDU 5600 12v DC lead for SDU 5600 Spare 230V mains 3 pin UK power supply for SDU 5600 Spare 230V mains 2 pin EU power supply for SDU 5600 Service manual for SDU 5600 Spare operators manual for SDU 5600 Wireless camera detector Collins mechanical filter CW 300Hz for AR 5000 Collins mechanical 500Hz CW filter for AR 5000 Collins mechanical filter AM narrow 4 0KHz for AR 7030 Collins AM mechanical 6 0KHz filter for AR 5000 CTCSS board for AR 5000 Speech inverter for AR 5000 Tape recorder lead for AR 5000 ACC 8 pin connector for AR 5000 ACC 8 pin connector with free end lead for AR 5000 RS232 lead from AR 5000 to PC 9 way connector Spare DC lead for AR 5000 Spare 230V mains 3 pin UK power supply for AR 5000 Spare 230V mains 2 pin EU power supply for AR 5000 Service manual for AR 5000 5000 3 on CD ROM Service manual for AR 5000A 5000A 3 SPECTRUM MASTER CD PC control data base amp more for AR 5000 on CD ARD 25 TVA 1 OP 5000 APCO25 external decoder non trunking External FM NTSC TV demodulator Operators manual for AR 5000 5000 3 RS232 use AOR ACCESSORIES FOR AR 3000A DC 3000 AA 2001 RA 8600 CR 400 3000PC SM 3000A AOR ACCESSORIES FOR AR 7030 AR 5000 Spare DC
272. ad to Motorola GM300 series MPA EZMT6 Eazytalk interface lead to Motorola M110 series MPA EZMX Eazytalk interface lead to Maxon PM100 series MPA EZT2 Eazytalk interface lead to Tait 2000 series MPA EZYS6 Eazytalk interface lead to Yaesu VX1000 series MPA EZYS8 Eazytalk interface lead to Yaesu VX2000 series MPA EZPH80 Eazytalk interface lead to Phillips PMR80 series MPA EZPH29 Eazytalk interface lead to Phillips M290 series MPA EZEM27 Eazytalk interface lead to Maycom EM27 CB series MP GNM1 Eazytalk goose neck microphone SKYMASTS ANTENNAS S PAGE Circular downfire antenna state frequency SOFTROCK SOFTWARD DEFINED RADIO KITS PA 160 160m PA filter kit for Softrock RX TX PA 30 20 17 30 20 17m PAMfilter kit for Softrock RX TX PA 16 12 10 15 12 10m PA filter kit for Softrock RX TX ROCKY 3 X Serial interface kit with 3 5mm jack SPID ELEKTRONIK BIG RAS PWM Rotator for heavy duty azimuth and elevation 2 x 4 core control cable needed RAS PWM Rotator for medium duty azimuth and elevation 2 x 4 core control cable needed BIG RAK PWM Rotator for serious heavy array such as large EME system 4 core control cable needed RAK PWM Rotator for heavy duty 4 core control cable needed RAU PWM Rotator for medium duty 4 core control cable needed SPID MP Mounting plate SPID TCA Tower cage adapter for tower cage mounting SSB ELECTRONICS SSB SP 6 50 52MHz 6m mast head pre amplifier 20dB gain 500W bypass N SSB SP 2000 144 146MHz 2m mast head pre ampl
273. adaptor 4 pin power supplies to 2 pin connector Amp keying interface USB keyer knob interface for remote control Omni VIl operation Hand microphone 8 pin for Orion Il or Omni VII or Eagle 599 Regal desk microphone with 707 T8 lead included Ten Tec 8 pin 716 stand not included Additional cable for 707 microphone Icom 8 pin Additional cable for 707 microphone Kenwood 8 pin Additional cable for 707 microphone Ten Tec 4 pin for Jupiter Additional cable for 707 microphone Ten Tec 8 pin for Orion II OMNI VII and Yaesu Desk microphone coiled cord 8 pin Handheld straight microphone straight cord 8 pin Mic adaptor 4 pin socket to 8 pin plug Mic adaptor 8 pin socket to 4 pin plug Desk stand for 709A microphone USB soundcard digital mode adaptor cable RF speech processor price includes one output cable of your choice 8 pin Icom output cable for 715 8 pin Kenwood output cable for 715 4 pin Ten Tec amp Yaesu output cable for 715 8 pin Ten Tec amp Yaesu output cable for 715 Desk stand for 707 microphone com T8 adapter Kenwood T8 adapter DX PRO dual headset 8 pin Icom adapter cable 8 pin Kenwood adapter cable 4 pin Ten Tec adapter cable 8 pin Ten Tec Yaesu adapter cable Spare 4 pin DC power connector Spare 2 pin DC power connector Replacement 12V DC lead 4 pin Omni VI Paragons Corsairs Replacement 12V DC lead 2 pin for Model 550 Jupiter Pegasus Orions Omni VII Cable for paddles 3 5mm stereo plug amp tinned pig tails DX
274. adphone jack RS 232 computer interface for IC 7600 Spare mounting bracket for IC 7600 Mains power switch mode power supply 25 Amps for IC 7600 Service manual on CD ROM for IC 7600 HF amp 6m 100W transceiver with ATU DSP amp USB Antenna whip amp mount for IC 7410 Automatic antenna tuner HF plus 6m for IC 7410 6kHz st IF filter for HF 50MHz for IC 7410 3kHz st IF filter for HF 50MHz for IC 7410 Spare hand microphone with up down buttons for IC 7410 Dynamic desktop microphone for IC 7410 Desktop microphone for IC 7410 600 Ohm 8 pin deluxe base station desk microphone for IC 7410 Base station speaker small for IC 7410 Base station speaker small for C 7410 4 audio filters headphone jack RS 232 CLU converter computer interface for IC 7410 Carrying handle for IC 7410 Mains power switch mode power supply 25 Amps for IC 7410 Solid state HF 6m linear amplifier 1KW for IC 7410 Adapter cable for C 7410 Service manual on CD for IC 7410 HF 6m 4m 2m 70cm all mode DSTAR transceiver touch screen SD card slot DSP Mains power switch mode power supply 25 Amps for IC 7100 Antenna whip amp mount for IC 7100 Automatic antenna tuner HF plus 6m for IC 7100 Automatic tuning antenna 2 5 30MHz needs OPC 2321 Automatic ATU for IC 7100 Mobile speaker for IC 7100 Dynamic desktop microphone for IC 7100 needs OPC 589 Desktop microphone for IC 7100 needs OPC 589 Solid state HF 6m linear amplifier 1KW for IC 7100 needs OPC 589 Hand microph
275. aesu 2 pin 12 95 A PWRILOCK PowerLock RIGrunner retainer kit 12 95 WCT 321K Lapel microphone with over the ear earpiece for Kenwood 2 pin 12 95 A DCTOGO DCtoGO battery boxwith RIGrunner 118 95 WCT 321M Lapel microphone with over the ear earpiece for Motorola 2 pin 12 95 A BATT BOX 24 Battery box for group 24 size battery 18 95 POST STUD Battery post to stud conversion kit 9 95 WATSON HEADSETS AND THROAT MICROPHONES BATT FUSE Battery fuse and terminal kit 9 95 W 184 MX Y Headset with boom mic audio mixer and cables and adaptors for Yaesu 8 pin round 144 95 C PWR BRITE LED bright light strip needs 11 25V DC 35 95 W 184 MX I Headset with boom mic audio mixer and cables and adaptors for Icom 8 pin round 144 95 C RR 40051 WIFI WiFi module and antenna add on for RR 40051 42 95 W 184 MX K Headset with boom mic audio mixer and cables and adaptors for Kenwood 8 pin round 144 95 C PS CBL 3 Spare DC lead for RIGrunner 3 feet long powerpole to ring terminals 7 95 W 184 Communications heaset boom microphone for HF base stations 29 95 C PS CBL 6 Spare DC lead for RIGrunner 6 feet long powerpole to ring terminals 12 95 EP BM BLACK PAIR Replacement ear pads for W 184 4 95 A PS CBL 10 Spare DC lead for RIGrunner 10 feet long powerpole to ring terminals 19 95 LX 8K Headband with earpiece and boom mic locking PTT for Kenwood 19 95 A C15 PK 12 12 spare connector pairs for RIGrunner 15 Amp 11 95 X 17Y Throat microphone amp earpiece with PTT
276. aesu FT 847 le set for Yaesu FT 890 le set for Yaesu FT 900 le set for Yaesu FT 920 le set for Yaesu FT 950 le set for Yaesu FT 990 le set for Yaesu FT 9000 le set for Yaesu FT 1000D le set for Yaesu FT 1000MP le set for FLEX 5000 le set for Elecraft K2 and K3 e sel le set for Icom le set for Icom le set for Icom le set for Icom le set for Kenwood TS 990 e sel le set for Kenwood e sel e sel e sel le set for OMNI V le set for OMNI VII e sel le set for FT 450 le set for FT 736 le set for FT 757 le set for FT 767 le set for FT 840 le set for FT 847 le set for FT 890 ble set for FT 920 le set for Yaesu FT 950 ble set for Yaesu FT 990 le set for Yaesu FT 9000 le set for Yaesu FT 1000D le set for Yaesu FT 1000MP e set for Elecraft K2 e set for Elecraft K3 for Microham DI DI DI DI DI DI DI DI DI DI DI DI DI DI DI DI DI DI DI DI DI DI DI DI ts without microphone 14 150 14 350MHz ts with microphone 14 150 14 350MHz ts without microphone 7 150 7 300MHz ts with microphone 7 150 7 300MHz ts without microphone 3 750 4 000MHz h microphone 3 750 4 000MHz 1 8 30MHz 2 5kW continuous high power full feature manual antenna tuner 1 8 30MHz random wire tuner 200 Watts MFJ porcelain coffee mug TY PSK31 SSTVIOLIVIAMFSK APRS PacketEcholink Two Radio Controller Multifunction with single USB connection or Stand alone without computer Controller for two radios Cable connectin
277. agi 67 element 20 0 dBd SHF 1658 Meteosat 58 element yagi 18 7dBd X QUAD 2M X Quad 2m X QUAD 2MCD X Quad 2m cut down version X QUAD 700M X Quad 70cm X QUAD 70CMCD X Quad 70cm cut down version E 3 3 1 1 2 3 m 3 28 95 21 95 99 95 21 95 19 95 4 95 0 95 0 95 9 95 14 95 29 95 5 95 119 95 6 95 21 95 9 95 4 95 5 95 7 95 2 95 9 95 46 95 334 95 245 95 199 95 235 95 10 95 20 95 18 95 5 95 m m 159 95 159 95 249 95 239 95 3 95 9 95 21 95 9 95 299 95 42 95 11 95 99 95 99 95 109 95 54 95 79 95 89 95 89 95 95 95 10 95 199 95 279 95 119 95 189 95 229 95 259 95 329 95 179 95 229 95 299 95 319 95 389 95 349 95 429 95 529 95 179 95 229 95 239 95 289 95 309 95 389 95 399 95 529 95 189 95 229 95 299 95 389 95 469 95 239 95 299 95 369 95 429 95 529 95 259 95 329 95 389 95 479 95 549 95 299 95 439 95 549 95 669 95 099 95 379 95 499 95 629 95 399 95 99 95 349 95 469 95 79 95 449 95 49 95 69 95 99 95 49 95 219 95 49 95 44 95 69 95 44 95 69 95 TK e OOO OOO KT K e e K D T K e T K K T T C T Te L
278. al HM 131 Speaker microphone HM 153 Earphone Microphone HM 166 Earphone microphone HM 174 Waterproof speaker microphone for IC E92D HM 175GPS Speaker microphone with GPS receiver built in for IC E92D HM 75A Hand held speaker microphone with up down OPC 1797 Adaptor for speaker microphone to take usual 2 pin type OPC 474 Cloning cable transceiver to transceiver RS 92 Remote control software and cloning for IC E92D includes lead OPC 1799 CP 12L Cigarette lighter cable with noise filter CP 19R Cigarette lighter cable DC DC convertor built in OPC 254L DC power cable with 1end bare wires L shaped plug with in line fuse 5 95 18 95 36 95 72 95 18 95 124 95 27 95 12 95 31 95 10 95 28 95 46 95 21 95 31 95 18 95 11 95 10 96 18 95 10 95 63 95 104 95 14 95 18 95 25 95 14 95 31 95 15 95 20 95 31 95 72 95 27 95 57 95 18 95 124 95 27 95 12 95 31 95 10 95 28 95 46 95 18 95 10 95 18 95 10 95 69 00 13 95 399 99 52 95 OFPFrFrFrFOFEFOFSFSFSPANVQIOSFSESESFSESPOANINQINIOSFOTSESEHSELPOFYSSSFSFPOFSFOYSFOYFYSPYSYSrYrYKrYKFrYKFrOWFrYrYrYrrrroryryrFrrororryEe rFrrrrarrraorrrTrrandrnnrngr ror rroa rFrrwmwmrrandnndnndaogrrroao F HS 85 LC 168 MB 111 SP 13 ACCESSORIES FOR IC E90 FAS 6270D BC 06 BC 139 CP 19R BP 216 BP 217 HM 54 HM 75A HM 128 HM 131L HM 166 HS 85 HS 94 HS 95 HS 97 OPC 474
279. al TNC for DR 135 99 95 MUF 2 Spare large windshield for Adonis desk microphones 3 95 A WPC 12 Spare 12V DC lead C W 2 x 15A fuses for DR 135 9 95 ERW 4C Programing cable for DR 135 39 95 AIRNAV SYSTEMS LLC DR 435EMKIll 70cm mobile 35 Watts FM voice data transceiver 199 95 WPC 12 Spare 12V DC lead C W 2 x 15A fuses for DR M03 06 9 95 SHIPTRAX 3D Advanced Windows based ship tracking applications with Google Earth and in 3D 489 95 C EMS 53 Spare hand microphone for DR 135 34 95 SHIPTRAX PRO Advanced Windows based ship tracking applications 399 95 C EMS 56 Hand microphone back lit with DTMF key pad for DR 135 39 95 RADARBOX MICRO Realtime aircraft display on PC USB Dongle and antenna included COMING SOON TBA C EMS 57 Hand microphone back lit with DTMF amp remote contol key pad for DR 135 49 95 RADARBOX 3D See real aircraft on PC just like on a real radar display with Google Earth 3D 99 95 C EJ 41U Optional TNC for DR 435 99 95 RADARBOX UG Upgrade from RADARBOX 2009 to RADARBOX 3D Software Only 199 95 C ERW 4C Programing cable for DR 435 39 95 RADAR COM 10 RADAR EXTENDER RADAR AMP all coax leads 10m 259 95 C RADAR COM 20 RADAR EXTENDER RADAR AMP all coax leads 20m 299 95 C ALINCO HANDHELDS amp ACCESSORIES RADAR INT Spare indoor aerial for AirNav RadarBox 19 95 C DJ A10 136 173 995MHz 5W transceiver 76 108MHz RX WFM 128 memories 89 95 RADAR RAMA External antenna for RadarBox 57cm long inc mounting tube c w clamps N
280. al tracer 1MHz to 6GHz nicad pack charger and aerial DIGI HUNTER Frequency counter 30MHz 2 8GHz Analogue amp Digital nicad pack charger amp aerial WR 5002 Nearfield receiver with reaction tune auto hold amp S meter nicads charger and aerial WFC PSU EU Spare power supply charger for Watson counters 2 PIN EURO WFC PSU Spare power supply charger for Watson counters 3 PIN UK WATSON SPEAKERS SP 140B Mobile communications extension speaker SP 160 Mobile communications extension speaker SP 170F Mobile communications speaker filter and volume 3m cable 3 5mm mono jack plug SP 180A Amplified mobile communications speaker with AF gain control cigar lead etc SP 2000 Sun visor fitting mobile speaker WATSON VSWR amp POWER METERS WCN 200 Cross needle VSWRIPOWER meter 1 8 200MHz 0 5 30W 300W 3kW WCN 400 Cross needle VSWR POWER meter 140 525MHz 0 5 30W 300W 600W WCN 600 Cross needle VSWR POWER meter 1 8 200MHz 30 300 3000W amp 140 525MHz 30 300 600W WATSON MICROPHONES AND ACCESSORIES UB 802 Behringer 8 input 2 bus mixer with Xenyx mic preamps and British EQ s WM S FT Mobile microphone with PTT packed with Yaesu RJ 11 6 pin modular plug lead WYL 6M WM S RW Mobile mic PTT choose 1 x free lead WKL 8M WIL 8M WYL 8R WKL 8R WIL 8R WM S IC Mobile microphone with PTT for Icom choose 1 x free lead WIL 8M or WIL 8R WM S 7000 Mobile microphone with PTT for Icom IC 7000 with free WIL 8M lead WYL 6M Lead for WM S to Yaesu small modular RJ 11 6 pin
281. and mi ncoder decoder unit unit for DJ G al 240 memories for DR 605 Trunking logic board for DJ 195 nk board for DR 135 435 ice board for DR 135 peech board for DJ 596 MKI Earphone microphone for any handheld Earphone microphone for any handheld Headset with VOX PTT for DJ G5 Speaker microphone for DJ 100 500 120 Replacement microphone for DR 150 610 Speaker microphone for DJ C1 4 5 needs EDS 7 Speaker microphone for DJ C1 4 5 needs EDS 7 icrophone for DR 140 DTMF microphone for DR 605 Dynamic hand microphone for DR 135 435 8 pin round Speaker microphone Dynamic hand microphone 49 95 41 95 15 95 39 95 39 95 11 95 24 95 39 95 29 95 29 95 29 95 4 95 14 95 14 95 14 95 22 95 34 95 49 95 19 95 6 95 9 95 68 95 9 95 12 95 44 95 24 95 39 95 52 95 52 95 49 95 14 95 39 95 39 95 4 95 14 95 24 95 29 95 20 95 13 95 9 95 9 95 11 95 14 95 29 95 11 95 11 95 11 95 11 95 11 95 11 95 19 95 14 95 9 95 14 95 14 95 9 95 9 95 9 95 23 95 4 95 4 95 4 95 19 95 32 95 49 95 26 95 24 95 27 95 32 95 24 95 24 95 9 95 14 95 59 95 14 95 49 95 14 95 19 95 32 95 24 95 9 95 14 95 15 95 19 95 69 95 19 95 52 95 44 95 12 95 27 95 34 95 10 95 44 95 8 95 29 95
282. ands Computers Micro controllers amp DSP for the radio Amateur Digital Modes For All Occasions Amateur Radio Exam Secrets Foundation Licence Now 25 Years Of Hart Reviews HF Amateur Radio 2nd Edition HF Antennas For All Locations 3rd edition OTA Directory Celebrating 45 years edition OTA Directory 40th anniversary edition OTA Directory OTA directory 15th edition 2011 international Examination Manual termediate Licence Building On The Foundation 6th edition ternational Microwave Handbook ternational Microwave Handbook 2nd Edition ternational Antenna Collection 2 ternational Antenna Collection roduction To RF Design Log book for short wave listeners LF Today 2nd Edition Low Power Scrapbook Microwave projects Microwave Projects 2 HF Antenna Collection he Amateur Radio Operating Manual 7th Edition Practical Antennas For Novices PIC Basics RSGB Prefix Guide 8th Edition Power Supply Handbook Perera s Telegraphic Collectors Guide Practical Wire Antennas 2 QRP Basics Radio Nature Radio Orienteering ARDF Handbook he RSGB Guide To EMC Radio Communication Handbook 10th edition RF Design Basics he RGSB Rig Guide 2014 Radio Propagation Principles and Practice by lan Poole Six Metre Handbook echnical Compendium 1 echnical Topics Scrapbook All 50 Years echnical Topics Scrapbook Marklll 2000 04 Pat Hawker SS555 5 294 95 264 95 529 95 199 95 189 95 64 95 64 95 79 9
283. angled Adaptor PL 259 plug to N socket Adaptor PL 259 plug to phono socket Adaptor SO 239 to SO 239 socket joins 2 X PL 259 plugs Adaptor PL 259 plug to PL 259 plug Adaptor BNC socket to BNC socket joins x 2 BNC plugs Adaptor BNC plug to BNC plug Adaptor N plug to SO 239 socket Adaptor N plug to BNC socket Adaptor 3 pin XLR plug to 1 4 inch stereo jack plug Adaptor N plug to SMA socket Adaptor BNC plug to SO 239 socket Adaptor BNC plug to N socket Adaptor N socket to N socket joins 2 N plugs Adaptor N socket to N socket joins 2 N plugs gold centre pin Adaptor N plug to N plug Adaptor PL 259 plug to 3 8th socket Adaptor BNC plug to 3 8th socket Adaptor 3 8th socket to 3 8th socket joins 2 x 3 8th plugs Adaptor 3 8th stud to 3 8th stud joins 2 x 3 8th sockets Adaptor 3 8th stud to 3 8th socket with hinge Adaptor BNC socket to 3 5mm mono jack plug Adaptor BNC plug to BNC socket 90 degree elbow Adaptor PL 259 plug to S0239 socket 90 degree elbow Adaptor SO 239 to car radio aerial plug Adaptor N plug to TNC socket Adaptor TNC socket to TNC socket joins two plugs Adaptor BNC plug to TNC socket Adaptor TNC plug to SO 239 socket Adaptor 2 5mm stereo jack socket to 3 5mm stereo jack plug Adaptor 1 4 stereo jack plug to 3 5mm stereo jack socket Adaptor 1 4 stereo jack socket to 3 5mm stereo jack plug Adaptor headphone splitter 3 5mm stereo jack plug to 2x3 5mm stereo jack sockets 9 9 9 9 9 9999
284. ar piece type needs OPC 1392 Headset neck arm type needs OPC 1392 Earphone with throat mic needs OPC 1392 VOXIPTT unit needs HS 94 Swivel belt clip Alligator style belt clip Fixed type non swing belt hanger Swivel type leather belt hanger Bare ends DC lead for battery charging or 12 V supply DC cable 12 20V for BC 121N Cloning cable serial Cloning cable USB type Programming software for IC F61M Service manual on CD ROM for IC F61M GMDSS survival craft 2 way VHF radio Wheel Mark MED certification BC 119N charger adapter Fast charger includes AD 109 amp BC 145 BP 224 only 6 way charger including 6 x AD 109 adaptors and BC 157 BP 224 only UK mains PSU for BC 119N fast charger Charger 2 pin euro for BC 158 Spare AC adaptor for BC 121 Desktop charger 12V cigarette lighter lead for charging or 12V supply Lithium battery pack non rechargeable 9 0V 3300mAh Waterproof speaker microphone was HM 125 Headset ear piece type needs OPC 1392 Headset neck arm type needs OPC 1392 Earphone with throat mic needs OPC 1392 Spare Alligator style belt clip YELLOW Swivel belt clip Fixed type non swing belt hanger Swivel type leather belt hanger Cloning cable PC to transceiver Bare ends DC lead for battery charging or 12 V supply DC cable 12 20V for BC 121N Cloning cable adaptor Headset adaptor cable for VOX hands free operation Cloning software needs OPC 478 and OPC 922 for IC GM1600 Service manual on CD ROM for IC GM1600 M
285. arger for FNB V95LI FNB V96LI and 230V EU 2 pin plug Desktop rapid charger for FNB V95LI FNB V96LI and 230V UK 3 pin plug Multi unit charger for FNB V95LI FNB V96LI and 230V EU 2 pin plug Multi unit charger for FNB V95LI FNB V96LI and 230V UK 3 pin plug Vehicle charger mounting adaptor for VAC 300 Earpiece with in line microphone for VX 351 354 Speaker microphone noise cancelling for VX 351 354 Speaker microphone small type for VX 351 354 Speaker microphone miniature type for VX 351 354 VOX headset for VX 351 354 DTMF paging and encryption for VX 351 354 Rolling code encryption unit for VX 351 354 Inversion encryption unit for VX 351 354 MDC1200 GE STAR ANI encoder only unit for VX 351 354 Leather case and belt loop for VX 351 354 Leather case and swivel belt loop for VX 351 354 Leather case and belt loop for VX 351 354 Leather case and swivel belt loop for VX 351 354 Cloning cable for VX 351 354 Programming kit for VX 351 354 USB interface adaptor for use with CT 106 Programming cable interface for VX 351 354 connects to FIF 10A Programming software for VX 351 354 Antenna connector adaptor SMA BNC for VX 351 354 Handheld 32ch VHF 146 174MHz 5W no display Handheld 32ch UHF 400 430MHz no display Handheld 32ch UHF 440 470MHz no display Handheld 32ch VHF 146 174MHz 5W keypad and display Handheld 32ch UHF 400 430MHz keypad and display Handheld 32ch UHF 440 470MHz keypad and display Handheld 256ch UHF 440 470MHz keypad and display 13
286. arine transceiver with AIS receiver White Spare Flush mount bracket for GX 2100 RAM plus microphone for GX 2100 Black RAM plus microphone for GX 2100 White Rubber cover for CMP30B and VH 310 socket for GX 2100 Microphone clip hanger for CMP30B for GX 2100 Original cable with socket for CMP30B and VH 310 for GX 2100 23 foot RAM plus extension cable for GX 2100 Voice scrambler for GX 2100 3 loud hailer horn for GX 2100 5 x 8 rectangular loud hailer horn for GX 2100 External speaker for GX 2100 Loud hailer extension intercom speaker with call button for GX 2100 10W external amplified speaker for GX 2100 Sun cover for GX 2100 Programming software for GX 2100 Programming cable side to side for GX 2100 Programming cable PC side for GX 2100 VHF DSC fixed marine transceiver with AIS input Black VHF DSC fixed marine transceiver with AIS input White Spare Flush mount bracket for GX 2000 RAM plus microphone for GX 2000 Black RAM plus microphone for GX 2000 White Rubber cover for CMP30B and VH 310 socket for GX 2000 Microphone clip hanger for CMP30B for GX 2000 Original cable with socket for CMP30B and VH 310 for GX 2000 23 foot RAM plus extension cable for GX 2000 Voice scrambler for GX 2000 3 loud hailer horn for GX 2000 5 x 8 rectangular loud hailer horn for GX 2000 External speaker for GX 2000 Loud hailer extension intercom speaker with call button for GX 2000 10W external amplified speaker for GX 2000 Sun cover for GX
287. ase enclosure Additional base enclosure for IC F510 Scrambler unit inversion and rolling Digital unit provides 6 25KHz digital capacity Digital unit provides IDAS 6 25KHz digital capacity 2 tone 5 tone unit 40 pin type Separation cable 3 meters needs RMK1 Separation cable 8 meters needs RMK1 Separation cable 1 9 meters needs RMK1 Controller separation kit Programming software for IC F5062 6062 dealers only Service manual on CD ROM for IC F5062 6062 VHF 136 174MHz 25W PMR HM 100N mount DC cable VHF 136 174MHz 25W PMR HM 100N mount DC lead keypad UHF 400 470MHz 25W PMR HM 100N mount DC cable UHF 400 470MHz 25W PMR HM 100N mount DC lead keypad Heavy duty microphone Standard mobile microphone Mobile 10 key microphone Separation cable 3 meters needs RMK1 Separation cable 8 meters needs RMK1 Separation cable 1 9 meters needs RMK1 Accessory cable Cloning cable dealers only 10 Amp power supply with choice of base enclosure Additional base enclosure for IC F1710 Remote head mount kit needs OPC 609 Scrambler unit inversion Scrambler unit inversion and rolling Desk microphone Cloning software for IC F1710 1810 2710 2810 Service manual on CD ROM for IC F1710 1810 2710 2810 ICOM REPEATERS AND ACCESSORIES SRP U11 SRP U06 SRP V06 SRP X06 IC FR5100 AD 115230 IC FR6100 HM 152 SM FR5000 MPX2 6LN 4 6 MPX2 6LN 6 15 MPX2 6HN 4 6 MPX2 6HN 6 15 MPX7O 6LN 5 7 MPX7O 6LN 7 9 MPX70 6LN 9 13 MPX7O 6LN 13 16 MPX70 6
288. base 26 95 RR 4012 RIGrunner 12 way 12V distribution board 112 95 C WR AX 12B Wide band antenna system 3 outputs in the range 0 15 1500MHz 5 475 95 RR 4008 C RIGrunner 8 way 12V distribution board complete with 2m cable 24 connectors 121 95 C WR AX 31CHX Wide band antenna system 3 outputs in the range 0 15 1500MHz 5 475 95 RR 4008 RIGrunner 8 way 12V distribution board 104 95 C WR AX 81S Active HF antenna 224 95 RR 4008H C RIGrunner 8 way 12V distribution horizontal board complete with 2m cable 24 connectors 112 95 C WR AC RMB 114 Rail mounting accessories for AX 81S antenna 37 95 RR 4008H RIGrunner 8 way 12V distribution horizontal board 95 95 C WR AC DMB 114 Deck mounting accessories for AX 81S antenna 37 95 RR 4005 C RIGrunner 5 way 12V distribution board complete with 2m cable 12 connectors 79 95 C WR LWA 0130 Long wire balun for medium wave and short wave 0 1 30MHz 39 95 RR 4005 RIGrunner 5 way 12V distribution board 66 95 C WR CMC 30 Common mode choke 39 95 RR 4005H C RIGrunner 5 way 12V distribution horizontal board complete with 2m cable 12 connectors 79 95 C WR BT 650 HF VHF power injector bias T 96 95 RR 4005H RIGrunner 5 way 12V distribution horizontal board 66 95 C WR BT 3500 VHF UHF power injector bias T 96 95 RR 40051 Monitor and control DC power distribution systems from internet ready mobile device or PC 245 95 C WR DNC 3500 Frequency down convertor 224 95 RR 4004U C RIGrunner 4 way 12V distribution
289. bler Charger adaptor for BC 119N amp BC 121N Spare UK mains charger for use with BC 152 Fast charger includes AD 100 amp BC 145 6 way charger including 6 x AD 100 adaptors and BC 124 UK mains PSU for BC 119N fast charger Desktop charger for IC F5 Spare AC adaptor for BC 121 Spare Desktop fast charger UK 3 pin for IC F51V Spare Desktop fast charger EU 2 pin for IC F51V 12V cigarette lighter lead for charging or 12V supply Dry cell case for IC F51 5 x AA cells Spare Li lon battery 7 2V 1700mAh Aerial VHF 150 174MHz SMA Aerial VHF 136 150MHz Aerial VHF 150 162MHz 90mm stubby Aerial VHF 160 174MHz 90mm stubby Waterproof speaker microphone Waterproof speaker microphone with programmable button Waterproof speaker microphone with GPS for BIIS mode position tracking Waterproof speaker microphone Headset ear piece type needs VS 1L Headset neck arm type needs VS 1L Earphone with throat mic needs VS 1L VOXIPTT unit needs HS 94 Swivel belt clip Alligator style belt clip Fixed type leather non swing belt hanger for use with MB 94 Fixed type leather non swing belt hanger for use with N batteries Bare ends DC lead for battery charging or 12 V supply DC cable 12 20V for BC 121N Cloning cable serial Cloning cable USB type Programming software for IC F51 dealers only Service manual on CD for IC F51 Waterproof 136 174MHz c w batt charger ant belt clip scrambler Waterproof 400 470MHz c w batt charger ant bel
290. board complete with 2m cable 12 connectors dual USB 89 95 C WR LNA 3500 Low noise amplifier 224 95 RR 4004U RIGrunner 4 way 12V distribution board dual USB 75 95 C WR DASP 2500 Dual action surge protector 42 95 SO PWR Auxiliary battery isolator 83 95 C WR ACD 1800 Dual antenna combiner 224 95 PWR GUARD Automatic safety switch with audible alarm 104 95 C WR UBF 1800 Universal broadcast filter 168 95 PG 40S PowerGate backup power system can supply up to 40 Amps 10 Amp charger 129 95 C WR SF 41 US Low noise linear power supply USA and Canada 17 95 PG 40S C PowerGate backup power system can supply up to 40 Amps 10 Amp charger cables amp plugs 149 95 C WR SF 41 EU Low noise linear power supply continental Europe 17 95 PG 40S CR PowerGate backup power system can supply up to 40 Amps 10 Amp charger for RIGrunner 149 95 C WR SF 41 UK Low noise linear power supply UK 17 95 PWRICHECK Integrated DC power analyser watt and voltage monitor 164 95 C WR SF 41 AU Low noise linear power supply Australia 17 95 PWRICRIMP High performance crimp tool for powerpole connectors 15 30 amp 45 Amps 36 95 C WR SF 41 JA Low noise linear power supply Japan 17 95 Srrrrrrrrrrrrrrrrrrrrrrrranodrrraorraoarrrrr YS TK e e OH HHOH e e 9 9 O T K HD OHO OOO GOGOGOGOGO GO GOGO GOGO GO GOGO GOGO GOGO GOGO GOGO GOGO GO WONDERWAND WONDERWAND WB_ The Wonderwand wide bander BNC portable aeria
291. boom length 4 15m 9 1dBd gain ZX 15 4 15m 4 element beam boom length 6 4m 11 4dBd gain ZX 15 5 15m 5 element beam boom length 10 2m 12 1dBd gain ZX 15 6 15m 6 element beam boom length 14 7m 12 7dBd gain ZX 17 2 17m 2 element beam boom length 1 45m 6 3dBd gain ZX 17 3 17m 3 element beam boom length 4 9m 9 1dBd gain ZX 17 4 17m 4 element beam boom length 7 5m 11 4dBd gain ZX 17 5 17m 5 element beam boom length 11 2m 12 1dBd gain ZX 17 6 17m 6 element beam boom length 17 4m 12 7dBd gain ZX 20 2 20m 2 element beam boom length 1 7m 6 3dBd gain ZX 20 3 20m 3 element beam boom length 6 0m 9 1dBd gain ZX 20 4 20m 4 element beam boom length 9 4m 11 4dBd gain ZX 20 5 20m 5 element beam boom length 14 4m 12 1dBd gain ZX 20 6 20m 6 element beam boom length 22 0m 12 7dBd gain ZX 30 2 30m 2 element beam boom length 2 35m 6 3dBd gain ZX 30 3 30m 3 element beam boom length 8 55m 9 1dBd gain ZX 40 1 40m rotary dipole ZX 40 2 40m 2 element beam boom length 3 35m 6 3dBd gain ZX 40 3 40m 3 element beam boom length 10 7m 9 1dBd gain G4MH 2 2 element 3 band minibeam G4MH 3 3 element 3 band minibeam MINI WARC WARC dipole 12 17m MINI 2000 10 15 20m 3 element beam boom length 2m 3 5 6 1dBd gain SHF 2328 23cm 28 element yagi 15 4dBd gain 1 6m long N type SHF 2344 23cm 44 element Yagi boom boom length 3m 18 1dBd gain N socket SHF 2367 23cm 67 element Yagi boom boom length 5 1m 19 9dBd gain N socket SHF 1340 13cm yagi 40 element 16 6dBd gain SHF 1367 13cm y
292. cable 49 95 ADMS 1900 Programming software for FT 1900 comes with USB 29F USB cable 49 95 ADMS 1G Programming software for VX 7 comes with USB 57B USB cable 49 95 ADMS 1 Programming software for FT 60 comes with USB 57A USB cable 49 95 ADMS 2600 Programming software for FT 2600 comes with USB 29C USB cable 49 95 ADMS 2900 Programming software for FT 2900 comes with USB 29F USB cable 49 95 ADMS 2H Programming software for FT 8900 comes with USB 29B USB cable 49 95 ADMS 2I Programming software for FT 8800 comes with USB 29B USB cable 49 95 ADMS 2K Programming software for FT 7800 comes with USB 29B USB cable 49 95 ADMS 3 Programming software for VR 500 comes with USB 29A USB cable 49 95 ADMS FT DX3000 Programming software for FT DX3000 comes with USB 63 USB cable 49 95 ADMS FT DX1200 Programming software for FT DX1200 comes with USB 63 USB cable 49 95 ADMS 450 Programming software for FT 450 comes with USB 63 USB cable 49 95 ADMS 4AU Programming software for FT 817 comes with USB 62B USB cable 49 95 ADMS 4BU Programming software for FT 857 897 with USB 62B USB cable 49 95 ADMS 950 Programming software for FT 950 comes with USB 63 USB cable 49 95 ADMS 7900 Programming software for FT 7900 comes with USB 29B USB cable 49 95 ADMS 270 Programming software for FT 270 comes with USB 57B USB cable 49 95 ADMS FT1D U Programming software only for FT 1DR Cable comes with radio 29 95 ADMS 350 Programming software for FTM 350 comes
293. ce adaptor for use with CT 104A and VX 4204 4207 Programming cable for FIF 10A and VX 4204 4207 Programming software for VX 4204 4207 Mobile transceiver 250ch VHF 37 50MHz Heavy duty noise cancelling microphone with DTMF keypad for VX 5500L Hand microphone for VX 5500L High Power 12W external mobile type speaker for VX 5500L round High power 12W external mobile type speaker for VX 5500L square Mobile mounting bracket for VX 5500L Mobile mounting bracket lockable for VX 5500L DTMF paging and encryption for VX 5500L Rolling code encryption unit for VX 5500L Inversion encryption unit for VX 5500L MDC1200 GE STAR ANI encoder only unit for VX 5500L nterface board for option boards for VX 5500L Radio to radio clone cable for VX 5500L RS 232 DB9 programming cable for VX 5500L needs CT 29 RS 232 DB9 programming cable PC interface for VX 5500L USB interface adaptor for use with CT 104A and VX 5500L Programming cable for VX 5500L Programming software for VX 5500L Base station repeater 16ch 50W VHF 150 174MHz export version non CE Base station repeater 16ch 25W VHF 146 174MHz Base station repeater 16ch 25W UHF 450 480MHz Hand microphone for VXR 7000 Desktop microphone for VXR 7000 RS 232 DB9 programming cable PC in Programming software for VXR 7000 Mains power cable with 2 pin Euro plug for VXR 7000 Mains power cable with 3 pin UK plug for VXR 7000 RS 232 DB9 programming cable for VXR 7000 needs CT 29 t
294. ceivers AVAIR SWRIPOWER METERS AV 20 X needle VSWR POWER meter 1 8 150MHz 0 30 amp 0 300 Watts AV 40 X needle VSWR POWER meter 140 525MHz 0 15 amp 0 150 Watts AV 201 VSWRIPOWER meter 1 8 160MHz 2 20 200 400 1000 Watts AV 400 VSWRIPOWER meter 140 525MHz 5 20 200 400 Watts AV 601 VSWRIPOWER meter 1 8 160MHz amp 140 525MHz 5 20 200 400 1000 Watts AV 1000 VSWRIPOWER meter 1 8 160MHz amp 430 1300MHz 5 20 200 400 Watts BAOFENG UV 5RC 2m 70cm handheld 5W 136 174 amp 400 480MHz Li ion battery and charger 1800mAh UV 3R 2m 70cm handheld 136 174 amp 400 470MHz 119 95 2 595 95 259 95 499 95 199 95 349 95 699 95 119 95 21 95 49 95 11 95 5 95 46 95 46 95 66 95 7 95 699 95 99 95 106 95 94 95 94 95 89 95 79 95 19 95 2 95 6 95 11 95 5 95 45 95 45 95 69 95 69 95 19 95 449 95 319 95 7 95 5 95 29 95 17 95 20 95 12 95 24 95 89 95 106 95 39 95 89 95 99 95 47 95 39 95 19 95 19 95 3 95 2 95 39 95 5 95 19 95 12 95 20 95 279 95 499 95 88 95 1 199 95 599 95 369 95 49 95 49 95 69 95 23 95 189 95 169 95 269 95 79 95 17 95 17 95 54 95 54 95 19 95 7 95 29 95 5 95 1 359 95 999 95 1 959 95 2 849 95 3 449 95 39 95 39 95 39 95 49 95 49 95 69 95 79 95 49 95 49 95 DOP CC E ETC CTT
295. cell battery case 2 x AA for IC E80D BP 217 Spare Li lon battery pack 7 4V 1300mAh for IC E80D FA S270C Spare flexible aerial for IC E80D HM 131 Compact type speaker microphone for IC E80D HM 153 Durable type earphone microphone for IC E80D HM 166 lightweight type earphone microphone for IC E80D HM 189GPS GPS speaker microphone for IC E80D HM 75A Remote control speaker microphone for IC E80D CS 80 Software for IC E80D download free from www icomco jp world supportlindex html OPC 1529R Data connection cable for PC or GPS receiver connection RS 232C type for IC E80D OPC 474 Cloning cable set to set for IC E80D OPC 478 PC cloning cable computor to radio RS 232C type for IC E80D OPC 478UC PC cloning cable computer to radio USB type for ID E80D CP 12L Cigarette lighter cable with noise filter for IC E80D CP 19R Cigarette lighter cable DC DC convertor built in for IC E80D OPC 254L DC power cable with 1 end bare wires L shaped plug with in line fuse for IC E80D HS 85 Headset with VOX PTT TOT for IC E80D LC 163 Soft leatherette carry case for IC E80D MB 86 Swivel type belt clip for IC E80D SP 13 Earphone for IC E80D MB 107 Spare alligator type belt clip for IC E80D AD 92SMA Antenna connector adaptor SMA plug to BNC socket for IC E80D IC E92D Accessories BC 177 Desk top charger complete with BC 06 2 5 hours charge time BP 256 Spare battery pack 7 4V 1620mAh Li ion BP 257 Dry cell case 2 x AA not supplied FA S270C Spare flexible aeri
296. ck for HX 370E 1400mAh 7 2V 19 95 E DC 19A Spare DC cable with cigar lighter plug for HX 370E 9 95 E DC 6 External DC cable for HX 370E 6 95 CN 3 Antenna connector adaptor SMA BNC for HX 370E 8 95 FVP 31 Encrypion unit for HX 370E 36 95 CAT 460 Spare antenna for HX 370E 9 95 CT 32 Cloning cable for HX 370E 48 95 CE 68 Programming software for HX 370E 41 95 CT 111 Programming cable for HX 370E 48 95 HX 370SAS Handheld marine transceiver intriniscly safe version 214 95 CMP 460 Waterproof speaker microphone for HX 370SAS 39 95 CD 26 Charging cradle for HX 370SAS 9 95 NC 88C Spare charger for HX 370SAS 3 pin EU old style 11 95 PA 48U Spare charger for HX 370SAS 3 pin UK new style 11 95 PA 48C Spare charger for HX 370SAS 3 pin EU new style 11 95 CD 47 Desktop charger for FNB 83 amp HX 370SAS 15 95 CLIP 14 Spare belt clip for HX 370SAS 4 95 FNB V571S Nicad pack 7 2V 1 1Amp for HX 370SAS 86 95 E DC 19A Spare DC cable with cigar lighter plug for HX 370SAS 9 95 E DC 6 External DC cable for HX 370SAS 6 95 CN 3 Antenna connector adaptor SMA BNC for HX 370SAS 8 95 FVP 31 Encrypion unit for HX 370SAS 36 95 CAT 460 Spare antenna for HX 370SAS 9 95 CT 32 Cloning cable for HX 370SAS 48 95 CE 68 Programming software for HX 370SAS 41 95 CT 111 Programming cable for HX 370SAS 48 95 HX 400E Handheld marine transceiver 5W Li lon battery and charger 189 95 OOOCOBPROPRPPRPOPRPRPPRPEREEPEPROOCOOOCOBPROPRPRPPRP
297. crophone for HX 290E 35 95 MH 57A4B Speaker microphone for HX 290E 23 95 VC 24 Vox headset for HX 290E 59 95 VC 27 Earpiece microphone for HX 290E 28 95 CLIP 22 Spare belt clip for HX 290E 2 95 CD 52 Charging cradle for HX 290E 15 95 PA 44U Spare charger for HX 290E 3 pin UK 11 95 PA 44C Spare charger for HX 290E 2 pin Euro 11 95 FBA 42 Dry cell case for HX 290E 6 x AA cells 15 95 FNB 110LI Spare NiMH battery pack for HX 290E 1170mAh 7 4V 31 95 E DC 19A DC cable with cigar lighter plug for HX 290E 9 95 E DC 6 External DC cable for HX 290E 6 95 CN 3 Antenna connector adaptor SMA BNC for HX 290E 8 95 CAT 460 Spare antenna for HX 290E 9 95 CE 130E Programming software for HX 290E 41 95 CT 111 Programming cable for HX 290E 48 95 HX 370E Handheld marine transceiver Ni MH pack charger dry cell case cigar lead VHF PMR Channels 139 95 MH 73A4B Waterproof speaker microphone for HX 370E 35 95 MH 57A4B Speaker microphone for HX 370E 23 95 VC 24 Vox headset for HX 370E 59 95 VC 27 Earpiece microphone for HX 370E 28 95 CD 26 Charging cradle for HX 370E 9 95 PA 48U Spare charger for HX 370E 3 pin UK new style 11 95 PA 48C Spare charger for HX 370E 2 pin Euro new style 11 95 NC 88C Spare charger for HX 370E 3 pin UK old style 9 95 CD 47 Desktop charger for HX 370E 15 95 CLIP 14 Spare belt clip for HX 370E 4 95 FBA 25A Spare Dry cell case for HX 370E 6 x AA cells 13 95 FNB 83 Spare NiMH battery pa
298. ct spring Quick disconnect adaptor Multi band adaptor HYGAIN ROTATORS amp ACCESSORIES AR 303X Lightweight rotator for small beam or TV aerial AR 500X Automatic remote antenna rotator AR 40X Lightweight rotator VHF mini HF 5 core lower mast clamps CD 451IX Light med rotator needs 8 core cable Analogue display lower clamps DCU 1X Pathfinder digital control unit to upgrade T2XX or HAM IVX DCU 2X Digital rotator controller for T2XX or HAM IVX DCU 3X Digital programmable rotator controller HAM IVX Medium duty rotator needs 8 core cable with analogue display HAM VX Medium duty rotator 8 core cable with DCU 1 digital display HAM VIX HAM IVX with DCU 2X HAM VIIX HAM IVX with DCU 3X HDR 300AX Heavy duty rotator with digital display RBD 5 Automatic 5 second brake delay for Ham 11 111 4V V T 2XX T 2XDX T 2XX Tailtwister medium heavy duty needs 8 core cable Analogue display T 2XDX Tailtwister medium heavy duty needs 8 core cable with DCU 1 digital displ T 2XD2X T 2XX with DCU 2 T 2XD3X T 2XX with DCU 3 MS HD Optional heavy duty lower mast support kit HAM IV T 2X HAM V MS LD Spare light duty lower mast clamps for AR 40 CD 45ll TSP 1 Lower spacer plate 5042510 Hardware mounting kit for CD 451 and AR 40 YRC 3X Programmable remote control for Yaesu rotator 220v TB 105 Thrust bearing for AR 35 38 303 500 HYGAIN VERTCAL ANTENNAS SPT 500 5 8th wave 10 11 12 meter vertical 5 3dB gain 22
299. d 15W continuous 100W 2 seconds PL 259 type DC 800MHz dummy load 15W continuous 100W 2 seconds N type DC 1GHz dummy load PL 259 30W continuous 100W 90 seconds DC 3GHz dummy load N type 35W continuous 100W 120 seconds DC 1kW 2 way coax switch 2 5KW 3 x N type DC 1000MHz 2 way coax switch 2 5KW 3 x SO 239 PL 259 DC 1GHz 2 way coax switch 2KW 3 x SO 239 PL 259 DC 3GHz 2 way coax switch 2KW 3 x N type DC 800MHz 3 way coax switch 1 5KW 4 x SO 239 PL 259 DC 1 5GHz 3 way coax switch 1 5KW 4 x N type DC 900MHz 4 way coax switch 1 5KW 5 x PL 259 type DC 1 5GHz 4 way coax switch 1 5KW 5 x N type WATSON ANTENNA BASES amp ACCESSORIES AV 35C NMNM AV 22C NNNM AV 32C NMNM Duplexer 1 6 30 amp 49 470MHz N socket to 2 cables PL 259 amp N plugs Duplexer 1 6 150 amp 400 460MHz N socket to 2 cables N plugs Duplexer 1 6 56 amp 140 470MHz N socket to 2 cables PL 259 amp N plugs 21 95 14 95 14 95 14 95 12 95 12 95 199 95 99 95 69 95 49 95 29 95 14 95 9 95 5 95 9 95 5 95 5 95 49 95 49 95 49 95 6 95 6 95 29 95 31 95 31 95 19 95 19 95 9 95 24 95 29 95 9 95 9 95 6 95 8 95 5 95 5 95 34 95 19 95 19 95 9 95 7 95 7 95 4 95 12 95 12 95 59 95 79 95 72 95 59 95 24 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 19 95 19 95 19 95 19 95 19 95 29 95 29 9
300. d knob set 31 95 TT 7 Touch tone decoder 27 95 TG 2C Tone grabber kit decodes transmitted tones with matching case amp knob set 66 95 AA 7C Active antenna kit for HF VHF RF gain control 9V with matching case amp knob set 54 95 SM 100 Magnetic noise reduction antenna includes case and knob set no PSU 84 95 S 70C Speech scrambler kit with case and knob set 48 95 LB 56C Light beam receiver transceiver kit infra red with matching case and knob set 48 95 RF 1 Sniff it RF detector probe traces out weak RF signals 34 95 MM 5C Music machine 28 different pre programmed tunes with matching case amp knob set 29 95 DN 1C Dr Ni Cad conditioner charger discharger with matching case amp knob set 49 95 C 1C Shortwave converter kit with matching case amp knob set 29 95 ECG 1C Electrocardiograph Kit with case and knob set 44 95 PR 2 Broadband RF pre amp ready built 1 1000MHz BNC 50 Ohms c w PSU up to 23dB gain 78 95 RAMSEY ENCLOSURES STE 2200F2 Microwave test enclosure includes RF absorbant foam no connectors Generation 2 729 95 STE 2300 Microwave test enclosure includes RF absorbant foam no connectors 869 95 STE 2900 Microwave test enclosure 1 199 95 STE 2902 2x STE 2900 in a rack shelf 2 199 95 rrrrrrrrrrrrrrrroa LS FEEEFEFANQIQDAANAAAAAAVANAANANNANVVVVVVVVVVVVVVVVTND ERELL E OOO STE 3000B Microwave test enclosure includes RF absorbant foa
301. d transceiver VHF 136 174MHz 1 5W 64ch full keypad c w belt clip 339 95 NX 300S Digital and analogue FM hand held transceiver UHF 400 470MHz 1 5W 64ch full keypad c w belt clip 339 95 KRA 23M UHF short antenna 440 490MHz for NX 200S 300S 9 95 KRA 23M3 UHF short antenna 400 450MHz for NX 200S 300S 9 95 KRA 27M UHF antenna 440 490MHz for NX 200S 300S 9 95 KRA 27M3 UHF antenna 400 450MHz for NX 200S 300S 9 95 KRA 22M VHF short antenna 146 162MHz for NX 200S 300S 9 95 KRA 22M2 VHF short antenna 162 174MHz for NX 200S300S 9 95 KRA 22M3 VHF short antenna 136 150MHz for NX 200S 300S 9 95 KRA 26M VHF antenna 146 162MHz for NX 200S 300S 9 95 KRA 26M2 VHF antenna 162 174MHz for NX 200S 300S 9 95 KRA 26M3 VHF antenna 136 150MHz for NX 200S 300S 9 95 KNB 47L Li ion battery 1950mAh for NX 200S 300S 50 95 KNB 48L Li ion battery 2550mAh for NX 200S 300S 59 95 KSC 32T Rapid charger for NX 200S 300S 38 95 KSC 326T 6 way tri chemistry charger for NX 200S 300S 319 95 KMB 30M Optional wall hanging bracket for NX 200S 300S 15 95 KAS 10 AVLidispatch software for NX 200S 300S 274 95 KBH 11 Belt clip for NX 200S 300S 9 95 KEP 1 Earphone for NX 200S 300S 26 95 KLH 174NC Nylon case for NX 200S NX 300S 17 95 KLH 175PC Heavy duty leather case with metal clip for NX 200S NX 300S 24 95 KLH 176PG Heavy duty leather case with swivel loop for NX 200S NX 300S 27 95 KHS 11BL Palm earphone microphone kit 2 wire for NX 200S 300S 87 95 KHS 12
302. daptor for Yaesu FT 100 and Heil headphones H HAT Heil embroidered hat with adjustable back XLHT White Go To Heil t shirt XL only TEE S Black t shirt with Heil logo Small TEE M Black t shirt with Heil logo Medium TEE L Black t shirt with Heil logo Large TEE XL Black t shirt with Heil logo Extra large TEE XXL Black t shirt with Heil logo Extra extra large HEIL AMATEUR RADIO SPARES BAG 1 Leatherette travel bag for PRO SET series BC Replacement boom clip for the BM series headset BM CORD Replacement cord for the BM 10 BM 5 EP BM BLACK PAIR Replacement ear pads 2 for BM10 BM5 pair black EP BM BLUE PAIR Replacement ear pads 2 for BM10 BM5 pair blue EP BM RED PAIR Replacement ear pads 2 for BM10 BM5 pair red PS FOAM Replacement pair of thin ear pad foams only for the Pro Set EP PM PAIR Replacement ear pad 2 75 circle for Pro Micro and Traveler EP PS Replacement pair of ear pads for the Pro Set EP PSP Replacement pair of ear pad covers for the Pro Set Plus amp Pro set Elite EP TRAV OLD Replacement pair of ear pads for OLD Traveler Oval HC 5 1 HC 5 1 microphone insert retro conversion kit HBA Bluetooth adapter for wireless audio HMC Pack of two 8 pin round microphone plugs really an in line socket HMC 4 Pack of two 4 pin round microphone plugs really an in line socket PM CORD Replacement cord for the PRO MICRO PS CORD Replacement cord for Pro Set PS EPC Replacement pair of ear pad covers for Pro Set PS INNER L Le
303. distick to mast adaptor Counterpoise wire adaptor Buddipole In The Field Book 2 element 6m yagi kit 50 15 24m Mini RG8 PL 259 each end WART ELECTRONIC ACCESSORIES BOSS II OBF Y 500 OFC 817 OFC 817UK PSU OFC 897 OPF I SSB 2300 OPP 897 0QS 817 OTT 817 OTT 897 OTT K YB OTT Auto aerial adjuster for screwdriver aerials 6 160m with Icom interface cable kit One Board Filter Dual Collins Mechanical 2 3KHz SSB amp 500Hz CW for Yaesu FT 817 One Fast Charger for OPP 817 and OPP 817 KIT needs 13 8V DC 1A One Fast Charger UK wall power adaptor for OPP 817 and OPP 817 kit KIT 230V One Fast Charger for OPP 897 without wall adaptor needs OFC 897UK PSU One Plug Filter Collins Mechanical 2 3KHz SSB for Icom IC 718 703 One Plug Power 4500 mAh 13 2V NiMH battery for FT 897 needs Yaesu CD 24 or OFC 897 One Quick Switch enhances operation with LDG Z 11 ATU One Touch Tune for FT 817 One Touch Tune for FT 897 FT 857 amp FT 100 One Touch Tune for Kenwood Yaesu interface cable kit for BOSS II to Yaesu WATSON POWER SUPPLIES DC LEADS DC DC CONVERTERS POWER MITE NF POWER MAX 45 NF POWER MAX 65 NF SEC 1235 SEC 1225G SEC 1212G RACK PLATE SDC 12 SDC 20 JUP 4 W 5A W 10AM SDC 2010 WDC 112 WPC 12 WDC HF6 WDC HF4 ELA1090 661 401 MW1208CS WISP 150 USB WISP 300 WATSON BASE VHF amp UHF ANTENNAS HALO 2 HALO 4 HALO 6 MR 700 HB9CV 2 HB9CV 4 HB9CV 6 HB9CV 70 PBX 4RB WSJ 144 WSJ 430 BM
304. dles BY 3 lambic twin paddle key on a gold base with gold components BY 4 lambic twin paddle key on a black base with gold components ST 1 Single paddle key on a black base with chrome components ST 2 B Single paddle key on a chrome base with chrome components MERCURY PADDLE Mercury paddle key RJ 1 Straight hand key on a black base with chrome components RJ 2 Straight hand key on a chrome base with chrome components EZ 1 Universal hook up kit 4 foot cable plugs and terminals BHI DSP SPEAKERS amp ACCESSORIES FOR ADAPTORS SEE CONNECTORS NES10 2 MK3 NEIM 1031MKII DUAL IN LINE COMPACT INLINE DSPKR DESKTOP DESKTOP FEET NEDSP NEDSP NEDSP NEDSP NEDSP 061 KBD 061 PCB 062 KBD 062 PCB 068 PCBA DSP speaker with rotary selective filtering settings now with bypass switch increased audio output In line DSP noise eliminator use your own speaker Dual in line DSP noise cancelling module Compact batttery operated DSP noise cancelling unit ideal for portable use Audio speaker DSP noise eliminating 10W RMS Audio speaker DSP noise eliminating 10W base station speaker Set of feet for desktop Noise eliminating DSP generic module for fitting inside a rig like FT 817ND Noise eliminating DSP module basic PCB only for commercial use Noise eliminating DSP module for fitting inside almost any loudspeaker Listed Noise eliminating DSP module basic PCB only for commercial use Commercial noise eliminating DSP module AG
305. e T T T T T T K T T 9214 9211 9231 9315K 9317K 9320K 9330K 9340K 9380K 9315W 9317W 9320W 9330W 9340W 9380W 9402 9402X 9406 9406X 9410 9410X 9420 9420X 9440 9440X 9475 9475X 9982 16010 9 102 ee eee 2 ee ES SS Se Se ee 2 ee ee ee MICROHAM MICROKEYER11 MK2R MICRO 2R LINK STEPPIR DB37 IC 8 DB37 IC 13 DB37 IC 599 DB37 IC 718 DB37 IC RS8 DB37 IC 7800 DB37 JST 245 DB37 TS 6 DB37 TS 9 DB37 TS 480 DB37 TS 990S DB37 TS 9M DB37 TS MINI6 DB37 TT OR DB37 TT ORII DB37 TT JPA DB37 TT OM DB37 TT OMV DB37 DB37 F DB37 FT 450 DB37 FT 757 DB37 FT 767 DB3 DB37 FT 847 DB37 FT 890 DB37 FT 900 DB37 FT DB3 DB37 F DB37 FT 9000 DB37 F DB3 DB37 DB37 FX 5000 DB37 EL K23 DB37 ELK3R DB37 EL K3 2M DB37 FT 9000 2M DB37 FT 2000 2M DIGIKEYERII USB INTERFACEIII DB15 IC 8 DB15 IC RS8 DB15 IC 13 DB15 IC 7800 DB15 TS 6 DB15 TS 9 DB15 TS 990 DB15 TS 9M DB15 TS MINI6 DB15 TT OR DB15 TT JPA DB15 TT OM DB15 TT OMV DB15 TT OM7 DB15 FT MINI8 DB15 FT 450 DB15 F DB15 FT 757 DB15 FT 9000 DB15 FT 1000 D DB15 FT 1000MP DB15 EL K2 DB15 EL K3 PS 2 MICROSET 27 200T CF 30 ACC DUALSTEPPIR Cable MK2R QRP pocket POWER meter with dummy load 1 8 150MHz 2 x BNC sockets 5W BNC male QRP pocket 4 1 balun BNC QRP pocket artifici al earth 1 8 30MHz 1 Watt 15m band CW QRP transceiver kit 1 Watt 17m band CW QRP transcei
306. e USB type Waterproof speaker microphone Programming software for IC F51 61 dealers only Service manual on CD for IC F51 61 PMR UHF 400 470MHz BC 145 BC 145 BP 232 MB 94 aerial MPT version PMR UHF 400 470MHz BC 145 BC 145 BP 232 MB 94 aerial keypad MPT version Charger adaptor for BC 119N 121N and BP 230 231 232 Fast charger includes AD 106 amp BC 145 6 way charger including 6 x AD 106 adaptors and BC 124 UK mains PSU for BC 119N fast charger Spare AC adaptor for BC 121 Spare Desktop rapid charger High capacity Li ion battery pack 7 4V 2000mAh UHF antenna for 400 430MHz UHF antenna for 430 470MHz Stubby UHF antenna for 450 490MHz Earphone microphone screw type connector Heavy duty hand held microphone Splash proof full sized speaker microphone durable Earphone microphone Headset ear piece type needs VS 1L Headset neck arm type needs VS 1L Earphone with throat mic needs VS 1L VOXIPTT uni Swivel belt clip Alligator type belt clip Swivel belt hanger for use with MB 93 Fixed type non swing belt hanger Fixed type leather non swing belt hanger for use with N batteries 12V cigarette lighter lead for charging or 12V supply Bare ends DC lead for battery charging or 12 V supply for IC M31 DC cable 12 20V for BC 121N Cloning cable PC to transceiver Cloning cable for radio to PC USB cable Scrambler unit inversion Scrambler unit inversion and rolling Earpiece Programming software for IC F44 GS GT MPT deale
307. e for MFJ 9200 30m band module for MFJ 9200 20m band module for MFJ 9200 17m band module for MFJ 9200 15m band module for MFJ 9200 QRP pocket antenna tuner 80 10m 25W 2 x BNC sockets QRP pocket SWRIPOWER meter 1 8 50MHz 25W 2 x BNC sockets 5 30 100W 2 x BNC sockets 22 95 22 95 19 95 8 95 12 95 13 95 13 95 11 95 8 50 13 95 13 95 13 95 13 95 13 95 13 95 9 50 28 99 13 95 67 95 67 95 67 95 13 95 22 95 22 95 22 95 22 95 22 95 17 95 17 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 20 95 11 95 11 95 12 95 12 95 12 95 16 95 28 95 28 95 28 95 11 95 21 95 13 95 19 95 16 95 24 95 24 95 28 95 28 95 7 50 12 95 14 95 15 95 17 95 28 95 43 95 12 95 14 95 16 95 17 95 19 95 33 95 53 95 14 95 17 95 21 95 26 95 63 95 99 95 40 95 42 95 43 95 48 95 53 95 23 95 48 95 53 95 54 95 59 95 70 95 44 95 14 95 11 95 18 95 5 50 4 50 8 95 7 95 6 50 11 95 8 50 76 95 105 95 135 95 178 95 249 95 229 95 229 95 229 95 229 95 229 95 259 95 29 95 29 95 29 95 29 95 29 95 29 95 49 95 39 95 OOPP T K T T OHO OOO Ke e K K T T K T TO HOO K SS SPP LP PPPS SP PSP PPS PPS PP eee T T PP T T PPPS PP T K K T T K T T T K T T K K T T OH OP K T T K T T T
308. ece type boom microphone needs VS 4LA Headset neck arm type with boom microphone needs VS 4LA Earphone with throat microphone needs VS 4LA PTT switch cable Durable earphone microphone Earphone microphone Spare alligator style belt clip Vehicle charger bracket for use with BC 213 12V cigarette lighter lead for charging or 12V supply DC power supply cable 12 20V for use with BC 214 Cloning cable for radio to PC RS 232C USB type Programming software for IC F1000 2000 series Compact speaker microphone Durable speaker microphone 6 way charger for IC F3002 4002 Spare mains PSU for BC 193 rapid desktop charger for IC F3002 4002 Rapid desktop charger for BP 265 2 5 hours comes with BC 06 for IC F3002 4002 Dry cell case for IC F3002 4002 6 x AA cells not included Spare Li lon battery pack 7 4V 1900mAh 2000mAh for IC F3002 4002 VHF antenna for 150 174MHz for IC F3002 4002 UHF antenna for 430 470MHz for C F3002 4002 80mm Stubby antenna 160 174MHz for IC F3002 4002 60mm Stubby antenna 450 490MHz for IC F3002 4002 Speaker microphone Heavy duty hand held microphone for IC F3002 4002 Splash proof full sized speaker microphone durable for IC F3002 4002 Headset ear piece type needs OPC 2004 for IC F3002 4002 Headset neck arm type needs OPC 2004 for IC F3002 4002 Earphone with throat mic needs OPC 2004 for IC F3002 4002 Plug adaptor cable for HS 94 95 97 when using with IC F3002 4002 Programming software for C
309. ectronic Auto Ranging Wattmeter SWR Bridge with 144 450MHz 1 200W sensor Fully Assembled W2 DCVU200 K Electronic Auto Ranging Wattmeter SWR Bridge with 144 450MHz 1 200W sensor No Solder Kit DCHF 200 Additional Sensor 1 8 54MHz 0 1 200W for W2 meter DCHF 2000 Additional Sensor 1 8 54MHz 1 2000W for W2 meter DCVU 200 Additional Sensor 144 450MHz 1 200W for W2 meter E850368 Spare W2 sensor cable RJ8 6 long XG 3 Portable Calibrated Signal Source 160m to 2m bands 1uV or 50uV level TIA 0 5 20W Automatic ATU for FT 817 and other QRP radios 160 6m T1 FT817 Remote control adapter T1 to FT 817 XV144 2 Meter Transverter 25W Out 0 01mW to 8W 28 30MHz In KRC2 KRC2 Band Decoder For the K3 K2 and Most HF Rigs N GEN Wideband Noise Generator 100 kHz 500 MHz ETON E1100 Portable radio AM FM plus 10 shortwave bands MINI400 Pocket sized AM FM SW radio SATELLIT 750 Shortwave radio AM FM SW with air band G3 GLOBAL Traveler AM FM SSBIRDS radio G8 GLOBAL Traveler II shortwave radio G2 REPORTER AM FM SW portable radio 450 DLX AM FM shortwave deluxe portable radio FRI60MICROLINK AM FM SW solar crank radio FR360MICROLINK AM FM SW solar crank radio FR650 AM FM shortwave solar crank radio with RDS SOULRA i Pod solar mains powered docking station SOULRA XL 8 speaker 20W i Pod i Phone solar powered docking station SCORPION Splash proof solar crank radio phone charger RAPTOR Multi function radio barometer compass and more MOBIUS Rechargab
310. ed BNC plug 2m 70cm 35W 50cm long black metal whip magmount 3m cable fitted PL 259 plug 2m 70cm 35W 50cm long black metal whip magmount 3m cable fitted SMA plug 2m 70cm 35W 50cm long black metal whip magmount 3m cable fitted SMA socket 2m 70cm 70W 50cm long black metal whip magmount 4m cable fitted PL 259 plug 2m 70cm 70W 50cm long black metal whip magmount 4m cable fitted SMA socket 2m 70cm 70W 50cm long black metal whip magmount 4m cable fitted BNC plug 2m 70cm 70W 50cm long black metal whip magmount 4m cable fitted SMA plug DIAMOND MOBILE WHIP ANTENNAS D330 DC 1 D200 DC730HX F80FX F40FXW F30FX ZDTIDTZZOHo Remote control screw driver aerial 3 5 30MHz 200W SSB 1 85m long PL 259 12V 100mA Tuning control for SD330 antenna 159 95 119 95 209 95 289 95 119 95 89 95 44 95 79 95 49 95 64 95 23 95 18 95 17 95 15 95 79 95 69 95 189 95 74 95 84 95 129 95 189 95 159 95 139 95 124 95 64 95 239 95 309 95 299 95 329 95 449 95 369 95 319 95 329 95 56 95 59 95 109 95 94 95 119 95 119 95 439 95 89 95 129 95 149 95 54 95 64 95 66 95 89 95 99 95 149 95 149 95 154 95 249 95 299 95 99 95 129 95 79 95 89 95 68 95 109 95 59 95 29 95 m m m m 52 95 79 95 109 95 39 95 79 95 69 95 47 95 24 95 84 95 09 95 79 95 76 95 56 95 94 95 m m m
311. een any Ultimeter and Kenwood TM D710E Spare PRO rotor assembly Spare anemometer base assembly Pinhole Glasses PORTABLE TELESCOPIC MASTS TFM 20 2 TFM 30 2 TFM 40 2 TFM 50 2 ATMP 17 2 ATMP 26 2 ATMP 33 2 POLES SFGM 150 SFGM 200 WSP 125 WSP 150 WSP 175 POLE BRACKETS W 6 W 9 W 12 W 18 W 24 W 36 DAK AD MKII DAK PL DAK 38 9016 9886 9887 9891 9894 9349 9888 9889 9853 9853 MKII W TS 9890 9892 DL PULLEY 3 AC 04 AC 06 TB1 S TB1 38 TRIPOD HDA 20 telescopic fibre glass mast 4 x 5 sections 2 at base 1 25 at top 30 telescopic fibre glass mast 5 x 6 sections 2 at base 1 25 at top 40 telescopic fibre glass mast 5 x 8 sections 2 25 at base 1 25 at top 50 telescopic fibre glass mast 6 x 8 sections 2 25 at base 1 25 at top 17 5 telescopic aluminium mast 6 x 40 sections 2 at base 1 at top built in guy rings 26 telescopic aluminium mast 6 x 60 sections 2 at base 1 at top built in guy rings 33 telescopic aluminium mast 6 x 80 sections 2 at base 1 at top built in guy rings Strengthened fibre glass pole 2m long 1 5 diameter Strengthened fibre glass pole 2m long 51mm diameter 2 4 swaged poles each 5 x 1 25 4 swaged poles each 5 x 1 5 4 swaged poles each 5 x 1 75 ideal for use with AR 300XL rotators 4 swaged poles each 5 x 2 4 X 1 25 straight aluminium pole 4 6 X 1 5 straight aluminium pole 5 X 1 straight aluminium pole 4 6 X 1 3 4 outside
312. eiver for K3 Transceiver Modular No Solder Kit 599 95 KAT3 F Internal 100W ATU with 2nd Ant Jack for K3 Transceiver Fitted to your radio 369 95 KAT3 K internal 100W ATU with 2nd Ant Jack for K3 Transceiver Modular No Solder Kit 319 95 KPA3A F internal 100W Upgrade for K3 10 Fitted to your radio 599 95 KPA3A K internal 100W Upgrade for K3 10 Modular No Solder Kit 559 95 K144XV F internal 2m 10W Option for K3 Transceiver Fitted to your radio Requires KXV3A 349 95 K144XV K internal 2m 10W Option for K3 Transceiver Modular No Solder Kit Requires KXV3A 299 95 K144RFLK K144XV Reference Lock Board Recommended for best stability on 144MHz 99 95 KSYN3AUPG Low Noise Synthesiser upgrade for K3 and KRX3 229 95 KXV3B Preamp RX Ant IF Out and Xverter Interface for K3 amp K3S Transceiver 209 95 KTCX03 1 High Stability Reference Oscillator 0 5ppm TCXO for K3 Transceiver 119 95 K3EXREF External 10MHz Reference Input for K3 Transceiver 109 95 KDVR3 Digital Voice Recorder for K3 Transceiver 149 95 KBPF3A General Coverage Rx Bandpass Module 100Khz 30Mhz 48 54Mhz for K3 amp K3S Transceiver 199 95 KPCA F Spare Power Cable 5ft long for K3 Transceiver 22 95 MH2 Hand Microphone with microphone clip for the K3 amp K2 Transceiver 64 95 MC 43S Kenwood dynamic hand microphone with up down for K3 20 95 MC 60A Dual impedance desk microphone with internal pre amplifier for K3 127 95 MC 90 Desk microphone for DSP transceivers for K3 204 9
313. end ule for SL USB and 8 pin round Icom ule for SL USB and 8 pin round Kenwood ule for SL USB and 8 pin round Yaesu ule for SL USB and 6 pin mini din data port ule for SL USB and Icom radios with 8 pin din accessory socket ule for SL USB and Yaesu Ten Tec 5 pin din accessory socket ule for SL USB and Icom radios with 13 pin din accessory socket for SL USB and Kenwood radios with 13 pin din accessory socket 9 95 ule for SL USB and Elecraft K3 ule for SL USB and Elecraft KX3 jumper module for SL USB and Yaesu Handhelds SignaLink programming header makes swapping radios much easier Accessory cable kit audio amp PC connection leads Crimping tool with selection of insulated terminals Crimping tool for RG 58 59 62 6 Crimping tool for RJ 45 RJ 11 RJ 12 30W soldering iron with stand cleaning sponge solder amp desoldering pump Screwdriver flat head 25cm long Helping hands with magnifier holds cable and plugs when soldering etc Universal battery tester any 1 5V or 9V including button cells Long nose pliers 6 with sprung jaws Pair of 5 wire cutters Auto tester tha Reel of solder Stand for reel of 2mm 500g solder and soldering iron Desoldering pump sucks off solder tests voltages between 6VDC and 24VDC Antex 18 Watt soldering iron and stand ki 25 piece hexagonal Metric amp Imperial Allen key set Analogue multi Digital multi met meter rugged style 16 ranges AC DC 500V e
314. enerator 700 amp 1900Hz BL2 250W 1 1 amp 4 1 switched Balun CP1 Directional coupler 1 30MHz XG50 Simple 49 380 Signal source kit Designed for use with the KX3 Extended VFO Temp Comp Procedure ELECRAFT OTHER KPA500 F 160 6m Solid State Auto Band Switching Linear Amplifier Fully Assembled KPA500 K 160 6m Solid State Auto Band Switching Linear Amplifier Modular No solder Kit E740244 The Elecraft KPA500 KAT500 by Fred Cady KPAK3AUX KPA500 to K3 Aux Cable for Band Switching and Control KAT500 F High power ATU matches 10 1 at 500 600W Fully Assembled KAT500 K High power ATU matches 10 1 at 500 600W No Solder Kit 850463 KAT500 to KPA500 band data cable P3 F Panoramic Adaptor for K3 Transceiver needs KXV3A fitted to K3 Fully Assembled P3 K Panoramic Adaptor for K3 Transceiver needs KXV3A fitted to K3 Modular No Solder Kit P3SVGA Large Screen Adaptor for P3 Allows Widescreen O P Upto 1920x1080p on External Screen P3TXMON SSB CW TX signal monitor adaptor with true PEP reading for K3 amp K3S includes coupler W2 DCHF200 F Electronic Auto Ranging Wattmeter SWR Bridge with 1 8 54MHz 0 1 200W sensor Fully Assembled W2 DCHF200 K Electronic Auto Ranging Wattmeter SWR Bridge with 1 8 54MHz 0 1 200W sensor No Solder Kit W2 DCHF2000 F Electronic Auto Ranging Wattmeter SWR Bridge with 1 8 54MHz 1 2000W sensor Fully Assembled W2 DCHF2000 K Electronic Auto Ranging Wattmeter SWR Bridge with 1 8 54MHz 1 2000W sensor No Solder Kit W2 DCVU200 F El
315. ength 8 9 995 95 XR6 6 10 12 15 17 20m 6 band beam antenna 11 element 6kW 6 7 5dB gain 3 6m boom elemeny length 8 9 1 095 95 GAP ANTENNAS TITAN DX 8 band vertical HFantenna 80 40 30 20 17 15 12 10m 2KW PEP SSB 7 6m high 399 95 CHALLENGER DX 8 band vertical HF VHF antenna 80 40 20 15 12 10 6 2m 2KW PEP SSB 9 6m high 329 95 EAGLE DX 6 band vertical HF antenna 40 20 17 15 12 10m 2KW PEP SSB 6 4m high 369 95 VOYAGER DX 4 band vertical HF antenna 160 80 40 20m 2KW PEP SSB 13 72m high 419 95 CHALLENGER CP Challenger counterpoise 41 95 VOYAGER CP Voyager counterpoise 74 95 QTGM Quick tilt ground mount 84 95 QTLM Quick tilt ladder mount 74 95 Gk 200 Guy kit 200 feet long 24 95 Gk 100 Guy kit 100 feet long 17 95 SPOOL 100 Spool 3 32 UV black guy rope 100 feet long 10 95 SPOOL 350 Spool 3 16 UV black guy rope 350 feet long 38 95 T 3 6 BEIGE Capacitor for TITAN 3 6MHz centre frequency minimum 100KHz bandwidth 13 95 T 3 7 RED Capacitor for TITAN 3 7MHz centre frequency minimum 100KHz bandwidth 13 95 T 3 8 BLUE Capacitor for TITAN 3 8MHz centre frequency minimum 100KHz bandwidth 13 95 T 3 9 GREEN Capacitor for TITAN 3 9MHz centre frequency minimum 100KHz bandwidth 13 95 T 4 0 BROWN Capacitor for TITAN 4 0MHz centre frequency minimum 100KHz bandwidth 13 95 C 3 5 BLACK Capacitor for CHALLENGER 3 5MHz centre frequency minimum 130KHz bandwidth 13 95 C 3 6 BEIGE Capacitor for CHALLENGER 3 6MHz centre frequency minimum 130KHz bandw
316. ent for parallel stacking 2 x 2m antennas Support boom element for parallel stacking 2 x 70cm antennas Side support boom element offset bracket for single antenna for 2m 144MHz Side support boom element offset bracket for single antenna for 70cm 430MHz Stack transformer power divider for 2 x 2m antennas Stack transformer power divider for 2 x 70cm antennas HF wide band wire antenna 2 30MHz with ATU 6 4m long 250W PEP SO 239 HF dipole for 40m amp 15m 7 21MHz 1 2KW PEP 12 4m long weight 1 2kg HF dipole for 40m amp 80m 3 5 7MHz 1 2KW PEP 26m long weight 1 85kg HF dipole for 80m 40m 20m 15m10m 1 2kW PEP 19 2m long weight 2 5kg T2FD type broadband HF dipole 150W 2 30MHz 25m long PL 259 30m coax T2FD type broadband HF dipole 150W 2 28 6MHz 10m long PL 259 with 2 x 10m reels of plastic rope T2FD type broadband HF dipole 150W 2 30MHz 25m long 7MHz 10MHz portable dipole 3 5m telescoping 120W 21MHz 28MHz coils for DP 7RH pair Dipole aerial 7 14 21 28 6m HF wideband ground plane ant 2 30MHz 250W max 6 7m long No radials PL259 40 amp 80m vertical 500W SSB 7MHz 250W SSB 3 5MHz 6 14m long 6 10 15 20 40 80m vertical 200 Watts SSB rigid radials height 4 6m 1 8m radial length 80 40 20 15 10 6 2m 70cm vertical 200W SSB HF 150W FM 6 2 70 2 7m long 80 amp 40m vertical 6 53m high radial length 1 8m 200 Watts 10 15 20 40 80m vertical 500 Watts SSB 250 Watts 80m vertical 5 8m high no radials 28 29 50MHz 500W 14 21MHz
317. er for VX 3E 3 pin UK new style PA 46C Spare charger for VX 3E 2 pin EU new style YHA 66 Spare aerial for VX 3E FT 252E ACCESSORIES FNB 124LI Spare 1030mAh 7 4V battery pack PA 46U Spare battery charger 3 pin UK PA 46C Spare battery charger 2 pin EU CD 57 Charger cradle for FT 252E SDD 11 DC cable with cigarette lighter adaptor for FT 252E E DC 6 External DC cable for FT 252E CN 3 Antenna connector adaptor SMA BNC for FT 252E FT 270E 2m handheld transceiver with 16 key keypad Ni MH battery and charger CN 3 Antenna connector adaptor SMA to BNC for FT 270E FNB 83 Spare NiMH battery pack 1400mAh for FT 270E YHA 68 Spare aerial for FT 270E NC 88C Spare charger for FT 270E 2 pin EU old style PA 48U Spare charger for FT 270E 3 pin UK new style PA 48C Spare charger for FT 270E 2 pin EU new style VAC 370U Desktop rapid charger for FT 270E comes with PA 23U 3 pin UK VAC 370C Desktop rapid charger for FT 270E comes with PA 23C 2 pin EU PA 23U Spare power supply for VAC 370U 3 pin UK PA 23C Spare power supply for VAC 370U 2 pin EU CD 47 Desktop rapid charger with hod to hold the complete radio needs PA 43 PA 43U PSU for CD 47 and FT 270E 3 pin UK PA 43C PSU for CD 47 and FT 270E 2 pin Euro CD 26 Desktop over night charger with hod to hold the complete radio use the charger supplied with the radio FBA 25A Dry cell case 6 x AA cells for FT 270E SDD 13 Cigar lighter DC cable for FT 270E E DC 6 External DC cable for FT 27
318. er supply for VAC 370C 2 pin EU Q300 136A Spare aerial for FT 60E YHA 58 VX 7R BK 6m 2m 70cm triband transceiver submersible BLACK VX 7R SL 6m 2m 70cm triband transceiver submersible SILVER CD 15A Desk top rapid charger for VX 7R needs PA 48 2 5 hours was CD 15 CN 3 Antenna connector adaptor SMA BNC for VX 7R CSC 88 Soft case for VX 7R CT 91 Microphone adaptor for VX 7R SDD 13 Cigar lighter DC cable for VX 7R E DC 6 External DC cable for VX 7R FBA 23 2x AA dry cell case for VX 7R FNB 80LI Spare 7 4V 1300mAh lithium ion battery pack for VX 7R MH 57A4B Speaker microphone for VX 7R VC 27 Earpiece microphone for VX 7R MH 73A4B Waterproof speaker microphone for VX 7R PA 48U Spare charger for VX 7R 3 pin UK new style PA 48C Spare charger for VX 7R 2 pin Euro new style SU 1 Barometric Pressure Sensor Unit for VX 7R YHA 64 Spare aerial for VX 7R Q 3000183 CLIP 14 Spare belt clip for VX 7R VX 3E 2m 70cm miniature handheld transceiver with Li ion battery charger CN 3 Antenna connector adaptor SMA BNC for VX 3E CT 27 Cloning cable for VX 3E CT 44 Microphone adaptor for VX 3E CSC 92 Soft case for VX 3E belt loop on soft case as rig does not have a belt clip FBA 37 Dry cell case for VX 3E FNB 82L1 Spare 1000mAh Lithium lon battery for VX 3E E DC 21 DC adaptor with cigar lighter plug 12 24V for VX 3E MH 34B4B Speaker microphone for VX 3E MH 37A4B Earpiece microphone for VX 3E VC 25 VOX headset for VX 3E PA 46U Spare charg
319. er waterproof for FTM 10 25 95 CT M10 6m front panel seperation kit for FTM 10 21 95 YHA M10 FTM 10 mobile antenna 31 95 AMK 1 Antenna mount for YHA M10 held on by motorcycle licence plate needs COX 2MM 12 95 COX 2MM Cable kit for YHA M10 and AMK 1 27 95 79022815 Spare DC lead for FTM 10 14 95 79207380 Replacement microphone cable with fitted microphone plug for FTM 10 14 95 FT 8900R 10m 6m 2m 70cm mobile transceiver detatchable head Listed 384 95 269 95 SMB 201 Desktop cooling fan includes SAD 11C 34 95 MH 42B6JS Microphone for FT 8900 39 95 MH 48A6JA Spare Hand microphone with DTMF for FT 8900 34 95 MLS 100 High Power external speaker for FT 8900 29 95 SAD 11U C 220 240VAC PSU for SMB 201 9 95 YSK 8900 Separation lead kit for FT 8900 32 95 MMB 60 Quick release mobile bracket for FT 8900 16 95 CT 39A Packet interface cable for FT 8900 14 95 MEK 2 Microphone lead extension kit for FT 8900 29 95 CT 69 Microphone adaptor 8 pin round socket to 6 pin modular plug for FT 8900 21 95 79022815 Spare DC lead for FT 8900 14 95 791015344 Spare very short cable between Head and body of FT 8900 8800 7900 1 95 FT 8800E 2m 70cm 50 35W mobile transceiver Listed 334 35 249 95 SMB 201 Desktop cooling fan includes SAD 11C 34 95 MH 42B6JS Microphone for FT 8800 39 95 MH 48A6JA Spare Hand microphone with DTMF for FT 9800 34 95 MLS 100 High Power external speaker for FT 8800 29 95 SAD 11U C 220 240VAC PSU for SMB
320. er with GPS option 1 059 95 YA FSK CBL Yaesu data port audio cable 6 feet long fixed level receive audio and FSK using 4 pin data port 18 95 A WR G33WSM Wireless spectrum monitor 879 95 KN13 FSK CBL Kenwood data port audio cable 6 feet long fixed level receive audio and FSK using 13 pin data port 18 95 A WR G303 PDO Advanced professional demodulator option for WR G303 receivers 299 95 478 KIT Conversion kit from M8 or Plus to 4 pin mic radio 20 95 A WR G305 PDO Advanced professional demodulator option for WR G305 receivers 299 95 DC SUP 230UK Mains power supply for RiGblaster 240V 13 95 A WR G3151 Internal PCI card professional receiver 9KHz 1800MHz extendable to 3500MHz 2 199 95 RT1 RiGtalk USB rig control interface needs cable 49 95 C WR G315E External PCI card professional receiver 9KHz 1800MHz extendable to 3500MHz 2 395 95 RT1 CIV RIGtalk for Cl V Icom and Ten Tec radios 54 95 C WR EM GPS GPS and mapping option for WR G33EM receivers 199 95 RT1 CAT RiGtalk for Yaesu FT 100 100D 817 857 897 59 95 C WR DBM2 WorldStation Database Manager option version 2 for all Win Radio receivers 93 95 RT1 CAT6 RIGtalk for Yaesu FT 736 747 767 990 1000 59 95 C WR G305 APCO APCO P25 decoder for WR G305 receivers 84 95 RT1 DB9 USB to RS232 male female adaptor 33 95 C WR G315 APCO APCO P25 decoder for WR G315 receivers 169 95 RB CD CD ROM of sound card software collection 7 95 A WR DS Digital suite digital signal processing DSP soundcard
321. erface for VXR 7000 4U high 19 wide rack mounting kit for VXR 7000 3U high 19 wide rack mounting kit for VXR 7000 Base station repeater 32ch 50W VHF Base station repeater 32ch 25W VHF 48 174MHz export version non CE 46 174MHz Base station repeater 32ch 25W UHF 440 470MHz Hand microphone for VX 4204 4207 Desktop microphone for VX 4204 4207 Single internally mounted 230V battery management with 2 pin EU plug Mains power cable with 3 pin UK plug for VXR 9000 RS 232 DB9 programming cable for VXR 7000 needs CT 29 RS 232 DB9 programming cable PC interface for VXR 7000 USB interface adaptor for use with CT 104A and VX 5500 Programming cable for FIF 10A and VX 2100 2200 Programming software for VXR 9000 DTMF paging and encryption for VX 5500 Rolling code encryption unit for VX 5500 600 Ohm 4 wire line interface E M Handheld airband transceiver Handheld airband transceiver Handheld airband transceiver Spare aerial for VXA 300 Antenna connector adaptor SMA BNC for VXA 300 Cigar lighter DC cable for VXA 300 External DC cable for VXA 300 Dry cell case for VXA 300 6 x AA cells Spare NiMH battery pack for VXA 300 1400mAh 7 2V Speaker microphone for VXA 300 Spare charger for VXA 300 2 pin EU old style Spare charger for VXA 300 3 pin UK new style Spare charger for VXA 300 2 pin Euro new style Rapid charger for VXA 300 with PA 23U 3 pin UK plug Rapid charger for VXA 300 with PA 23C 2 pin EU plug Spare power supply f
322. erface unit for FT DX5000 SCU 21 Connecting cable SM 5000 Y Station monitor for FT DX5000MP LTD DMU 2000 Data management unit for FT DX5000 needs monitor with VGA plug Listed XF 126CN CW narrow filter 9MHz 300Hz for FT DX5000 FH 2 Y Remote keypad for FT DX5000 FT DX3000D HF amp 6m 100w DSP amp ATU MD 200A8X Desk microphone for FT DX3000D MD 100A8X Desk microphone for FT DX3000D MH 31B8 Spare hand mic for FT DX3000D SP 2000 Y External speaker for FT DX3000D YH 77STA Open air type stereo headphones for FT DX3000D MTU 160 RF tuning unit A 160m band unit for FT DX3000D MTU 80 40 RF tuning unit B 80 40m band unit for FT DX3000D MTU 30 20 RF tuning unit C 30 20m band unit for FT DX3000D RF UTUNEKIT Base platform for MTU 160 80 40 30 20 SCU 17 USB interface unit for FT DX3000D XF 127CN CW narrow crystal filter for FT DX3000D center frequency 9MHz bandwidth 300Hz DVS 6 Voice memory unit for FT DX3000D 79101556 Control cable between FT DX3000D and G 1000DXC CT 178 Quadra connection cable for DT DX3000D FC 40 External automatic ATU with 200 memories for end fed wire or long whip and FT DX3000D FH 2 Y Remote keypad for FT DX3000D FT DX1200 HF amp 6m 100w DSP amp ATU MD 200A8X Desk microphone for FT DX1200 MD 100A8X Desk microphone for FT DX1200 MH 31B8 Spare hand mic for FT DX1200 SP 2000 Y External speaker for FT DX1200 YH 77STA Open air type stereo headphones for FT DX1200 79101556 Control cable between FT DX1
323. ess than 1 3 1 at 5S00MHz DL 650MN Dummy load DC 650MHz1500W 50 Ohm less than 1 3 1 at 500MHz N DL 2500 Dummy load DC 150MHz 2500W 50 Ohm less than 1 3 1 at 150MHz DL 2500N Dummy load DC 150MHz 2500W 50 Ohm less than 1 3 1 at 150MHz N VEC 554 Wet dummy load 1500 Watts 0 400MHz with oil VEC 554X Wet dummy load 1500 Watts 0 400MHz without oil VEC 512 Tuner tuning aid 1 8 60MHz VEC 514 Tuner extender for auto tuner VECTRONICS FILTERS HPF 1 High pass TVI filter HPF 2 Deluxe high pass TVI filter LP 30 Low pass filter 50 Ohm for stations up to 1500W SO 239 LP 2500 Low pass filter 50 Ohm for stations up to 2500W SO 239 VEC 862 50 Ohm 81dB in 1dB step VEC 813 2 meter intermod filter BNC VEC 814 2 meter intermod filter SO 239 VEC 884 Super tunable DSP filter VECTRONICS WATTMETERS PM 30 Cross needle SWR power meter 1 8 60MHz 300 3000W SO 239 PM 30UV Cross needle SWR power meter 2m 70cm 300 3000W SO 239 PM 30UVN Cross needle SWR power meter 2m 70cm 300 3000W N type VECTRONICS CW PRODUCTS CK 200 Deluxe lambic keyer speed weight tone volume controls KP 200 lambic key paddle cable chrome KP 200B lambic key paddle cable black PMT 228 Morse code tutor LCD display VEC 202 Slim line Curtis 8045ABM keyer VEC 204 Curtis 8045ABM paddle combo VEC 212 Code practice oscillator with telegraph key VEC 254 Classroom code oscillator VECTRONICS SWR ANALYSRES SWR 584B HF VHF SWR analyser SWR 29C Analyser pouch SWR 66C Dip meter coil set VECTRO
324. f 17m traps 1000W CW SSB 500W FM AM resonance 3 tolerance 72 95 R 1000 14 1 Pair of 20m traps 1000W CW SSB 500W FM AM resonance 3 tolerance 72 95 R 1000 10 1 Pair of 30m traps 1000W CW SSB 500W FM AM resonance 3 tolerance 76 95 TR 1000 7 Pair of 40m traps 1000W CW SSB 500W FM AM resonance 3 tolerance 79 95 TR 1000 3 6 Pair of 80m traps 1000W CW SSB 500W FM AM resonance 3 tolerance 89 95 OOO OOO KOKO K OOO GOGOGOGOGOGO K KO K K GO TK T T T K T T T K T T K T T O 333 GG GG TOO EI Qa OOD ARMAAAAAAAAAAAAAATVVGVGAAAD HEIL STUDIO BROADCAST ON STAGE MICROPHONES R 20 R 20UT R 20SUT R 20G R 22 R 22UT R 22SUT R 22G R 22P R 28 R 30 R 30B R 31BW R 35 R 35S R 40 R 40G R 40C R 40BG R 48 C 22 C 35 DK 8 DK 7 HG N B N B B N RED N WHITE N BK RD N BK BU N BK WT M PRO PLUS RO SET 3 gt NZ EEE EEE EEE EE EEE EE EEE EE L 2 L 2T RC PR 30 RC PR 40 780 RS 1 SB 2 SM 1 SM 3 SM 5 PRSM B PRSM C TM 1 WM 1 CC 1 XLR 3 XLR 3F XLR 3M USBQ HB 1 CB 1PTT C CLAMP SM 1 BAND SM 2 BAND WSM WSPR 40 WSHM GRILL 35 B GRILL 35 S GRILL 35 G GRILL 22 B HM CLIP HW 10 HW 20 HW 50 PRO BK PGCS BK 9 Professional dynamic cardoid mic PR 20 utility version no switch 3 pin XLR needs CC 1XLR Professional dynamic cardoid mic PR 20 utility version with switch 3 pin XLR needs CC 1XLR Professional dynamic cardoid microphone 600 Ohms balanced 3 pi
325. for Alinco Yaesu lcom handhelds 32 95 C C30 PK 12 12 spare connector pairs for RIGrunner 30 Amp 12 95 X 17K Throat microphone amp earpiece with PTT for Kenwood handhelds 32 95 C C45 PK 12 12 spare connector pairs for RIGrunner 45 Amp 16 95 X 17M Throat microphone amp earpiece with for Motorola handhelds 32 95 C BT CBL 6 6 feet powerpole battery fuse cable 16 95 MPA2 Medusa power analyser with powerpoles reads watts volts amps and ampere hours 66 95 WEST MOUNTAIN RADIO MPA PRO Medusa power analyser pro basic with powerpoles standalone or USB AUX temp amp RPM 101 95 RIGBLASTER BLUE RIGblaster with Bluetooth technology for digital modes 179 95 C A CLB Lead 3 5mm stereo jack plug to 3 5mm stereo jack plug 6 long 3 95 CLRSPKR Clearspeech amplified mobile DSP noise reduction amplified speaker 209 95 C PP EC 3 Power pole extension cable 3 feet long 11 95 CLRDSP Clearspeech DSP noise reduction processor 199 95 C PP EC 6 Power pole extension cable 6 feet long 12 95 COMSPKR Computer pair of speakers immune to RF interferance so ideal for your ham station computer 39 95 C PP EC 10 Power pole extension cable 10 feet long 14 95 DC SUP DSP 230UK Mains power supply for RIGblaster 240V CLRspkr amp CLRdsp 12 95 A PP 25 J Power pole to 5 5 x 2 5mm jack 9 95 RB DU CUSB RiGblaster Duo data mode soundcard interface rig control and more12v DC USB 289 95 C PP 25 P Power pole to 5 5 x 2 5mm plug 9 95 RB PR CUSBDC RiGblaster PRO data mode so
326. for VOX hands free operation Antenna VHF 150 174MHz Cloning software for IC M90 Servive manual on CD ROM for IC M90 Marine hand held Charger adaptor for BC 119N amp BC 121N Spare UK mains charger for use with BC 152 Fast charger includes AD 100 amp BC 145 6 way charger including 6 x AD 100 adaptors and BC 124 UK mains PSU for BC 119N fast charger Desktop charger for IC M87 Spare AC adaptor for BC 121 12V cigarette lighter lead for charging or 12V supply for IC M87 Dry cell case for IC M87 5 x AA cells Spare Li lon battery 7 2V 1700mAh for IC M87 Waterproof speaker microphone 94 95 29 95 5 95 18 95 53 95 25 95 6 95 18 95 94 95 35 95 18 95 125 95 27 95 11 95 11 95 46 95 28 95 46 95 10 95 8 95 36 95 75 95 75 95 234 95 18 95 14 95 52 95 211 95 14 95 14 95 31 95 94 95 41 95 41 95 5 95 18 95 25 95 78 95 29 95 18 95 18 95 18 95 94 95 82 95 18 95 125 95 27 95 42 95 11 95 11 95 10 95 104 95 104 95 75 95 75 95 469 95 125 95 18 95 92 95 11 95 11 95 18 95 14 95 66 95 389 95 14 95 31 95 94 95 18 95 25 95 76 95 82 95 18 95 18 95 10 95 104 95 104 95 82 95 69 00 239 95 12 95 56 95 339 95 14 95 19 95 79 95 13 95 29 95 18 95
327. ft inner support for Pro Set PS INNER R Right inner support for Pro Set PS OUTER L Left outer support for Pro Set PS OUTER R Right outer support for Pro Set PM INNER Inner part for PRO MICRO PM OUTER Outter part for PRO MICRO PSM CORD Replacement cord for Pro Set Media PSP CORD Replacement cord for Pro Set Plus PTT Replacement square PTT button WSPS Replacement windscreen for Pro Set WSPSP Replacement windscreen for Pro Set Plus WS TRAV Replacement windscreen for Traveler XLR 3F 3 pin in line XLR socket female XLR 4F 4 pin in line XLR socket female XLR 3M 3 pin in line XLR plug male XLR 4M 4 pin in line XLR plug male XT 1 Transformer high to low imedance matching PSE CORD Replacement curly cord for Pro Set Elite PHASE REV Proset and Proset Plus phase reversal switch PSSP Replacement speaker for Pro Set PSBC Spare boom cup for Pro Set amp Traveler HI MOUND HK 705 Straight Morse key good quality beginners key HK 708 Straight Morse key HK 709 Straight Morse key HK 808 Straight Morse key MK 701 Twin paddle Morse key MK 706 Twin paddle Morse key TC 701 Straight Morse key with built in oscillator 37 95 99 95 99 95 29 95 29 95 19 95 19 95 19 95 19 95 19 95 19 95 19 95 19 95 19 95 19 95 19 95 19 95 19 95 28 95 27 95 27 95 27 95 27 95 27 95 27 95 27 95 29 95 29 95 29 95 29 95 29 95 29 95 29 95 29 95 29 95 39 95 35 95
328. g MKII iLINK port and SteppIR native control DATA OUT port LINK ULTRABEAM Cable connecting MK2R ACC port and two ultrabeam s control RS 232 ACC port amp two SteppIR s controllers using native control DATA OUT port ACC DUALULTRABEAM Cable MK2R ACC port amp two Ultrabeam controllers using native RS 232 le set for Icom IC 706 IC 703 IC 7000 le set for Icom rigs with 8 pin din ACC1 connector IC 7400 IC 756 etc bl bl bl bl bl bl bl ble set for old Kenwood with 6 pin din ACC1 connector some need IF 10 ble set for Kenwood TS 570 TS 870 TS 2000 bl bl bl bl bl bl e set for Yaesu FT 817 FT 857 FT 897 e set for Yaesu FT 2000 FT DX5000 le set for Elecraft K3 2m long le set for Yaesu FT 9000 2m long ble set for Yaesu FT 2000 2m long face digatal modes rig control stereo sound chip ound card software and rig control le set for old Kenwood with 6 pin din ACC1 connector some need IF 10 le set for Kenwood TS 570 TS 870 TS 2000 29 95 19 95 59 95 02 95 02 95 02 95 02 95 02 95 02 95 52 95 52 95 52 95 52 95 52 95 152 95 294 95 304 95 264 95 274 95 274 95 284 95 254 95 264 95 254 95 264 95 254 95 264 95 684 95 64 95 4 99 MD MMD MD MD M MMD mrm mh 299 95 679 95 309 95 39 95 39 95 51 95 51 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95 73 95
329. g interface cable serial for TK 2000 3000T Programming interface cable USB for TK 2000 3000T Serial to USB adapter with drivers for TK 2000 3000T VHF handy 136 174MHz 12 5 20 25KHz 1 5W 16 CH with aerial battery charger belt clip F handy 440 470MHz 12 5 25KHz 1 4W 16 CH with aerial battery charger belt clip VHF short antenna 146 162MHz for TK 2202 3202 2302 3302 VHF short antenna 162 174MHz for TK 2202 3202 2302 3302 VHF short antenna 136 150MHz for TK 2202 3202 2302 3302 UHF short antenna 440 490MHz for TK 2202 3202 2302 3302 UHF short antenna 400 450MHz for TK 2202 3202 2302 3302 VHF antenna 146 162MHz for TK 2202 3202 2302 3302 VHF antenna 162 174MHz for TK 2202 3202 2302 3302 VHF antenna 136 150MHz for TK 2202 3202 2302 3302 UHF antenna 440 490MHz for TK 2202 3202 2302 3302 UHF antenna 400 450MHz for TK 2202 3202 2302 3302 Ni MH battery 1500mAh for TK 2202 3202 2302 3302 Li ion battery 2000mAh for TK 2202 3202 2302 3302 Rapid charger for KNB 29N Rapid charger for KNB 45L 6 way charger for KNB 29N 6 way charger for KNB 45L Optional wall hanging bracket for KSC 316 356 Leather case for TK 2202 3202 2302 3302 Nylon case for TK 2202 3202 2302 3302 Water resistant bag for TK 2202 3202 2302 3302 Clip microphone with D type earpiece was EMC 6 for TK 2202 3202 2302 3302 Clip microphone with D type earpiece for TK 2202 3202 2302 3302 Spare belt clip for TK 2202 3202 2302 3302 Acoustic tube ea
330. ghtweig Electret lightweight dual sided Pro Micro double side headset with HC 6 insert needs AD 1 Pro Micro double side headset with IC insert with AD 1 IC8 Pro Micro single side headset with HC 6 insert needs AD 1 Pro Micro single side headset with IC insert with AD 1 IC Hi Comfort double side headset with HC 7 dynamic element microphone package with Red LB 1 Lit Base with PTT needs CC 1XLR microphone package with Black LB 1 Lit Base with PTT needs CC 1XLR for 2 pin Kenwood amp Baofeng transceivers for 4 pole single plug Yaesu Vertex dual sided headset needs AD 1 eadset for Icom complete with AD 1 IC el filled headband and earmuffs BLACK G Hi Comfort double side headset with HC 7 dynamic element Gel filed headband and earmuffs BLUE G Hi Comfort double side headset with HC 7 dynamic element el filled headband and earmuffs PINK Hi Comfort double side headset with HC 7 dynamic element Gel filled headband and earmuffs RED Hi Comfort dble side headset Electret element for ICOM Gel filed hband amp earmuffs with AD 1 IC BLK Hi Comfort dble side headset Electret element for ICOM Gel fi Hi Comfort dble side headset Electret element for ICOM Gel Filled h dband amp earmuffs Hi Comfort dble side headset Electret element Gel Filled headband amp earmuffs with AD 1 IC RED Dual sided professional headphones 10Hz to 22KHz 32 Ohms Large dual headphones boom microphone
331. gi 1 79m long 5kW 11 16dBi gain 135 95 12 element 2 x 6 144MHz cross polarised MAP65 yagi 2 41m long 5kW 11 88dBi gain 159 95 16 element 2 x 8 144MHz cross polarised MAP65 yagi 3 73m long 3kW 13 32dBi gain 249 95 18 element 2 x 9 144MHz cross polarised MAP65 yagi 4 40m long 3kW 14 06dBi gain 294 95 10 element 144MHz LFA2 yagi 5 38m long 5kW 14 52081 gain 259 95 11 element 144MHz LFA2 yagi 6 26m long 5kW 15 23081 gain 279 95 12 element 144MHz LFA2 yagi 7 14m long 5kW 15 62dBi gain 305 95 13 element 144MHz LFA2 yagi 8 18m long 5kW 16 11dBi gain 329 95 14 element 144MHz LFA2 yagi 9 2m long 5kW 16 58dBi gain 339 95 15 element 144MHz LFA2 yagi 10 07m long 5kW 16 93dBi gain 389 95 16 element 144MHz LFA2 yagi 11 14m long 5kW 17 26dBi gain 409 95 17 element 144MHz LFA2 yagi 12 09m long 5kW 17 53dBi gain 455 95 18 element 144MHz LFA2 yagi 13 07m long 5kW 17 86dBi gain 479 95 19 element 144MHz LFA2 yagi 14 12m long 5kW 18 08dBi gain 539 95 20 element 144MHz LFA2 yagi 14 96m long 5kW 18 35dBi gain 555 95 21 element 144MHz LFA2 yagi 16 06m long 5kW 18 47dBi gain 585 95 22 element 144MHz LFA2 yagi 17 00m long 5kW 18 55dBi gain 605 95 10 10 element 222MHz LFA yagi 3 43m long 4kW 14 48dBi gain 209 95 11 11 element 222MHz LFA yagi 4 01m long 4kW 14 92dBi gain 219 95 12 12 element 222MHz LFA yagi 4 69m long 4kW 15 31dBi gain 239 95 14 14 element 222MHz LFA yagi 5 79m long 4kW 16 63dBi gain 259 95 15
332. h battery pack for DJ 175E Li lon 7 AC quich AV 12000 mAh battery pack for DJ 175E k charger for Li lon DJ 193 195 496 493 Spare charger for DJ 175E will charge Li ion Spare charger for DJ 175E not Li ion Spare Spare Spare Dry cell NiMH pack 9 6V 700mAh NiMH pack 9 6V 1500mAh belt clip for DJ 446 193 195 493 496 596 aerial for DJ 596EMKII aerial for DJ 446 case for DJ 193 195 496 493 LION battery pack for DJ 193 range Mobile DC power cable i 12V DC 12V DC Multi voltage rapid charg Spare Spare AC quich ter amp cigar lighter plug for DJ 193 195 496 493 596 cable bare ends for DJ 193 195 496 493 596 cable with filter for DJ 193 195 496 493 596 r for DU 193 195 496 493 596 AC wall charger for DJ 193 195 496 493 596 3 pin UK plug AC wall charger for DJ 193 195 496 493 596 2 pin Euro plug k charger for DJ 193 195 496 493 2 Speaker microphone for DJ range Earphone microphone wil h PTT VOX for DJ 193 195 496 493 596 Headset single headphone VOX PTT for DJ 193 195 496 493 596 Headset inner ear type for DJ 193 195 496 493 596 Tie pin microphone for DJ 193 195 496 493 596 Leatherette case for DJ 193 195 496 493 596 Programing cable for DJ 193 195 496 493 596 Programing cable for DJ C7E C6 Aerial adaptor SMA to BNC for DJ C7E C6 Spare Spare mains battery charger for DJ C6E C7E LION battery pack 3 7V 600mAh for DJ C7E C6 Q Speaker microphone for DJ C7E C6
333. hanging bracket for KSC 326 for TK 2180 3180 GPS microphone for TK 2180 3180 Nylon case with metal clip for TK 2180 3180 Soft leather case for TK 2180 3180 Hard leather case for TK 2180 3180 Belt clip for TK 2180 3180 Vibrator unit for TK 2180 3180 Earphone for use with KMC 25 for TK 2180 3180 Palm microphone kit 2 wire for TK 2180 3180 Mini lapel microphone kit 3 wire for TK 2180 3180 Headset with boom microphone for TK 2180 3180 Heavy duty headset for TK 2180 3180 Speaker microphone for TK 2180 3180 Voice guide amp storage unit for TK 2180 3180 Programming interface cable for TK 2180 3180 Serial to USB adapter with drivers for TK 2180 3180 Programming software for TK 2180 3180 VHF handy red orange brown white oo fof S KENWOOD ATEX TRANSCEIVERS AND ACCESSORIES TK 3260EXE2 KRA 22M KRA 22M2 KRA 22M3 KRA 23M KRA 26M KRA 26M2 KRA 26M3 KRA 27M KNB 58LEX KNB 64LEX KSC 32T KSC 32ST KSC 326T KMB 30M KMC 46EX KBH 16EX KLH 168EX KSL 3SF KPG 36A KPG 123D KCT 53U UHF handy 440 470MHz 12 5 20 25KHz 1 2W 16CH ciw belt clip needs aerial battery amp charger VHF short antenna 146 162MHz for TK 2260 VHF short antenna 162 174MHz for TK 2260 VHF short antenna 136 150MHz for TK 2260 UHF short antenna 440 490MHz for TK 3260 VHF antenna 146 162MHz for TK 2260 VHF antenna 162 174MHz for TK 2260 VHF antenna 136 150MHz for TK 2260 UHF antenna 440 49
334. hock mount assembly 2 for PR30 amp PR40 champagne ri mount mic adapter to fit up to 3 mics to one base studio microphone boom with open top access rd carry case for PR 30 Wall mount with brass inserts for PL 2T or SB 2 Cable 3 pin XLR plug to 3 pin XLR socket 8 long 3 pin in line XLR socket female 3 pin in line XLR plug male Microphone pre ampliier designed for USB interface with balanced XLR input mic level tone vol control Articulated boom Optional base for Heritage studio microphone with soft touch PTT switch Replacement C clamp for PL 2 SM 1 replacement band small SM 2 replacement band large PR 40 el Replacement windscreen for PR 20 AND Heil desk mics GM 4 Replacement windscreen for PR40 amp PR30 amp PR 780 amp PR 781 Replacement windscreen for Handi Mic Replacement rubberised black grill for PR 35 will also fit RC 35 Replacement rubberised silver grill for PR 35 will also fit RC 35 Replacement rubberised gold grill for PR 35 will also fit RC 35 Replacement rubberised black grill for PR 22 amp PR 20 Spare clip for hand microphone amp stand Heil Wire for microphone 10 feet long 4 core 18 guage plus 100 silver screen Heil Wire for microphone 20 feet long 4 core 18 guage plus 100 silver screen Heil Wire for microphone 50 feet long 4 core 18 guage plus 100 silver screen t All Starts With The Microphone by Bob Heil Practical Guide for Concert Sound by Bob Heil lz HEIL AMA
335. hone standard for NXR 700 800 Hand microphone with DTMF for NX 700 800 Hand microphone heavy duty for NX 700 800 Hand microphone with keypad heavy duty for NX 700 800 Control station desktop microphone for NX 700 800 Horn alert public address relay unit for NX 700 800 AVLidispatch software for NX 700 800 DC cable remote mount 3m for NX 700 800 DC cable remote mount 7m for NX 700 800 Ignition sense cable for NX 700 800 External speaker needs KAP 2 for NX 700 800 Line noise filter for NX 700 800 GPS speaker microphone for NX 700 800 Control head remote kit 7m for NX 700 800 Voice guide amp storage unit for NX 700800 PC interface cable for NX 700 800 Programming software for NX 700 800 KENWOOD MOBILE PMR TRANSCEIVERS AND ACCESSORIES TK 7302E TK 8302E KMC 30 KMC 32 KMC 35 KMC 36 KMC 9C KCT 18 KCT 36 KCT 60 KES 3 KES 5 KLF 2 KMB 10 KPG 46A KPG 124D KCT 53U TK 7160E TK 8160E TK 8160E3 KMC 30 KMC 32 KMC 35 KMC 36 KMC 9C KCT 18 KCT 36 KCT 39 KDI 03 KES 3 KLF 2 KMB 10 KPS 10A KPG 46A KCT 53U KPG 99D TK 7180E TK 8180E KAS 10 KGS 3M KMC 30 KMC 32 KMC 35 KMC 36 KMC 9C KAP 2 VHF 136 174MHz 12 5 20 25KHz 5 25W 16 CH comes with mount DC cable user manual UHF 400 470MHz 12 5 20 25KHz 5 25W 16 CH comes with mount DC cable user manual Hand microphone standard for TK 7302 8302 Hand microphone with DTMF for TK 7302 8302 Hand microphone heavy duty for TK 7302 8302 Hand microphone w
336. i gain N type 500W 4 long 400 475MHz V 4PRO UHF commercial vertical 400 470MHz V 42R 2m 70cm vertical 3dBd 5dBd gain N type 200W 9 long V 6R 6m vertical 5 2dBi gain SO 239 500W 25 25 long VB 23FM 2m 3 element beam 500W VB 25FM 2m 5 element beam 500W VB 28FM 2m 8 element beam 500W VB 214FM 2m 14 element beam 500W VB 215DX 2m 15 element beam 2kW VB 64DX 6m 4 element beam 500W VB 66DX 6m 6 element beam 1 5kW HYGAIN MISCELLANEOUS APA 3 Arrow point antenna anchor APT 2 Antenna feedpoint pig tail cable DR 3 Drive rod for APA 3 ATB 65 Base mount assembly for ATM 65 877200 ATB 75 Universal tilt base for vertical antennas ATM 65 11 section portable aluminium mast 65 feet long open 6 feet closed BMC 249 Boom to mast clamp set BN 4000B Beam current balun 1 54MHz SO 239 50 Ohms 4000 Watts BN 4000D Dipole current balun 1 54MHz SO 239 50 Ohms 4000 Watts BN 4000N Beam current balun 1 54MHz N type plug 50 Ohms 4000 Watts BN 86 Ferrite balun 3 30MHz for HFYagis SO 239 50 Ohms C 1 Center insulator for multiband dipole aerial for wire connection C 1C Center insulator for multiband dipole aerial S0 239 connection E 1 End insulator for dipole 7 inches E 2 End insulator ceramic E 26 End insulator ceramic 6 pack GTD 2 Replacement gas discharge tube GR 1 4 foot copper plated steel earth rod 3 8ths diameter GWH 1 Guy wire gripper RPM 1 Rotator pot 500 Ohm 5023100 ICOM HF TRANSCEIVERS amp ACCESSORIES RC 28 RC 28 plus RS BA1 IP remote e
337. ial Mobile whip aerial 3 8th thread for 6m Mobile whip aerial 3 8th thread for 10m Mobile whip aerial 3 8th thread for 15m Mobile whip aerial 3 8th thread for 17m Mobile whip aerial 3 8th thread for 20m Mobile whip aerial 3 8th thread for 30m Mobile whip aerial 3 8th thread for 40m Mobile whip aerial 3 8th thread for 75m 40 10m portable antenna 50 coax PL 259 200W 40 2m apartment antenna Window balcony antenna with tuner 6 30m 200W Mini Bug catcher base loaded 1 6m approx 100W 6m 40m Window balcony antenna with tuner 6 80m 200W MFJ 1644 without RF front panel meter Compact 3 5 30MHz whip antenna tuner with telescopic whip 3 8 thread 150W 20 6m manual screwdriver aerial 40 6m manual screwdriver aerial 6 80m portable screwdriver aerial 200W PEP HF mobile 10 80m screwdriver aerial Mini screw driver aerial 200Watts 3 5 54MHz 6 way coax antenna transceiver switch 1 8 30 MHz 2KW max 6 way coax switch 1 8 30 MHz 2KW max 2 way coax switch 0 450MHz PL 259 type 2 way coax switch with center ground position amp lightning surge protection 2 way coax switch N type DC 1 1GHz Antennaitransmitting safety switch 4 way coax switch PL 259 0 500MHz 4 way coax switch N type RF bypass switch DC 60MHz 300 Watts RF bypass switch DC 60MHz 1500 Watts 6 position antenna switch for balanced line banana plug type binding posts 6 position antenna switch for balanced line ceramic feedthrough screw terminals Automatic RF sen
338. iant SWR POWER meter 1 6 60MHz SWR POWER meter 30 300 3000W 1 6 200MHz SWRIPOWER meter 5 20 200W 125 525MHz SWR POWER meter 5 20 200W 1 8 525MHz SWRIPOWER meter 5 20 200W 300 Hz to 2 8GHz pocket frequency counter nicads 220V charger and aerial DX Beacon Monitor 1 8 30 MHz versa tuner 200 Watts PEP 3 5 50MHz 80 6M 150W Travel Tuner mini antenna tuner 3 5 30MHz 150W Travel Tuner mini antenna tuner 4 1 balun amp bal wire term 6m ATU 100W FM and 200W SSB PEP 3 5 30MHz 150W Travel Tuner with SWR PWR meter 3 5 30MHz 150W Travel Tuner with SWR PWR meter 4 1 balun amp bal wire term 6m ATU 100W FM and 200W SSB PEP with SWR POWER meter Variable RF transformer 2 50 Ohms 1KW 1 8 30MHz Mobile impedance L matcher 200 Watts inductance type 10 80m Mobile impedance C matcher 600 Watts capacitance type 10 80m 1 8 30 MHz 200W HF matcher 4 1 balun 300W Switchable balun 1 1 or 4 1 300W 1 8 30MHz Remote balun box lets you put a balun where you like 4 1 Current balun 300W Auto tuner extender extends matching range of an auto ATU RF isolator 1 1 current balun 1 8 30MHz 50 Ohms 2m 70cm duplexer SO 239 2m 70cm duplexer N type Analyser current balun 1 8 30MHz checks balanced line feeders with MFJ 259 269 1 1 current balun 1 8 30MHz 50 Ohms 4 1 Current balun 1 5kW 144 amp 220 MHz VHF ATU 200W built in SWR power meter 144 amp 440 MHz VHF UHF ATU 200W built in SWR power meter 440 MHz band UHF ATU 200W built in SWR power meter 20
339. ice guide amp storage unit for TS 480 86 95 SP 23 K Base speaker for TS 480 74 95 HS 6 Ultra light headphones for TS 480 38 95 MC 43S Dynamic hand microphone with Up down 8 pin plug for TS 480 needs MJ 88 20 95 791 0638 35 Spare dynamic hand microphone with Up down modular plug for TS 480 needs MJ 88 69 95 MC 47 Hand mic with 4 programmable buttons for TS 480 needs MJ 88 42 95 MC 60A Dual impedance desk microphone internal pre amplifier for TS 480 needs MJ 88 127 95 MJ 88 Mic plug adaptor for TS 480 24 95 PG 20 DC cable 7m long for TS 480 38 95 PG 4Z Panel extension cable 4m for TS 480 48 95 0 3 K Superior stability TCXO for TS 480 108 95 WDC HF4 Replacement 12 v DC lead for TS 480 16 95 YF 107C CW filter 500Hz for TS 480 119 95 YF 107CN CW filter 270Hz for TS 480 119 95 YF 107SN SSB narrow filter 1 8KHz for TS 480 119 95 TKK K OOO OT OOO TOO K DOSS TOOT T T T OOO OOO OOO KOK K KOG KK KOK OOT OO OOO KOKO K OO KOK KO KK TOO TOO K KENWOOD VHF UHF TRANSCEIVERS TM D710GE 2m 70cm mobile transceiver with APRS amp TNC 50 50 Watts DTMF mic amp GPS TM D710EE 2m 70cm mobile transceiver with APRS amp TNC 50 50 Watts DTMF mic MC 59 Spare keypad hand microphone for TM D710E will work DTMF MJ 88 Mic plug adaptor for TM D710E PG 2N Spare DC cable for TM D710E PG 3B DC line no
340. idth 13 95 C 3 7 RED Capacitor for CHALLENGER 3 7MHz centre frequency minimum 130KHz bandwidth 13 95 C 3 8 BLUE Capacitor for CHALLENGER 3 8MHz centre frequency minimum 130KHz bandwidth 13 95 C 3 9 GREEN Capacitor for CHALLENGER 3 9MHz centre frequency minimum 130KHz bandwidth 13 95 C 4 0 BROWN Capacitor for CHALLENGER 4 0MHz centre frequency minimum 130KHz bandwidth 13 95 FUJIKON NOISE CANCELLING HEADPHONES NC 2 Noise cancelling headphones with airplane adaptor 24 95 FUN CUBE DONGLE FUNCUBE PRO SDR 150KHz 240MHz amp 420MHz 1 9GHz dongle 149 95 SBS SMA BNC Cable 15 95 G B ANTENNAS GB 4 6m 2m 70cm amp 23cm 4 band beam 21 elements 2 99m boom 369 95 GB 3 6m 2m amp 70cm 3 band beam 11 elements 1 99m boom 279 95 GB 2 2m amp 70cm 2 band beam 9 elements 1 99m boom 179 95 GB 4 3 4m 3 element yagi 70 70 5MHz 1 25m boom 1KW max 139 95 GB 4 4 4m 4 element yagi 70 70 5MHz 3m boom 1 KW max 209 95 GB 4 4 X 4m 4 element crossed yagi 70 70 5MHz 3m boom 1KW max 359 95 GB 4 5 4m 5 element yagi 70 70 5MHz 4 5m boom 1KW max 254 95 GB 4 6 4m 6 element yagi 70 70 5MHz 6m boom 1KW max 299 95 GB 270 2m 8 element 70cm 9 element dual band yagi 3m boom 269 95 GB 26 2m 8 element 6m 2 element dual band yagi 2 5m boom 279 95 WS 2580 Pack of 25 80mm 3 clip on wire spreaders 9 95 GHD ELECTRONIC KEYER GF 601A Double speed key 299 95 GK 509 Miniature Electronic Memory Keyer 279 95 GIOVANNINNI D2T 2 el Compact beam 1 5 200
341. ield Video Receiver built in monitor 900MHz 2 52GHz detects wireless video cameras 669 95 D X SWEEPER FM Nearfield Receiver with Spectrum Display 1 649 95 D X SWEEPER GPS X Sweeper fitted with GPS module amp GPS antenna 1 899 95 D XPLORER Frequency counter CTCSS DTMF decode reaction tune with charger amp aerial 789 95 C R 506 RF detector 50MHz 6GHz locates AM FM analogue digital transmitters in the nearfield 269 95 C DIGITAL SCOUT Digital amp analogue frequency counter 60MHz 2 6GHz EIS meter amp Reaction tune 489 95 D SPECTRUM SCOUT Frequency finder 10MHz 2 6GHz with data display 1000 memories Cl V AOR 479 95 C SCOUT Frequency finder 10MHz 1 4GHz 400 memories Cl V AOR 349 95 C CUB Mini frequency counter 1 2 8GHz with nicads charger amp helical LCD display 154 95 C M1 10Hz 2 4GHz counter with nicads charger amp aerial 3 memories LCD display 259 95 C M1 TCXO 10Hz 2 4GHz counter with temperature controlled crystal oscillator fitted 349 95 C CD 100 Multi counter 10MHz 1GHz frequency counter and tone decoder 610 95 C OPTOLINX RS 232 interface and software for Cl V AOR 199 95 C OPTOSUITE PRO Software package for Scout Spectrum Scout Digital Scout M1 CD100 Xplorer 169 95 C OPTOSUITE X Software package for Scout Spectrum Scout Digital Scout M1 CD100 Xplorer Xsweeper 189 95 C RD 27 0 Rubber duck antenna 26 150MHz BNC 38 95 A RD 50 RD 150 RD 440 RD 800 RD 2400 DB 32 BB 85 ANT PAK 1 ANT PAK 2 ANT P
342. ifier 20dB gain 750W bypass N SSB SP 7000 430 440MHz 70cm mast head pre amplifier 20dB gain 500W bypass N SSB SP 23 1250 1300MHz 23cm mast head pre amplifier 20dB gain 100W bypass N SSB SP 13B 2300 2400MHz 13cm mast head pre amplifier 20dB gain 50W bypass N DCW 2004B Sequence controller for 6 2 70 SSB SP 6 2000 7000 puts 12V up the coax DCW 2004B SHF Sequence controller for 13 23cm SSB SP 13B 23 puts 12V up the coax UEK 3000 2 2 4GHz down converter 2m IF TALKING HEADSETS 35000 Ear defenders with input for receiver listen only allows ambient noise through 45150 Ear defenders noise cancelling headset allows ambient noise wired for 2 pin Icom handheld 41050 Ear defenders noise cancelling headset NO ambient noise wired for 2 pin Icom handheld 36100 Ear defenders with built in FM radio NO ambient noise 41120 Noise cancelling headset for 2 pin Kenwood handheld with boom mic and earpiece 45120 Noise cancelling headset cut off active with boom mic ear for 2 pin Kenwood handheld TELECOM AMPLIFIERS 2M HK 2m high power linear amp 2 5W in 500W PEP out solid state 144 146IMHz 220V AC built in PSU 64 HK 4m amp 6m high power linear amp 2 5W in 500W PEP out solid state 50 70MHz 220V AC builtin PSU 70CM HK 70cm high power linear amp 2 5W in 500W PEP out solid state 432MHz 220V AC builtin PSU 23CM150 23cm high power linear amp 5 6W in 150W PEP out solid state 1296MHz 220V AC built in PSU TEN TEC TRANSCEIVERS amp ACCESSORIES REBEL 506 ORION 11 566
343. ion intercom speaker with call button for VLH 3000 10W external amplified speaker for VLH 3000 DC cable for VLH 3000 Mounting bracket for VLH 3000 Mounting bracket knob for VLH 3000 Sun cover for VLH 3000 YAESU MISCELLANEOUS ACCESSORIES MAINLY FOR OLDER RIGS DVS 4 PA 28U PA 28C CT 35 462800118 8100786 R3520630A Q9000709A CB1359001 RA0269400 RA0269500 Q9000788 Q9000796 462800139 8101959 8100830 CA 15 CD 2 CE 38 CLIP 10 CN 2 CSC 73 CSC 90 CT 28 CT 30 CT 92 DD 13 DC 20 BA 38 EP 10 NB V57 F 11 Dgn nnmoe Digital voice recorder for VR 5000 Spare 240V power supply for VR 5000 3 pin UK 13V DC 1 Amp Spare 240V power supply for VR 5000 2 pin Euro 13V DC 1 Amp Set to set clone cable kit for VR 500 Volume squelch encoder for Yaesu FT 8800 Spare aerial for VR 500 Spare belt clip for VR 500 Rotary encoder VR unit Rotary knob AF Rotary knob SQL Pot Encoder Potentiometer Lamp for Rotator Microphone cable for FT 8100 Charge adaptor for FNB 40 41 amp FT 10 40 50 Mobile charger charger for FT 11 41 51 Programming software for HX 270 Belt hook for FT 50 10 40 Adaptor SMA socket to BNC socket for FT 10 40 Soft case for VX 5R Soft case for VX 2E Clone cable Microphone adaptor for FT 10 30 FIF 8C to RJ45 programming cable DC adaptor for FT 11 41 51 was PA 10A DC lead for FT 1000MP FIELD Dry cell case Earphone for VX 1 Nicad pack 7 2V 1 1Amp for VX 246
344. ise filter for TM D710E PG 5A Data cable for TM D710E PG 5F Head extension cable kit 4m for TM D710E PG 5G PC serial cable for TM D710E PG 5H PC serial cable and soundcard audio cable contains PG 5G for TM D710E RC D710E Front panel of TM D710E built in AX 25 Packet TNC VGS 1 Voice guide amp storage unit for TM D710E PG 5J Interface kit for RC D710 E30 7543 08 Replacement cable and plug for MC 59 TM V71E 2m 70cm mobile transceiver with Echolink 50 Watts DTMF mic dual receive MC 59 Spare key pad hand microphone for TM V71E will work DTMF DFK 3DW Quick release detachable front panel kit for TM V71E MJ 88 Mic plug adaptor for TM V71E PG 2N Spare DC cable for TM V71E PG 3B DC line noise filter for TM V71E PG 5A Data cable for TM V71E PG 5F Head extension cable kit 4m for TM V71E PG 5G PC serial cable for TM V71E PG 5H PC serial cable and soundcard audio cable contains PG 5G for TM V71E RC D710E Front panel of TM D710E built in AX 25 Packet TNC VGS 1 Voice guide amp storage unit for TM V71E TM 281EE 2m FM 65 25W mobile transceiver with MC 59 RX 136 174MHz KES 3 Mobile speaker for TM 281E 9replaces SP 50B KMC 30 Hand microphone standard for TM 281E MC 59 Spare DTMF key pad hand microphone for TM 281E MC 60A Dual impedance desk mic pre amp for TM 281E needs MJ 88 KCT 53U Serial to USB adaptor with drivers KPG 46A PC interface cable for TM 281E serial KPG 46U PC interface cable for TM 281E USB MCP 1A Memory Control Software download free from
345. it LOC beacon READ badge F1710 with UT 103 OPC 822 flash ROM FFSK base software Cloning cable serial Cloning cable USB 10 Amp power supply with choice of base enclosure includes PS 1508 005 Additional base enclosure for IC F1710 ICOM RMS NET RADIO MESSAGING SYSTEM RMS 001 RMS 002 RMS 003 RMS 004 RMS 007 F1710 005 PS 1508 001 PS 1508 005 SM 25 OPC 1122 001 OPC 1122 002 Radio messaging system software suite SELCALL BIIS and a dongle Radio messaging system amp LLOC demo software suite no dongle Radio messaging system software suite full mapping Additional channel licence F1710 with UT 103 OPC 822 flash ROM FFSK base software 10 Amp power supply with choice of base enclosure includes PS 1508 005 Additional base enclosure for IC F1710 Desk microphone Cloning cable dealers only Cloning cable dealers only ICOM MISCELLANEOUS ACCESSORIES MAINLY FOR OLDER RIGS 450 026 1317 03 BC 206SE FSR08 001 PCR1000 008 SP 003 38022 001 F3G 005 F3G 006 F filter for IC M11 Part Power supply for BC 192 BC 158 BC 146 2 pin EU Channel selector encoder for IC F4002 C PCR1000 antenna with cable and BNC plug Spare headphone socket for IC R5 CPU for tuner control board from IC 746 Front cover for IC F4GT Front cover for IC F4GS 51 95 18 95 47 95 9 95 45 95 25 95 62 95 121 95 74 95 69 95 359 79 359 79 41 95 27 95 46 95 99 95 52 95 46 95 51 95 139 95
346. ith keypad heavy duty for TK 7302 8302 Control station desktop microphone for TK 7302 8302 Ignition sense cable needs KCT 39 for TK 7302 8302 Extension cable for TK 7302 8302 Connection cable D sub to Molex 15 pin for TK 7302 8302 External speaker for TK 7302 8302 External speaker needs KAP 2 for TK 7302 8302 Line noise filter for TK 7302 8302 Key lock adaptor for TK 7302 8302 PC interface cable for TK 7302 8302 PC programming software for TK 7302 8302 Serial to USB adaptor with drivers for TK 7302 8302 VHF 136 174MHz 12 5 20 25KHz 5 25W 128 CH comes with mount DC cable user manual UHF 440 470MHz 12 5 25KHz 5 25W 128 CH comes with mount DC cable user manual UHF 400 430MHz 12 5 25KHz 5 25W 128 CH comes with mount DC cable user manual Hand microphone standard for TK 7160 8160 Hand microphone with DTMF for TK 7160 8160 Hand microphone heavy duty for TK 7160 8160 Hand microphone with keypad heavy duty for TK 7160 8160 Control station desktop microphone for TK 7160 8160 Ignition sense cable needs KCT 39 for TK 7160 8160 Extension cable for TK 7160 8160 Accessory connector cable 16 pins for TK 7160 8160 DIN size vehicle mount for TK 7160 8160 External speaker for TK 7160 8160 Line noise filter for TK 7160 8160 Key lock adaptor for TK 7160 8160 DC power supply for TK 7160 8160 PC interface cable for TK 7160 8160 Serial to USB adaptor with drivers for TK 7160 8160 PC programming software for TK 7160 8160 VHF 136 174MHz 12 5 20 2
347. ith magnetic mount Travel case for Mini Paddle Code Cube instructions and cable etc Palm portable straight key black Pair of magnets for Palm Portable key or upgrade to QuickMounts Code Cube electronic memory keyer unit for mini paddle with side tone Code Cube electronic memory keyer unit stand alone with side tone Housing kit to upgrade a Code Cube to Code Cube Solo Tilt stand kit for FT 817 PEET BROS WEATHER STATION EQUIPMENT ULTIMETER 2100 ULTIMETER 800 ULTIMETER 100 WSF 10030PM WSS 01000 003 WSF 65027 WSF 10080 WSF 10100 WSF 10150 WSF 10065 WSF 47000 WSF 10075 WSF 02008 WSF 02108 040 WSF 10049 SCF 00400 WSS 01100 001 WSS 01100 003 PINHOLE GLASSES PINHOLE Weather station wind pressure sensors in out temp humidity inc psu WeatherText data lagging CD Weather station wind outdoor temp humidity inc psu WeatherText data logging CD Weather station wind and outdoor temp inc psu now includes WeatherText data logging CD Anenometer wind vane pro marine grade 40 feet of cable Wind vane assembly Weather Picture oak frame wall display Indoor temperature sensor for Ultimeter 100 Ultimeter rain gauge PRO 40ft cable Universal mounting bracket for Rain Gauge PRO Outdoor humidity temp sensor 40ft cable TB sensor combo rain gauge and humidity temperature sensor with solar shield Solar radiation shield for temperature sensor 40ft extension cable for Weather Picture display 40ft extension cable for junction box Cable betw
348. its Kenwood Yaesu Alinco lcom Replacement 12 v DC lead for HF rigs 6 pin like IC 706 3m long fused 30A Replacement 12 v DC lead for HF rigs 4 pin IC 7000 IC 7200 TS 480 FT 450 FT 950 3m long fused 30A 12V DC cable cigar lighter plug with LED fused 5A to 2 x 5 Amp crocodile clips 1m long 15 Amp cable Switch Mode AC DC adaptor 3 4 5 6 9 amp 12V 1 Amp max regulated 230 115 V AC DC converter 800mAh adapts a cigar lighter plug to 3 pin 230V mains Inverter 150 Watts from 12 Volts DC to 220 Volts AC with USB socket Inverter 300 Watts from 12 Volts DC to 220 Volts AC 2m halo folded dipole unity gain small compact and easy to use 4m halo folded dipole unity gain small compact and easy to use 6m halo folded dipole unity gain small compact and easy to use 2 70 mobile whip 3 8ths thread 50cm long 100W wideband vertical 0 5 2000MHz 110cms long N 4m 2 element beam 6m 2 element beam 70cm 2 element beam 4m vertical 5 8ths wave 8 feet tall SO 239 with ring base 2m Slim Jim 70cm Slim Jim Base station colinear 88 108MHz with cutting chart 5 8ths wave 2 7m long 4 5dB gain 200W SO 239 2m 70cm glassfibre colinear 3 6db gain 1 15m long 2m 70cm glassfibre colinear 4 5 7 2db gain 1 8m long 2m 70cm glassfibre colinear 6 5 9db gain 3 1m long 6m 2m 70cm glassfibre colinear 2 15dBi 6 2dBi 8 4dBi 2 5m long 4m 70 71MHz 1 2 wave glassfibre colinear 2 75dBd gain 2 3m long 6m 50 54MHz 1 2 wave glassfibre colinear 2 75dBd gain 2 85m long Airband vertical
349. iven element for 220921 and 220922 30 95 210103 Packet of 10 elements for 220623 220624 220635 220636 220655 and 220650 13 95 220603 Spare 1260 1300MHz driven element for 220623 34 95 220605 Spare 1260 1300MHz driven element for 220635 and 220655 34 95 220604 Spare 1260 1300MHz driven element for 220624 34 95 220606 Spare 1260 1300MHz driven element for 220636 and 220650 34 95 210125 Packet of 25 elements for 220725 13 95 TTI TSC 100R Hand held scanner 66 88 88 108 108 136 136 174MHz 69 95 TSC 3000R Hand held scanner 160KHz 1300MHz AM FM WFM 1300 memories 109 95 UNIDEN BEARCAT SCANNER UBC 125XLT Handheld scanner 25 88 108 174 225 512 amp 808 960MHz close call with USB cable 129 95 SW ARC125 BuTel control software for UBC 124XLT 24 95 UBC 75XLT Handheld scanner 25 88 108 174 amp 400 512MHz close call USB 99 95 AD1243 Car adaptor for UBC 75XLT with USB slot 13 95 AD1246 Home adaptor EU amp UK plugs for UBC 75XLT 19 95 EZI 33XLT Handheld scanner 78 87 295 87 3 107 95 108 174 amp 406 512MHz 8 33KHz steps 59 95 UBC 355CLT Desktop mobile scanner 25 87 108 174 406 512 amp 806 960MHz close call 8 33KHz steps 59 95 BCT 15X Base scanner 25 512MHz 764 776 794 956 amp 1240 1300MHz 259 95 SW UBC BCT 15X BuTel control software for BCT 15X 14 95 SW UBC 800 BuTel control software for UBC 800XLT 21 95 SW UBC 785 BuTel control software for UBC 785XLT 34 95 SL9 9 Programming cable serial PC to UBC
350. k plug Red banner badge scrolling message badge Blue LED scrolling message badge kit Spare battery for Banner badge CR 2032 6 pin data lead for FT 817 8 pin data lead for FT 817 FT 817 vehicle power lead FT 817 vehicle power lead 6m long FT 817 fused DC power lead Pocket reference for FT 817 Pocket reference for VX 7R Pocket reference for VX 5R Pocket reference for VX 2R Pocket reference for VX 6R Pocket reference for VX 8DR Pocket reference for VX 8R Icom SP 21 speaker fitted with bhi NEDSP 1062 KBD DSP filter Icom SP 23 speaker fitted with bhi NEDSP 1062 KBD DSP filter Kenwood SP 23 speaker fitted with bhi NEDSP 1062 KBD DSP filter 4 95 6 95 3 95 1 50 11 95 7 95 12 95 17 95 8 95 5 95 11 95 11 95 12 95 79 95 10 95 9 95 13 95 299 95 169 95 199 95 339 95 195 95 149 95 169 95 489 95 159 95 189 95 12 95 109 95 149 95 229 95 179 95 129 95 179 95 3 95 99 95 99 95 109 95 99 95 109 95 119 95 59 95 129 95 29 95 19 95 59 95 89 95 12 95 12 95 12 95 10 95 9 95 5 95 8 95 5 95 6 95 5 95 6 95 2 95 3 95 19 95 19 95 24 95 10 95 6 95 3 95 3 95 4 95 2 95 2 95 2 95 2 95 2 95 2 95 2 95 2 95 6 95 2 95 2 95 2 95 2 95 2 95 2 95 2 95 14 95 19 95 1 50 9 95 9 95 8 95
351. kW 11 65dBi gain 144MHz OWL yagi 2 1m long 5kW 11 65dBi gain rear mount 144MHz OWL yagi 3m long 5kW 12 88dBi gain 144MHz OWL yagi 3 75m long 5kW 13 4dBi gain 144MHz OWL yagi 4 4m long 5kW 14 23081 gain 144MHz LFA yagi 0 67m long SkW 8 67dBi gain rear mount 144MHz LFA yagi 1 17m long SkW 9 49dBi gain rear mount 144MHz LFA yagi 1 79m long SkW 11 16dBi gain rear mount 144MHz LFA yagi 2 41m long SkW 11 88dBi gain rear mount 144MHz LFA yagi 0 67m long SkW 8 67dBi gain 144MHz LFA yagi 1 17m long SkW 9 49dBi gain 144MHz LFA yagi 1 79m long SkW 11 16dBi gain 144MHz FLA yagi 2 41m long SkW 11 88dBi gain 144MHz LFA yagi 2 89m long SkW 12 81dBi gain 144MHz LFA yagi 3 73m long SkW 13 32dBi gain 144MHz LFA yagi 4 40m long SkW 14 06dBi gain 144MHz LFA yagi 5 25m long 5kW 14 73dBi gain 144MHz LFA yagi 6 19m long 5kW 15 20dBi gain 144MHz LFA yagi 7 13m long 5kW 15 80dBi gain 144MHz LFA yagi 8 00m long 5kW 16 14dBi gain 144MHz LFA yagi 8 96m long 5kW 16 60dBi gain 144MHz LFA yagi 9 86m long 5kW 16 89dBi gain 144MHz LFA yagi 10 85m long SkW 17 27dBi gain 144MHz LFA yagi 11 83m long SkW 17 52081 gain 144MHz LFA yagi 12 75m long SkW 17 83dBi gain comes in 2 boxes 144MHz LFA yagi 13 78m long SkW 18 05dBi gain comes in 2 boxes 144MHz LFA yagi 14 75m long SkW 18 24dBi gain comes in 2 boxes 144MHz LFA yagi 15 68m long SkW 18 41dBi gain comes in 2 boxes 144MHz LFA yagi 16 68m long SkW 18 55dBi gain comes in 2 boxes 449 95 469 95 639
352. l 1 8 432MHz 10W PEP 129 95 WONDERWAND CP_ Tuneable counterpoise for Wonderwand 61 95 WONDERWAND LP Wonderloop 14 50MHz tuneable loop 10W 91 95 WOODBOX RADIO TMATE2 USB tuning system for Flexradio Apache Labs and Perseus 269 95 STUDIO1 Studio1 SDR Software 159 95 HAMPAD Touchscreen USB mini monitor for Flex radio SDR transceivers 199 95 WOUXUN KG UV950P 10m 6m 2 70cm mobille transceiver 229 95 KG UV950PL 4m 6m 2m 70cm mobile transceiver 249 95 KG UV8D 2m 70cm Handheld True Dualband Transceiver 5W 4W SMA SOCKET 99 95 KG UV8D PROPACK 2m 70cm Handheld True Dualband Transceiver SW 4W SMA PLUG with accessories bundle 159 95 KG UV6D 2m 70cm Handheld True Dualband Transceiver 5W 4W SMA PLUG with accessories bundle 94 95 KG UV6DIL 4m 2m Handheld dalband transceiver 5W 4W SMA 66 87 5 amp 136 174MHz 119 95 KG 679E 2M 2m FM handheld transceiver 5W SMA plug 49 95 KG 699E 4M 4m 66 88MHz FM handheld transceiver 5W SMA plug 79 95 KG 679E 70CM 70cm 400 470MHz UHF FM handheld transceiver 5W SMA plug 64 95 KG 689E 70CM 70cm 400 470MHz UHF FM handheld transceiver 5W SMA plug with scrambler 81 95 QS 112W Handheld speaker microphone for Wouxun 2 pin 12 95 WO 4MCLWHIP 4m Whip 20 39 WO ANO 001 Spare 2m 70cm antenna 10 19 WO ANO 003 U Spare 70cm antenna 420 470MHz 13 29 WO BLO 001 Standard 1300mAh Li ion battery pack 15 30 WO BLO 004 1700mAh Li ion battery pack 19 99 WO BAO 001 Dry cell case for AA batteries 10 99 WO ELO 001
353. le battery case amp solar panel iPhone 4 AXIS Hand powered radio with flashlight phone charger ROVER Hand powered radio with USB phone charger ROAD TORQ Roadside beacon amp spotlight EXPERT ELECTRONICS SUNSDR2PRO High performance SDR transceiver Enhanced features compact size COLIBRIDDC Compact DDC receiver covering 0 09 55MHz extendable up to 800MHz MB1 FINGER DIMPLE FD 450 Kranker knob for FT 450 amp FT 450 AT NOT FT 450D FD BLK FingerDimple packet of 2 black FD GRY FingerDimple packet of 2 grey VOCT Velcro pack of 25 black reusable cable ties 8 inches long 1 2 inch wide 299 95 32 95 129 95 169 95 129 95 64 95 22 95 32 95 32 95 9 95 9 95 9 95 34 95 749 95 1 099 95 399 95 129 95 44 95 99 95 62 95 239 95 89 95 169 95 22 95 99 95 42 95 79 95 49 95 30 95 249 95 229 95 44 95 79 95 16 95 16 95 64 95 156 95 319 95 129 95 29 95 49 95 49 95 299 95 89 95 129 95 69 95 65 95 9 95 69 95 39 95 39 95 44 95 2 199 95 1 999 95 39 95 39 95 729 95 679 95 24 95 759 95 709 95 259 95 209 95 299 95 239 95 299 95 239 95 299 95 239 95 99 95 99 95 99 95 6 95 169 95 159 95 64 95 419 95 159 95 64 95 34 95 29 95 299 95 99 95 49 95 119 95 99 95 29 95 49 95 59 95 149 95 199 95 49 95
354. lead 1 8 430MHz 5 Watts all mode Ni MH charger DC lead BHI DSP fitted Desk microphone for FT 817 Desk microphone for FT 817 Spare hand mic for FT 817 DTMF hand microphone for FT 817 High Power external speaker for FT 817 Open air type stereo headphones for FT 817 Manual tuning mobile aerial for FT 817 High stability crystal for FT 817 Collins SSB filter for FT 817 Collins CW filter 500Hz for FT 817 Collins CW filter 300Hz 1KHz for FT 817 Spare Ni MH battery pack 9 6V 1400mAh for FT 817 Spare charger for FT 817ND 3 pin UK new style Spare charger for FT 817ND 2 pin Euro new style USB interface unit for FT 817 CAT interface cable for FT 817 Packet cable for FT 817 Case for FT 817 Spare 6m 2m 70cm whip for FT 817 Spare dry cell case for FT 817 8 x AA now part number was FBA 28 Spare shoulder strap for FT 817ND Spare DC cable for FT 817ND Repeater 2m 70cm digital and analogue Spare DTMF microphone for DR 1XE Hand microphone for DR 1XE Voice guide unit for DR 1XE Digital amp analogue internet link to RF USB Data Cable MDIN10 pin to MDIN10 pin USB Data Cable MDIN10 pin to MDIN6 pin YAESU VHF UHF MOBILE TRANSCEIVERS AND ACCESSORIES FTM 400DE 2m 70cm digital transceiver Bluetooth GPS APRS 50 50W touchscreen MH 85A11U Hand speaker microphone with snapshot camera for FT 400DE MH 48A6JA Spare DTMF microphone for FT 400DE MH 42C6J Hand mic
355. lead for AR 3000 Spare mains power supply for AR 3000 Spare telescopic whip for AR 3000 Ready made tape recording lead for AR 3000 to 2 5 amp 3 5mm jack plugs RS232 lead to 9 pin PC for AR 3000 Service manual for AR 3000 MF 300 Collins mechanical filter CW 300Hz for AR7030 MF 500 Collins mechanical filter CW 500Hz for AR7030 CFJ 455K8 Murata ceramic 1 0KHz data filter for AR 7030 This is better filter than CFK 455J MF 4 Collins mechanical filter AM narrow 4 0KHz for AR 7030 MF 6 Collins mechanical filter AM 6 0KHz for AR 7030 FPU 7030 Enhanced features CPU as supplied with NB 7030 SM 7030 Service kit C W PC alignment disk for AR 7030 7030 PC 9 RS 232 lead from AR 7030 to PC 9 way connector CR 400 Ready made tape recording lead for AR 7030 to 2 5 amp 3 5mm jack plugs 5 DIN 5 pin din plug for computer connection 240 degrees 8 DIN 8 pin din plug for AUX connection PSU 7030 Spare PSU for AR 7030 DC 8600 Spare DC lead for AR 7030 with cigar lighter plug DATA MASTER CD PC control data base and more for AR 7030 on CD TW 7030 Telescopic whip for AR 7030 PL 259 USB RS232 USB to RS 232 converter COM PORT AOR MODEMS ARD 9000MKII HF digital SSB modem supplied with microphone ARD 9800 Modem for voice data high quality over SSB ME1 Optional memory card for ARD 9800 ARD 9900 Modem for voice data high quality over SSB encrypted AOR AERIALS LA 800 Outdoor loop aerial 80cm 10KHz 500MHz 20dB minimum gain 12V LA
356. long 5kW 8 62dBi gain 70MHz LFA yagi 1 4m long 5kw 8 72dBi gain 70MHz OP DES yagi 1 9m long 5kw 9 05dBi gain 70MHz LFA yagi 2 14m long 5kw 9 76dBi gain 70MHz LFA Q yagi 2 6m long 5kW 10 62dBi gain 70MHz LFA yagi 3 11m long 5kw 10 65dBi gain 70MHz LFA Q yagi 3 13m long SkW 11 24dBi gain 70MHz OP DES yagi 3 4m long 5kw 11 07dBi gain 70MHz LFA ZTR yagi 4 36m long 5kw 11 26dBi gain 70MHz LFA Q yagi 4 78m long SkW 12 48dBi gain 70MHz LFA yagi 4 88m long 5kW 11 83dBi gain 70MHz OP DES yagi 5 30m long SkW 12 39dBi gain 70MHz LFA WOS yagi 6 80m long 5kW 12 98dBi gain 70MHz LFA Q yagi 6 70m long 5kW 13 55dBi gain 70MHz LFA2 yagi 8 34m long 5kW 13 49dBi gain 70MHz LFA yagi 10 41m long 5kW 14 72dBi gain t 70MHz LFA yagi 12 21m long 5kW 15 29dBi gain t 70MHz LFA yagi 13 74m long 5kW 15 44dBi gain 88MHz OP DES yagi 2 30m long 3kW 10 00dBi gain t 88MHz OP DES yagi 4 01m long 3kW 10 90dBi gain t 88MHz OP DES yagi 5 60m long 3kW 11 30dBi gain t 88MHz OP DES yagi 6 05m long 3kW 12 15dBi gain t 88MHz OP DES yagi 6 70m long 3kW 12 28dBi gain t 88MHz OP DES yagi m long 3kW dBi gain 144MHz LFA Q quad boom 14cm long 6 87dBi gain 144MHz LFA Q quad boom 14cm long 6 87dBi gain 144MHz OWL yagi 52cm long 5kW 6 94dBi gain 144MHz OWL yagi 56cm long 5kW 8 58dBi gain 144MHz OWL yagi 90cm long 5kW 8 58dBi gain rear mount 144MHz OWL yagi 1 3m long 5kW 10 55dBi gain 144MHz OWL yagi 1 6m long 5kW 10 55dBi gain rear mount 144MHz OWL yagi 1 8m long 5
357. m no connectors 1 399 95 STE 3000F2 Cellular forensics RF test enclosure including RS 232 USB port and 6 outlet PS Generation 2 1 799 95 STE 3000FAV2 Microwave test enclosure includes vid Colour camera 7 TFT and recorder Generation 2 2 699 95 STE 3300F2 Microwave test enclosure includes RF absorbant foam no connectors Genaration 2 1 199 95 STE 3500 Microwave test enclosure includes RF absorbant foam no connectors 1 399 95 STE 4500 RF shielded test enclosure 2 499 95 STE 6000 RF shielded test enclosure with vision panel and bulit in examination gloves 4 199 95 GIGABIT ETHERNET Gigabit Ethernet Module option for all enclosures except STE 2200F2 595 95 52125 UK 5 Outlet power strip and cord 69 95 MISC55 STE Plate Mod 139 95 REUTERS 99 99 1840 Deluxe adjustable 8 Ohm professional earpiece for RFTV audio 3 5mm stereo jack plug 4 95 RFSPACE SDR IQ SDR receiver spectrum analyser and panoramic adapter 0 0001 30MHz DSP 549 95 IF 2000 F interface board for FT 2000 FT 2000D and FT 950 199 95 SDR IP SDR commercial grade receiver with spectrum analyser 0 01 34MHz DSP eithernet ready 2899 95 SDR IP 1 2 SDR commercial grade ethernet radio with low noise oscillator OVCXO amp trigger options fitted 3599 95 SDR IP 1 2 3 SDR commercial grade ethernet radio with low noise oscillator OVCXO amp trigger amp buffer options fitted 3799 95 NET SDR High performance networked SDR receiver 0 01 34MHz with rack mounting kit 1499 95 RIGEXPERT KMK UK
358. m 500W SO 239 with ground strap 39 95 B1 2K PLUS Current balun for dipoles and inverted V antennas 1 5KW 1 1 3 5 54MHz 39 95 B1 4K ULTRA Current balun high isolation 160 10m 1 1 4KW SO 239 44 95 B1 5K PLUS Current balun 160 6m 1 1 5KW SO 239 49 95 Y1 5K PLUS Current yagi balun 1 1 160 6m SkW SO 239 54 95 B4 1 5K Voltage balun 80 10m 4 1 1 5KW 39 95 B4 2K Voltage balun 80 10m 4 1 1 5KW 49 95 B4 2KX Current balun 160 10m 4 1 1 5KW 59 95 REM BAL Remote waterproof balun 160 10m 4 1 1 5KW 56 95 KEVLAR 200 feet spool Kevlar guy line 400 500 pound strain 29 95 LADDER LOC Dipole centre piece for 450 Ohm ladder line 19 95 RFF 213 Ferrite clamp for RG 213 1 30MHz 5 95 RFF 58 Ferrite clamp for RG 58 1 30MHz 3 95 FAQ BK Frequently Asked Questions About Antenna Systems And Baluns Book 6 95 RAMSEY KITS DDF 1 Doppler direction finder kit 154 95 LBC6K Laser beam audio communicator 56 95 TD 1 Tone encoder decoder kit 40 5000Hz 13 95 SG 7 Speedy radar kit 74 95 UAM 2 20W audio amplifier module ki 49 95 TFM 3C Tri Field meter kit electrical magnetic and RF detector 78 95 AR 1C AM VHF airband receiver kit with matching case and knob set 49 95 AR 2 R Synthesized aircraft receiver kit 117 975 to 137 000MHz 25KHz steps 194 95 ABM 1 KIT Passive airband monitor kit 89 95 FR 1C FM broadcast radio receiver kit with matching base and knob set 48 95 FR 10C 10M FM receiver kit with matching case and knob set 48 95 FR 146C 2m FM
359. m 80 6m inc WARC bands 69 feet long 21 1m 1500W cw ssb 179 95 CW 80LP Carolina Windom 80 10m inc WARC bands 133 ft long 40 5m 600W low profile 124 95 CWS 80 Carolina Windom 80 10m inc WARC bands 66 feet long 20 1m 129 95 CW 40 Carolina Windom 40 10m inc WARC bands 66 feet long 20 1m 1500W cw ssb 119 95 CW COMPACT 40 Carolina Windom 40 6m inc WARC bands 34 feet long 10 36m 1500W cw ssb 139 95 CW 40LP Carolina Windom 40 10m inc WARC bands 66 feet long 20 1m 600W low profile 119 95 CW 40PLUS Carolina Windom 40 10m inc WARC bands 66 feet long 20 1m 149 95 CW 20 Carolina Windom 20 15 10m 34 feet long 10 36m 119 95 CW 620 Carolina Windom 20 15 10 6m 32 feet long 119 95 SHORT 40 Carolina short 40 10m 50 long was Carolina beam 40 134 95 SHORT 80 Carolina short 80 10m 100 long was Carolina beam 80 144 95 SHORT 80 SPECIAL Carolina short 80 special 80 10m 50 long was Carolina beam 80 special 147 95 SHORT 160 SPECIAL Carolina short 160 special 160 10m 100 long was Carolina beam 160 special 147 95 G5RV PLUS Full size G5RV 80 10m with balun 79 95 TA Line isolator 160 10m 1 5kW SO 239 41 95 T 4G Line isolator 160 10m 1 5kW SO 239 with ground strap 44 95 T 4 PLUS Line isolator 160 6m 1 5KW SO 239 49 95 T 4G PLUS Line isolator 160 6m 1 5KW SO 239 with ground strap 49 95 T 4 500 Line isolator 160 6m 0 5KW SO 239 small size 39 95 T6 Line isolator 15 2m 500W SO 239 38 95 T 6G Line isolator 15 2
360. m HF dipole for portable fixed station use 400W CW 1 1 balun SO 239 5 07m long 45 95 HW AK 15 17m add on kit for HW 40HP to make HW 42HP 17 15 6m no ATU needed 19 95 MARINE EQUIPMENT S 160 Mariner 1 2 wave 156 163MHz mobile marine antenna SO 239 2 15dBi gain 90cm long 100w 55 95 MAXON TRANSCEIVERS amp ACCESSORIES LCPC 50 Leatherette case for PC 50 9 95 WTA 9 Low profile eartalker type microphone earpiece for PC 50 14 95 SRA 300 Leatherette case for SR 214 9 95 SRA 200 Charger for SR 214 9 95 CA 1488 Heavy duty nylon case for SL 30 10 95 MFJ 755 6811 2 50 755 3626 7 95 282 2112 1 35 95 729 0142 1 11 95 625 8800 49 95 400 3083A Mini cross meter 17 95 412 0109 Ferrite rod 8 95 408 6124 Relay for AL 811 later versions 9 95 408 6140 Relay for AL 811 earlier versions open frame type 24 95 204 2007 1 Air variable capacitor 20 250pf 300V 59 95 282 2008 1 Air variable capacitor 40 260pf 3kv 91 95 282 2009 1 Air variable capacitor 40 535pf 1 5v was 204 2009 1 92 95 404 1052 Inductor air roller 33UH 989 62 95 420 6102 Ferrite ring 61 ferrite 375 x 187 x 125 OD x ID x TH inches 0 69 420 6103 Ferrite ring 61 ferrite 500 x 281 x 188 OD x ID x TH inches 1 50 420 6114 Ferrite ring 61 ferrite 1 00 x 610 x 320 OD x ID x TH inches 1 50 420 7510 Ferrite ring 75 ferrite 1 00 x 610 x 320 OD x ID x TH inches 3 75 420 6138 Ferrite ring 61 ferrite 2 40 x 1 40 x 500 OD x ID x TH inches 11 95 729 0142 1
361. m long BNC plug Super Gainer scanning flexi 25 1900 MHz 40cm long SMA plug Tele Gainer scanning telescopic whip 25 1900 MHz 41cm long BNC plug Tele Gainer scanning telescopic whip 25 1900 MHz 41cm long PL 259 6 section telescopic whip 1 29m long for shortwave receivers amp 54 725MHz BNC plug VHF rubber duck antenna 135 175MHz adjustable 500hms 223mm BNC plug telescopic antenna for frequency counters 25 1300MHz BNC plug telescopic antenna for RX TX on 2m band 0 62m long 2 15dBi gain PL 259 with hinge portable 6 section telescopic whip for receiver 20KHz 1300MHz 1 3m long max BNC plug portable 5 section telescopic whip for scanner 25 2000MHz 53 5cm long max BNC plug portable 10 section telescopic whip for scanner 25 2000MHz 1 3 long max Lower mast to convert ATX mobile whips to centre loading 60 5cm long Portable 80 6m telescopic loading whip 1 5m long BNC PL 259 3 8th fitting Portable 80 6m telescopic loaded whip 1 5m long BNC fit Portable 80 6m telescopic loaded whip 1 5m long PL 259 fit Portable 80 6m telescopic loaded whip 1 5m long 3 8th fit Portable 80m whip with BNC Portable 40m whip with BNC Portable 30m whip with BNC Portable 20m whip with BNC Portable 17m whip with BNC Portable 15m whip with BNC Portable VHF airband rubber duck type flexible whip antenna with SMA plug 15cm long Portable VHF airband rubber duck type flexible whip antenna with SMA plug 35cm long Portable 12m whip with BNC 27 95
362. m radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Allin one USB inte USB interface for s Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Numerical keypad Broadband amplifier 3 30MHz AM FM SSB 3 5 or 5 15W in up to 300W out Dummy load N type socket 50 Ohm 30W max 15W continuous 0 850MHz is PEP with microphone T T T T T T le set for Icom rigs le set for Icom rigs le set for IC 718 amp IC 7410 le set for Icom IC 7800 e sel le set for Kenwood TS 480 le set for Kenwood TS 990S e sel le set For Kenwood TS 480 le set for Ten Tec Orion le set for Ten Tec Orion Il e sel ble se le set for Ten Tec Omni V le set for Ten Tec Omni VII le set for Yaesu FT 450 le set for Yaesu FT 757 le set for Yaesu FT 767 le set for Yaesu FT 7840 le set for Y
363. mote mount automatic antenna tuner Indoor outdoor use Indoor active SWL antenna 0 30 MHz Wideband active receive aerial 300KHz 200MHz set top type Outdoor active shortwave listeners antenna 0 30 MHz All mode QRM eliminator excluding active antenna All mode QRM eliminator including active antenna 1 8 54 MHz preselector for receiver transceiver Same as 1040 but without attenuator xcvr auto bypass delay or PTT Same as MFJ 1048 less RF sense PTT line bypass Passive preselector for receivers and transceivers 1 6 33MHz 100W 6 way DC outlet 269 95 41 95 339 95 389 95 649 95 729 95 111 95 67 95 169 95 184 95 189 95 129 95 99 95 129 95 149 95 38 95 AMANAAAAAAADASTDSTSGSGATGSTSTTVTV TTD TVAD TTD DAADAADAADAAAAAAATDTGTGTGVTGVRAAAASSFAVDAAADADASARVRAAAADAAADAAAAAAAAAAARAAAAAAVDAAAVAAAAAAAARAARAARAAASFSSPOQQVAQAQOC S A a A a a a a a a a a a a a a a a a a E a a a on oe a a a a a i a a a a a a a a a A a a a a a a a oe a a mn a a RR a a a A a a Ram a a a a me ne a a A a A RE A RR a ne a a a a a a a A 1112 1116 1117 1118 1124 1126 1128 1129 1142 1213 1214PC 1260 1261 1263 1273B 1273BM 1273BT 1275X 1275MX 1275TX 1279X 1279MX 1279TX 1284H 1289WD 1296 1298 1312DX 1401 1402 1412 1414 1422 1432 1434 1436 1438 1456 1516 1521 1522 1524 1526 1526N 1532N 1536 1538 1606T 1610T 1615T 1617T 1620T 1630T 16
364. mp HM 10 4 5 DUAL and Icom 8 pin round CC 1 IM Cable 4 pin XLR female for GM4 5 amp HM 10 4 5 DUAL and Icom modular CC 1 K8 Cable 4 pin XLR female for GM4 5 amp HM 10 4 5 DUAL and Kenwood 8 pin round CC 1 K4 Cable 4 pin XLR female for GM4 5 amp HM 10 4 5 DUAL and Kenwood 4 pin round CC 1 KM Cable 4 pin XLR female for GM4 5 amp HM 10 4 5 DUAL and Kenwood modular CC 1 T Cable 4 pin XLR female for GM4 5 amp HM 10 4 5 DUAL and Ten Tec 4 pin round CC 1 XLR 3 Cable 3 pin XLR plug to 3 pin XLR socket 8 long CC 1XLR 4 Cable 4 pin XLR socket to 3 pin XLR plug 1m long CC 1 X4X4 Cable 4 pin XLR plug to 4 pin XLR socket 8 long CC 1XLR 18 Cable 3 pin XLR female for Icom 8 pin round mic plug CC 1XLR K8 Cable 3 pin XLR female for Kenwood 8 pin round mic plug CC 1XLR Y8 Cable 3 pin XLR female for Yaesu 8 pin round mic plug CC 1XLR Y8BAL Cable 3 pin XLR female for Yaesu FT 950 8 pin round mic plug CC 1 Y8 Cable 4 pin XLR female for GM4 5 amp HM 10 4 5 DUAL and Yaesu 8 pin round CC 1 Y4 Cable 4 pin XLR female for GM4 5 amp HM 10 4 5 DUAL and Yaesu 4 pin round CC 1 YM Cable 4 pin XLR female for GM4 5 amp HM 10 4 5 DUAL and Yaesu modular PRO BK It All Starts With The Microphone by Bob Heil PGCS BK Practical Guide for Concert Sound by Bob Heil HHRH BK Heil Ham Radio Handbook by Bob Heil 2nd edition RC PR 781 ROAD CASE hard carry case for PR 781 AD 100 8 8 pin round mic plug to 6 pin modular mic socket adaptor CT 69 HDAT Headphone attenuator a
365. n 50MHz LFA VR yagi 4 35m long 5kW 10 63dBi gain 50MHz LFA Q yagi 4 53m long 5kW 11 38dBi gain 50MHz OP DES yagi 4 8m long Skw 11 03dBi gain 50MHz OP DES Dxpedition yagi 4 80m long 5kW dBi gain 50MHz LFA2 MAX yagi 5 80m long 5kW 11 18dBi gain 50MHz LFA2 MAX HD yagi 5 80m long 5kW dBi gain 50MHz LFA Q yagi 6 73m long 5kW 12 49dBi gain 50MHz LFA2 S yagi 6 13m long 5kW 11 39dBi gain 50MHz LFA2 M yagi 6 43m long 5kW 11 66dBi gain 50MHz LFA2 L yagi 6 83m long SkW 11 9dBi gain 50MHz OP DES yagi 7 40m long 5kW 12 33dBi gain 50MHz LFA2 HD yagi 8 9m long 5kW 12 81dBi gain 50MHz LFA Q yagi 9 44m long 5kW 13 37dBi gain 50MHz LFA2 WOS yagi 9 50m long SkW 12 90dBi gain 50MHz LFA2 WOS HD yagi 9 50m long SkW dBi gain 50MHz OP DES yagi 9 90m long 5kW 13 13dBi gain 50MHz LFA2 S yagi 11 68m long 5kW 13 40dBi gain comes in 2 boxes 50MHz OP DES yagi 12 38m long 5kW 14 02dBi gain comes in 2 boxes 50MHz LFA L yagi 12 52m long 5kW 14 05dBi gain comes in 2 boxes t 50MHz OP DES yagi 14 98m long SkW 14 45dBi gain comes in 2 boxes 50MHz LFA KW HD yagi 15 02m long 5kW 14 48dBi gain comes in 2 boxes t 50MHz LFA HZE yagi 17 67m long 5kW 15 21dBi gain comes in 2 boxes t 50MHz LFA2 BV yagi 20 50m long 5kW 15 79dBi gain comes in 2 boxes 70MHz LFA2 yagi 0 9m long SkW 6 52dBi gain rear mount 70MHz LFA Q yagi 0 5m long 5kW 6 81dBi gain rear mount 70MHz LFA2 yagi 0 55m long 5kW 6 52dBi gain 70MHz OWL yagi 0 851m long 5kw 7 69dBi gain 70MHz LFA Q yagi 1 2m
366. n XLR needs CC 1XLR gold Professional dynamic cardoid mic 600 Ohms balanced output 3 pin XLR needs CC 1XLR black Professional dynamic cardoid mic PR 22 utility version no switch 3 pin XLR needs CC 1XLR Professional dynamic cardoid mic PR 22 utility version with switch 3 pin XLR needs CC 1XLR Professional dynamic cardoid mic 600 Ohms balanced output 3 pin XLR needs CC 1XLR gold Professional dynamic cardoid mic 600 Ohms balanced output 3 pin XLR needs CC 1XLR pink Professional dynamic cardoid microphone 600 Ohms balanced 3 pin XLR needs CC 1XLR black PR22 wireless capsule PR35 wireless capsule Professional dynamic cardoid drum mic 600 Ohms balanced 3 pin XLR needs CC 1XLR Champagne dynamic cardoid large diameter mic 600 Ohms balanced 3 pin XLR needs CC 1XLR Black dynamic cardioid large diameter mic 600 Ohms balanced 3 pin XLR needs CC 1XLR PR 31 short large diaphram general use 3 pin XLR needs CC 1XLR Pro dyn cardioid Ige dia Hand mic 600 Ohms balanced cw SM 5 3 pin XLR needs CC 1XLR PR 35 switched large diaphram hand held 3 pin XLR needs CC 1XLR Professional large diameter dynamic studio microphone 3 pin XLR needs CC 1XLR CHAMPAGNE Professional large diameter dynamic studio microphone 3 pin XLR needs CC 1XLR GOLD finish Professional large diameter dynamic studio microphone 3 pin XLR needs CC 1XLR CHROME finish Professional large diameter dynamic studio mic 3 pin XLR needs CC
367. nal mode 189 95 C GP 5001 External GPS receiver improves frequency stability accuracy from 1ppm to 0 01ppm 299 95 C SM 5001D Service manual for AR 5001D 109 95 C AR 8200D AR 8200 MK111 plus APCO25 dec CTCSS dec Voice rec USB interface lead Voice inverter 569 95 C AR 8200 MKIIl Handy 530KHz 3GHz 1000mem SSB FM AM CW 389 95 C LN 4000 100 3000MHz wide band low noise pre amplifier for AR 8200 199 95 C SC 8200 Leatherette padded soft case for AR 8200 15 95 A EM 8200 External memory slot card for AR 8200 can be used for cloning was CO 8200 74 95 C VI 8200 Voice inverter slot card analogue for AR 8200 74 95 C RU 8200 Record playback slot card for AR 8200 74 95 C CT 8200 CTCSS slot card for AR 8200 94 95 C TE 8200 Tone eliminator slot card for AR 8200 use to lock out up to 256 unwanted frequencies 55 95 C CR 8200 Ready made tape lead for AR 8200 with serial numbers below 095431 55 95 C 0S 8200 ACC connector with free end lead for Scout etc for AR 8200 for serial numbers below 095431 19 95 A FA 8200 2 Replacement MW bar aerial for AR 8200 MKII 7 95 A RA 8600 Spare telescopic whip for AR 8200 1795 A RA 8200 Optional rubber aerial for AR 8200 1795 A DC 8200 Spare DC lead with cigar lighter plug for AR 8200 9 95 A CG 1500 Spare mains charger for AR 8200 3 pin UK plug 15 95 A AA8000EC Spare mains charger for AR 8200 2 pin Euro plug 15 95 A 8200 BC Spare belt clip for AR 8200 3 05 A PSU 8200 Mains power supply and charger f
368. ncoder plus control software IC 7800 MKIll HF 50MHz all mode transceiver 200W IC 7850 HF S0MHz all mode transceiver 200W 50th anniversary edition IC 7851 HF 50MHz all mode transceiver 200W IC PW1EURO Solid state HF 6m linear amplifier 1KW HM 36 Hand microphone with up down buttons for IC 7800 SM 30 Desktop microphone for IC 7800 SM 50 Dynamic desktop microphone for IC 7800 SP 34 Base station speaker large with audio filters for IC 7800 SP 33 Base station speaker CT 17 RS 232 computer interface for IC 7800 SM 7800 CD Service manual on CD for IC 7800 Ic 9100 HF 6m 2m 100W 70cm 75W 23cm 10W option DSP all mode transceiver AH 2B Antenna whip amp mount for IC 9100 AHA Automatic antenna tuner HF plus 6m for IC 9100 FL 430 6kHz 1st IF filter for HF 50MHz for IC 9100 FL 431 3kHz st IF filter for HF 50MHz for IC 9100 HM 36 Spare hand microphone with up down buttons for IC 9100 SM 30 Desktop microphone for IC 9100 SM 50 Dynamic desktop microphone for IC 9100 SP 21 Base station speaker small for IC 9100 SP 23 I Base station speaker small for C 9100 4 audio filters headphone jack CS 9100 Cloning software for IC 9100 OPC 1529R Data connection cable for PC or GPS receiver connection RS 232C type for IC 9100 UX 9100 1200MHz 23cm band unit for IC 9100 CT 17 RS 232 computer interface for IC 9100 UT 121 D STAR digital unit for IC 9100 SM 9100 Service manual on CD ROM for IC 9100 409 95 209 95 109 95 109 95 124 95 13
369. ne microphone Headset ear piece type Headset neck arm type needs VS 1L Earphone with throat mic Rubber D style earpiece Swivel belt clip Spare belt clip Swivel belt hanger Fixed type non swing belt hanger Cloning cable PC to transceiver Cloning cable for radio to PC USB cable DC cable 12 20V for BC 121N Scrambler unit inversion Scrambler unit inversion and rolling Man down unit not 5 tone Man down unit VOXIPTT unit right angled plug Programming software for IC F15 15S 25 25S Service manual for IC F15 15S 25 25S PMR VHF 136 174MHz BC 160 BC 145 BP 231MB 94 aerial PMR VHF 136 174MHz BC 160 BC 145 BP 231MB 94 aerial and keypad PMR UHF 400 470MHz BC 160 BC 145 BP 231MB 94 aerial PMR UHF 400 470MHz BC 160 BC 145 BP 231MB 94 aerial amp keypad PMR UHE 400 470MHz Li lon battery and charger Antenna etc Charger adaptor for BC 119N 121N and BP 209 210 21 1 222 Fast charger includes AD 106 amp BC 145 6 way fast charger includes 6 x AD 106 amp BC 124 UK mains PSU for BC 119N fast charger Spare AC adaptor for BC 121 Spare Desktop rapid charger Spare Li ion battery pack 7 4V 1150mAh High capacity Li ion battery pack 7 4V 2000mAh UHF antenna for 400 430MHz VHF antenna for 150 174MHz UHF antenna for 430 470MHz Spare Stubby antenna 160 174MHz Spare Stubby antenna 450 470MHz Earphone microphone screw type connector Heavy duty hand held microphone Splash proof full sized speaker microphone durable
370. ne microphone for DJ V57 needs either EDS 10 or EDS 14 54 95 ALINCO RECEIVERS EME 34A Earphone microphone for DJ V57 needs either EDS 10 or EDS 14 26 95 DX R8E All mode desktop receiver 150KHz 35MHz 13 8V 549 95 C EME 36A Earphone microphone for DJ V57 26 95 EDC 37 Spare 12V DC cable bare ends for DX R8E 6 95 A EMS 59 Speaker microphone for DJ V57 needs either EDS 10 or EDS 14 24 95 EDS 17 Front control remote kit 5m long for DX R8E 49 95 C EMS 62 Speaker microphone for DJ V57 29 95 ERW 7 USB port PC interface cable can be used for clone utility only for DX R8E 39 95 C ERW 4C PC programing cable serial port for DJ V57 needs either EDS 10 or EDS 14 39 95 DJ X11 Handheld scanner Dual VFO SSB CW AM NFM WFM 0 05 1299 99995MHz BFO not filtered 339 95 C ERW 7 PC programming cable USB port for DJ V57 needs either EDS 10 or EDS 14 39 95 WCN 3 Aerial adaptor SMA to BNC for DJ X11 4 95 A ESC 41 Soft leatherette case for DJ V57 18 95 EBP 74 Spare 1800mAh 3 7v Li lon battery pack for DJ X11 34 95 C DJ G7E 2m 70cm 23cm hand held transceiver 5 4 5 1W 530KHz 1299 995MHz receive 299 95 EDH 33 DC DC converter with cigar lighter plug 12vdc 24vdc to 6vdc for DJ X11 14 95 A EA 163 Spare antenna for DJ G7 14 95 EDH 36 Spare dry cell case 3 x AA for DJ X11 17 95 A EBC 23 Spare belt clip for DJ G7 5 95 EDS 12 Remote controller for DJ X11 24 95 A EBP 73 Spare Lithium lon battery pack 7 4V 1200mAh for DJ G7 39 95 EME 26 Curly cord earphones for DJ
371. nsceiver frame PM 110AB 10 Amp 13 5V DC power supply built in battery speaker and transceiver frame PT 1012 12 Amp 13 5V DC stabilized power supply with cigar lighter socket PT 120 20 Amp 13 5V DC stabilized power supply PC 120 20 Amp variable power supply with V A meter PL 330 20 Amp 4 30V switch mode variable power supply with V A meter 18 Amps continuous PTS 124 23 Amp 13 5V DC continuous switch mode power supply PTS 150 55A Max 13 5V DC stabilised switched mode power supply PCS 125 25 Amp variable 4 15V DC stabilized power supply V amp A meter PT 135A 35 Amp 13 5V DC stabilized power supply SP 135 35 Amp switch mode power supply PC2S 30 30 Amp variable power supply with separate V amp A meters PT 50A 50 Amp 13 5V DC stabilized power supply PS 50 M 50 Amp cont 4 15V variable switch mode power supply V A meter cigar socket HS 225 20 Amp continuous 24V DC switch mode power supply 230V R 25 2m amplifier 1 4W in 30W maximum out SSB CW FM GaAsFET pre amp RV 45 2m amplifier 3 15W in 45W maximum out SSB CW FM GaAsFET pre amp SR 100 2m amplifier 4 25W in 100W maximum out SSB CW FM GaAsFET pre amp SR 200 2m amplifier 10 50W in 200W maximum out SSB CW FM GaAsFET pre amp SR 300 2m amplifier 10 25W in 300W maximum out SSB CW FM pre amp built in psu VUR 30 2m 70cm amplifier 1 6W in 20 30W maximum out FM GaAsFET pre amp RU 20 70cm amplifier 0 8 3in15 20W maximum out SSB CW FM GaAsFET pre amp RU 45 70cm amplifier 3 15W in 45 maximum out
372. nt for handheld air vent fitting Adjustable width deluxe mobile mount for handheld Suction mount for hand held radio or phone or PDA etc to car wind screen short arm 39 95 6 95 5 95 5 95 6 95 6 95 79 95 16 95 1 99 24 95 34 95 13 95 7 95 7 95 6 95 4 95 12 95 29 95 14 95 29 95 69 95 54 95 39 95 11 95 11 95 11 95 10 95 9 95 4 95 4 95 1 99 4 95 8 95 10 95 13 95 C K T K K T T K T T T K T T K T T T K T T K K T T K T T K K T OD GG rPrErrraoarrrrrrErEESFPANQIVIESESFIADIDIDIDIDDADESEADDDDDSESESEQAQVAQVAQVAQAQIAVOINOA ee De ee ee P eo OF C ee ee E EC PC CD SP 350V Lightning surge protector 2 x SO 239 50 Ohms DC 1000MHz 400 Watts SP 350VNS Lightning surge protector 2 x N sockets 50 Ohms DC 3000MHz 400 Watts FUSE 35 Replacement fuse for SP 350V VNS WHB 1 Belt clip quick release non slip WML 2 8 pin modular mic plug for Kenwood Icom Yaesu Alinco 1 5m to open end WPG 5 6 pin mini din data lead for Kenwood and Yaesu rigs 1 5m long to open end WSC 3 Soft case clips over or through trouser belt for small radios or phones WATSON RECEIVERS BLACK BOX MKII Air band monitor nearfield receiver VHF 118 137MHz now with switchable audio filter W SDRX1 Al mode Communications Receiver 100KHz 2GHz USB powered 2 SMA antenna connections WATSON FREQUENCY COUNTERS VAA 1 Vector antenna analyser 0 5 60MHz Rechargeable battery USB cable RF HUNTER RF sign
373. ntrol program software for TH D72E free download from www kenwoodusa com TH F7ET 2m 70cms handheld with wideband receive Listed 259 95 PB 42L Spare Lithium lon rechargeable battery 7 5V 1550mAh for TH F7E BT 13 Dry cell case 4 x AA for TH F7E EMC 3 Clip microphone with earpiece for TH F7E EMC 6 Clip microphone with D type earpiece EMC 12 Clip microphone with D type earpiece was EMC 6 HMC 3 Headset boom mic VOX PTT for TH F7E KHS 21 Headset boom mic less VOX for TH F7E SMC 32 Speaker mic for TH F7E KHS 29F Boom microphone with D type earpiece and PTT for TH F7E was KHS 28F SMC 34 Speaker mic with 3 functions and volume control for TH F7E PG 2W DC cable open end for TH F7E PG 3J Cigar cable with filter for TH F7E PG 4Y PC interface cable D Sub 9 pin for TH F7E KCT 53U Serial to USB adaptor with drivers SC 52 Real leather case for TH F7E 90 0789 05 Spare rubber duck aerial for TH F7E W08 0929 15 Spare charger for TH F7E UK 3 pin plug W08 0928 15 Spare charger for TH F7E EU 2 pin plug W08 0440 05 Charger for TH G71E EU 2 pin plug K29 9107 22 Spare keypad membrane for TH F7E 29 0623 14 Spare belt clip for TH F7E B09 0615 23 Spare rubber cover for DC and speaker socket for TH F7E 69 0366 15 Spare lanyard for TH F7E TH K20EE 2m FM 5 5W portable transceiver c w Li ion batterykeypad charger TH K40EE 70cm FM 5W portable transceiver c w Li ion battery keypad charger KSC 35ST Spare rapid charger for KNB 63L and TH K20 40ET 3 pin UK plug K
374. o band 15m HF dipole for portable fixed station use 400W CW 1 1 balun SO 239 7 04m long 45 95 MD 12HP Mono band 12m HF dipole for portable fixed station use 400W CW 1 1 balun SO 239 5 77m long 45 95 MD 10HP Mono band 10m HF dipole for portable fixed station use 400W CW 1 1 balun SO 239 5 07m long 45 95 MAG 1 Magitenna 40 6m portable fixed station antenna 59 95 MV 6HP 6 band mobile aerial with special marching unit PL 259 3m tall 1kW 30 20 17 15 12 10m others with ATU 124 95 1 4 BALUN 400 Watts 1 8 30MHz 33 95 4 1 BALUN 400 Watts 1 8 30MHz balun 300 Ohm to 50 Ohm 33 95 9 1 UNUN 400 Watts 1 8 30MHz unbalanced to unbalanced current transformer 33 95 4 1 BALUN 1 5 1 5KW 1 8 30MHz balun 54 95 1 4 BALUN 1 5 1 5KW 1 8 30MHz balun 54 95 MAGI TUNER A Tuner for random wire 400W CW 550W PEP ok for marine 8m wire 40 6m 10m wire 80m and up 33 95 MAGI TUNER B Tuner for 1 2 or 5 8ths wave CB type antennas gives multiband use on HF amateur bands 2 x SO 239 33 95 W LINE 1 4 line isolator 400W 1 8 30MHz 33 95 HFC 3015V Multiband HF colinear 1 7m tall 30 15 12 10 with auto ATU 40 20 17 with extemal ATU 300W SO 239 69 95 CV 2 SO Duplexer 2m 70cm 3 x SO 239 24 95 CV 2 N Duplexer 2m 70cm 3 x N 24 95 LN AMP PL Low noise VHF pre amplifier mast head or in shack 35 400MHz 20dB gain can handle 60W through PL 259 39 95 LN AMP N Low noise VHF pre amplifier mast head or in shack 35 400MHz 20dB gain can handle 60W through N 39 95 MD 10HP Mono band 10
375. obile marine transceiver Marine base station with fist microphone and 230V power supply Desk microphone Transceiver fixed DSC VHF with fist microphone amp mounting kit Spare hand microphone for IC M401 Flush mount kit for the IC M401 Euro Flush mount kit for the DS 100 Cloning cable PC to transceiver Cloning cable for radio to PC USB cable Cloning cable adaptor needs OPC 478 Compatibility cable allows compatibility with DS 100 001 Mobile speaker 4W 8 Ohms External speaker Programming software dealers only Service manual on CD ROM for IC M401 Combined VHF DSC waterproof fixed mount Combined VHF DSC waterproof fixed mount with GPS antenna Flush mount kit for the IC M401 Euro Cloning cable PC to transceiver Cloning cable for radio to PC USB cable Antenna floating cable GPS antenna Programming software dealers only Service manual on CD ROM for IC M411 ransceiver fixed DSC VHF with HM 126B fist microphone black ransceiver fixed DSC VHF with HM 126B fist microphone grey ransceiver fixed DSC VHF with HM 126B fist microphone GPS black ransceiver fixed DSC VHF with HM 126B fist microphone GPS grey ransceiver fixed DSC VHF with HM 162 fist microphone black ransceiver fixed DSC VHF with HM 162 fist microphone grey ransceiver fixed DSC VHF with HM 162 fist microphone GPS black ransceiver fixed DSC VHF with HM 162 fist microphone GPS grey ransceiver fixed DSC VHF with HM 126B fist microphone AIS black ransceiver fixed DSC VHF with HM 1
376. of you travelling by car A question that you may well ask yourself before you spend your hard earned cash is Where does the equipment we sell come from Well we are either the official UK importer of the equipment we stock or appointed authorised distributors giving you full confidence in our after sales service when buying from us We have full time engineers here to help you who else can say that We stock a wide range of free leaflets on most of the items in our price list please contact us for these and we will be happy to send them to you Do not worry about asking for the information you need A stamped self addressed envelope is a help to us Technical staff are on hand so if you need any help or advice feel free to contact them Many of our customers come to us because we offer them a complete service Many advertisers will sell you a radio if you want one but try and get some leaflets or other impartial advice and you will come away thinking that you must have asked them for the Crown Jewels Too many of our customers have told us horror stories of the time that they purchased goods from another firm only to find that when they needed help on how to use the radio the firm either could not help or had gone bust The message is clear buy your goods from a firm that will still be there when you need them We do not expect our goods to develop faults but if they do we guarantee to sort matters out to your complete satisfaction Our prices
377. ol or professional options Upgrade Code300 32 to Code300 32P we require customers old dongle Update of older versions of CODE300 32 to 3 05 version Mobile antenna and mount HS 1800Pro 2 6 60MHz 1kW grey Whip quick disconnect Complete home base antenna package HS 1800Pro 2 6 60MHz 1kW black Complete home base antenna package HS 1800Pro 2 6 60MHz 1kW grey Control box for Icom transceivers such as IC 703 706 7 18 736 746 756 765 775 Control box for Kenwood 100W transceivers such as TS 480SAT Control box for Kenwood TS 480HX 200W transceiver 160m adaptor coil for use with HS 1800 antenna amp standard 6ft whip RV extension mast black 2 long with coupler for HS 1800 or sidekick 2 x 2 Universal Mounting bracket for use with HS 201C 1 25 x 1 25 Universal mounting bracket for use with HS 201C Standard control box for 1800 PRO antenna Solid aluminium universal adapter stand for most horizontal surfaces 18 tall Master mobile stainless quick disconnect Saddle with 3 HS ground strap Small capacity hat equivalent to 1 5 feet of whip black to match sidekick Stake hole mount black stainless steel for 3 8ths antenna 3 foot whip stainless steel black HORA TRANSCEIVER amp ACCESSORIES LC 408 RBP 120 LC 150S BCH 150 HUSTLER AERIALS 6 BTV 5 BTV 4 BTV G6 270R 30 MTK 4457 1 4098 1 4082 1 RM 10 RM 11 RM 12 RM 15 RM 17 RM 20 RM 30 RM 35 RM 40 RM 50 RM 60 RM 80 RM 10 S RM 11 S RM 15 S RM 20 S RM 40 S RM 80 S
378. one with up down buttons for IC 7100 needs OPC 589 Light weight hand microphone 600 Ohm for IC 7100 Remote control microphone for IC 7100 No DTMF Hand microphone for IC 7100 with DTMF Hand microphone for IC 7100 with DTMF keypad up down buttons Spare hand microphone for IC 7100 NVIS kit fiberglass mobile mounting antenna element for use with AH 740 RC 28 plus RS BA1 IP remote encoder plus control software for IC 7100 Mobile mounting bracket for IC 7100 main unit Mobile mounting base for IC 7100 controller needs MBA 1 Mobile mounting bracket for IC 7100 controller Cloning software for IC 7100 RS 232 Cl V converter computer interface for IC 7100 Spare separation cable 3 5m for IC 7100 Separation cable 5m for IC 7100 Control cable adaptor for AH 740 Microphone adaptor cable for IC 7100 Adapter cable converts 13 pin acc connector to 7 pin 8 pin acc connectors for IC PW1EURO amp IC 7100 Data connection cable for PC or GPS receiver connection RS 232C type for IC 7100 Data cable for DV mode data 1 jack to USB cable for IC 7100 Replacement 12 v DC lead for IC 7100 RC 28 plus RS BA1 IP remote encoder plus control software for IC 7100 Antenna whip amp mount for IC 7000 Automatic antenna tuner HF plus 6m for IC 7000 Automatic ATU for IC 7000 Mobile mounting bracket for IC 7000 main unit Front panel mounting bracket for IC 7000 Carrying handle for IC 7000 Mobile mount kit MB 62 MB 105 OPC 1
379. ong whip PL 259 2m 70cm dualband 50W 2 15 4 5dBi 67cm long whip PL 259 2m 70cm dualband 50W 2 15 4 9dBi 75cm long whip PL 259 2m 70cm dualband 50W 2 15 4 9dBi 75cm long whip with built in spring PL 259 2m 70cm dualband 50W 2 15 4 9dBi 75cm long whip PL 259 2m 70cm dualband 50W 2 15 5 5dBi 95cm long whip PL 259 2m 70cm 23cm triband 50W 0 3 8 7 2dBi 57cm long PL 259 2m 70cm dualband 50W 0 3 8dBi 47cm long whip 50W N type 2m 70cm dualband 50W 2 15dBi 5 5dBi 92cm long PL 259 2m 70cm dualband 50W 2 15 5 5dBi 95cm long whip N type 6m 2m 70cm triband 50W 0 2 15dBi 5 5dBi 95cm long PL 259 11m 200W 1 4 wave whip 26 28MHz 1 65m long PL 259 2m 70cm 100W 29cm long PL 259 1 4 wave on 2m and 1 2 wave on 70cm 10m 6m 2m 70cm 2 15dBi 144mHz 5 5dBi 430mHz 60W FM 1 26m long PL 259 Mobile antenna system 7 14 21 28 50 144 430MHz 200W 120W 7 28MHz 1 9m PL 259 10 14MHz add on element for HV 7CX 1 8 to 54MHz 500W 2 1m long 2 8ths conn with cable and solid base for bumper mounting 144MHz 170MHz mobile antenna PL 259 2m whip 150W 4 1 dB gain 1 41m long PL 259 6m 2m dualbander 2m 3 4dB 5 8 6m 2 15dBi 1 4 wave 200W 1 32m long PL 259 2m 2 x 5 8th 6 5dB gain 100W 2 46m long PL 259 2m 2 x 5 8th 6 5dB gain 280W 2 46m long PL 259 2m 1 4 wave 70cm 1 2 wave 100W 0 67m long DSTAR AM FM PL 259 2m 70cm dualband 200W 2 15 5 5 dB gain 200W 1 02m long PL 259 2m 70cm dualband 200W 2 15 5 5 dB gain 200W 1 02m long PL 259 black whip 2m 70cm dualband 200W 2 15 5 5 dB gain 2
380. ontrol for MFJ 4714 6 position desk remote antenna switch 1 8 150MHz Remote control for MFJ 4716 4 position desk remote antenna transceiver switch 1 8 150MHz Remote control for MFJ 4724 6 position desk remote antenna switch 1 8 150MHz Remote control for MFJ 4726 Pocket sized portable function generator Professional function generator Portable signal tracer injector PK 232 to Yaesu R handhelds PK 232 to Alinco Standard handhelds KAM to Alinco Standard handhelds MFJ to Icom Yaesu Alinco hand helds PK 232 to Icom Yaesu Alinco handhelds KAM to Icom Yaesu Alinco handhelds PK 232 to Kenwood handhelds KAM to Kenwood handhelds MFJ PK to Kenwood Yeasu VHF 6 pin mini din KAM to Kenwood Yeasu HF 6 pin mini din KPC 9612 to Kenwood Yeasu VHF 6 pin mini din FJ PK to Icom HF 8 pin din JPK to Icom HF 8 pin din PC 9612 to Icom HF 8 pin din PC 9612 to Icom HF 8 pin din FJ PK to Icom IC 706 13 pin din KAM HF to Icom 13 pin din accessory plug KAM to Icom IC 706 13 pin din MFJ PK to Kenwood HF 13 pin din MFJ packet to Yaesu 8 pin radios PK 232 to Yaesu 8 pin radios KAM HF port to Yaesu 8 pin radios KAM VHF port to Yaesu 8 pin radios MFJ Paccomm other TNC 2 to Yaesu 8 pin modular PK 232 to Yaesu 8 pin modular MFJ packet to Icom 8 pin radios MFJ Paccomm other TNC 2 to Icom 8 pin modular PK232 to Icom 8 pin modular KAM VHF port KPC3 KPC9612 to Icom 8 pin modular PK 232 to Icom 8 pin radios KAM VHF port to Icom
381. ophone SP 30 Mobile extension speaker 20W rated input power 30W max 4 inch diameter SP 35L Mobile speaker 6m cable MBF 1 Mobile mounting bracket suction cup type for controller of IC 2730E needs MBA 2 MBF 4 Mobile mounting bracket for main unit of IC 2730E MBA 4 Combination bracket for attaching the controller to the main unit of IC 2730E MBA 5 Controller bracket for use with MBF 1 OPC 1156 Controller extension cable 3 5m with joiner OPC 440 Microphone extension cables 5m OPC 474 Cloning cable set to set OPC 478UC Cloning cable for radio to PC USB cable OPC 589 Microphone adaptor cable 8 pin round to modular socket OPC 647 Microphone extension cable 2 5m for ID 5100E CS 2730 PC programming software free download UT 133 Bluetooth unit VS 3 I Bluetooth headset IC E2820 Accessories UT 123 GPS embedded DSTAR unit CS 2820 Cloning software for IC E2820 OPC 478 Cloning cable computor to radio OPC 478UC Cloning cable for radio to PC USB cable OPC 1529R Data connection cable PC GPS RS 232 type HM 133 Remote control microphone HM 154 Mobile hand microphone OPC 347 DC power cable 7m OPC 1132 DC power cable 3m OPC 1663 Front panel separation cable 3 4m standard OPC 440 Microphone extension cables 5m OPC 441 Speaker extension cable OPC 589 Microphone adaptor cable 8 pin round to modular socket SP 10 Mobile speaker 5W 40hms OPC 1712 Separation cable 10cm standard SM E2820 Service manual on CD for IC E2820 IC 2200H Acce
382. opic fibreglass mast 25ft heavy duty telescopic fibreglass mast 34ft heavy duty telescopic fibreglass mast 43ft heavy duty telescopic fibreglass mast Portable antenna stand 6 feet tall Heavy duty portable antenna tripod Yaesu ATAS controller for most transceivers Yaesu ATAS controller for IC 706 amp IC 7000 Automatic digital screwdriver controller Icom All brand ground radial set for vertical antennas 8 x 14 feet Ground rod 3 8ths inch diameter 4 feet long copper plated steel 8 feet telescopic whip with 3 8ths stub mount 72 mobile whip 3 8th base The ultimate portable HF vertical antenna kit 11 section aluminium telescopic pole 63 extended 7 collapsed 108 mobile whip 3 8th base Extra long stainless steel telescopic whip 12 feet long was MFJ 1954 16 9 foot long telescopic whip 3 8ths base Wire dipole for 40 20 10 6m 300W 66 feet long Wire dipole for 40 20 10 6m 1500W Wire dipole for 30 amp 60m 300W 86 feet long Wire dipole for 40 amp 80m 1500W 122 feet long Wire dipole for 80 amp 160m 1500W 240 feet long Mini dipole for 6m Mini dipole for 10m Mini dipole for 15m Mini dipole for 17m Mini dipole for 20m Mini dipole for 30m Mini dipole for 40m Mini dipole for 75m Portable 7 55MHz vertical telescopic whip antenna lightweight 1 KW over 18 long when extended Portable 7 55MHz vertical telescopic whip antenna lightweight 1KW over 34 span HF mini stick for 6m 3 8ths stud HF mini stick for 10m 3 8ths stud
383. or AR 8200 25 95 A 8200 LAN Spare lanyard for AR 8200 1 95 A 20 1030 DC plug and cable no fuse for AR 8200 3 95 A SM 8200 1 Service manual for AR 8200 mark 1 24 95 A SM 8200 2 Service manual for AR 8200 mark 2 on CD ROM 19 95 A M 8200 3 Service manual for AR 8200 mark 3 24 95 A OP 8200 Spare operating manual for all versions of AR 8200 7 95 A MI 8200 Multi interface cable for AR 8200 with serial nos above 095431 replaces 8200 USB amp CR 8200 119 95 A 8200 USB Computer lead level shift for AR 8200 USB for serial numbers below 095431 99 95 C 8200 PC Computer lead level shift for AR 8200 9 pin D type serial port for serial numbers below 095431 79 95 C AOR SAMPLER PC windows software on CD ROM for 8200 4 95 A BC 8200 Replacement battery compartment cover for AR 8200MKIlI 5 95 A AR MINI Handheld receiver List price 225 00 149 95 C WCN 3 Adaptor SMA plug to BNC socket for AR MINI 4 95 A SC MINI Leatherette case for AR MINI 11 95 A PC MINI USB PC lead for AR MINI free software from AOR web site 59 95 C DC MINI Cigar lighter DC lead with voltage converter for AR MINI 28 95 A CO MINI Data clone lead for AR MINI 9 95 A AA MINI Spare AC charger for AR MINI 26 95 A SM MINI Service manual for AR MINI 24 95 A OP AR MINI Spare operating manual for AR MINI 7 95 A AR 8600MKII Mobile desk top allmode scanner with 12v lead needs PSU 8600 for AC 530KHz 3GHz 569 95 D MF 4 Collins mechanical filter AM narrow 4 0KHz fo
384. or Icom Yaesu Kenwood Alinco 8 pin modulars Pre wired ICOM transceiver to computer interface cable Pre wired KENWOOD transceiver to computer interface cable Pre wired YAESU transceiver to computer interface cable 6 pin 3 5mm extension cord with adaptor kits Kenwood adaptor cable for MFJ 393 8 pin round Yaesu adaptor cable for MFJ 393 8 pin round Icom adaptor cable for MFJ 393 8 pin modular Kenwood adaptor cable for MFJ 393 8 pin modular Icom adaptor cable for MFJ 393 8 pin modular Pre wired lead from MFJ 396 to Icom Pre wired lead from MFJ 396 to Kenwood Microphone lead between MFJ 297 299 amp Kenwood 8 pin round Microphone lead between MFJ 297 amp Yaesu 8 pin round Mic lead MFJ 299 amp Icom Kenwood Yaesu MFJ 297 Icom amp Kenwood 8 pin mod Microphone lead between MFJ 297 amp Yaesu 8 pin modular Lead 8 pin round to 8 pin modular for MFJ 1263 Microphone lead between MFJ 299 amp Yaesu 8 pin round 5 pin din mic plug for MFJ transceiver 8 pin round mic plug to Yaesu FT 847 DB 9 female to DB 9 female cable 9 pin serial port to MFJ 493 6 feet long RS 232 cable DB 25M 25F 6 feet long RS 232 cable DB 25M 9F 6 feet long RS 232 Y cable Soundcard extension box with 5 cable Cable adaptor USB to parallel printer DB25F Cable adaptor USB to parallel printer Cen36 cable adaptor converts RS 232 to USB cable 12 V DC cigarette lighter cable for MFJ accessories bare ends 12 V DC cigarette lighter cable for MFJ accessories with cigar plug fitted DC cable
385. or K2 Transceiver K160RX 160m Option for K2 Transceiver K60XV 60m and transverter interface option for K2 KNB2 Noise blanker option for K2 Transceiver KDSP2 DSP Option for K2 Transceiver KAF2 Audio filter option for K2 Transceiver KAT2 Internal 20W ATU for K2 KPCA F Spare Power Cable 5ft long for K2 Transceiver NOZ RS 232 serial interface for K2 KUSB USB Adaptor for the K2 Transceiver KBT2 Internal battery kit for K2 KBT2 X KBT2 without battery for K2 BATT Replacement internal battery for K2 KAT100 1 External 100W ATU for K2 KAT100 2 100W ATU with EC2 panels for K2 must also order EC2 KAT 00PNL Converts KAT100 1 to 2 EC2 Blank project enclosure ETS15 1 5 tilt stand for EC2 KAT100 ETS2 Standard 3 tilt stand for EC2 MH2 Hand Microphone with microphone hanger clip for the K2 Transceiver PRO SET K2 Large dual headphones boom microphone for Elecraft K2 with AD 1 K8 K1 2 2 band 5W CW transceiver 20 amp 40m other bands available 15 17 30 80m KAT Internal 20W ATU for K1 K1BKLTKIT X KALCD backlight mod kit for unbuilt K1 s KBT1 Internal battery adapter for K1 KNB1 Noise blanker for K1 KX1 Ultra portable 20 amp 40m CW transceiver kit KXB3080 30 80m adaptor for KX1 KXAT1 Internal ATU for KX1 KXPD1 Plug in keyer paddle for KX 1 KXPD1 K2 Mounting bracket also attaches to KXPD1 to the K2 tilt ball BNC BP Adaptor BNC male to stackable binding posts Sames as MFJ 7704 ELECRAFT MINI MODULE KITS 2T GEN 2 tone test g
386. or VAC 370U 3 pin UK Spare power supply for VAC 370C 2 pin EU Headset cable for VXA 300 was CT 96 YAESU MARINE PLOTTERS ETC CPN 10101 8003043 8003048 UX0GPL51SD 8003042 8003044 790101553 XUCMP0052 ACVC10 VGAC10 ACAC10 CPN 7001 8003046 8003048 UXOGPL51SD 8003045 8003044 790101553 XUCMP0052 ACVC10 ACAC10 Multimedia Chart Plotter 10 screen built in Wi Fi Windows media player External bracket for CPN 10101 External bracket knob for CPN 10101 50 channel GPS antenna for CPN 10101 Dust cover for CPN 10101 Flush mounting bracket for CPN 10101 Power and ACC1 2 cable for CPN 10101 2 Amp fuse and holder for CPN 10101 DVD or VCR adaptor cable for CPN 10101 VGA adaptor cable for CPN 10101 Audio output cable for CPN 10101 Multimedia Chart Plotter 800 x 480 screen built in Wi Fi Windows media player External bracket for CPN 700I External bracket knob for CPN 7001 50 channel GPS antenna for CPN 10101 Dust cover for CPN 7001 Flush mounting bracket for CPN 7001 Power and ACC1 2 cable for CPN 10101 2 Amp fuse and holder for CPN 10101 DVD or VCR adaptor cable for CPN 10101 Audio output cable for CPN 1010 23 95 61 95 23 95 22 95 37 95 12 95 4 95 209 95 209 95 28 95 33 95 51 95 61 95 28 95 25 95 28 95 9 95 21 95 31 95 284 95 23 95 61 95 109 95 23 95 22 95 37 95 12 95 4 95 364 95 57 95 41 95 28 95 25 95 4 95 27 95
387. or VX 924 MDC1200 GE STAR ANI encoder only unit for VX 924 MDC1200 GE STAR ANI encoder decoder unit for VX 924 Leather case and swivel belt clip fo r VX 924 Leather case with belt loop and key cut out for VX 924 Leather case with swivel belt clip and key cut out for VX 924 Radio to radio cloning cable for VX 924 RS 232 DB9 programming cable kit CT 29 amp CT 115 for VX 924 USB interface adaptor for use with CT 108 Programming cable connects to FIF 10A for VX 924 Programming software for VX 924 Antenna connector adaptor SMA BI NC for VX 924 Mobile transceiver 8ch VHF 134 174MHz display Mobile transceiver 8ch UHF 400 470MHz display Mobile transceiver 128ch VHF 134 174MHz display mobile transceiver 128ch UHE 400 470MHz display Hand microphone for VX 2100 2200 Keypad microphone for VX 2100 2200 Heavy duty noise cancelling microphone for VX 2100 2200 Desktop microphone for VX2100 2200 High Power external speaker for VX 2100 2200 High power external mobile type speaker fro VX 2100 2200 Mobile mounting bracket for VX 2100 2200 Screw for VX 2100 MM 2 needed LF 1 line filter DC DTMF paging and encryption for VX 2100 2200 Rolling code encryption unit for VX 2100 2200 19 95 16 95 29 95 17 95 17 95 47 95 47 95 219 95 219 95 324 95 324 95 22 95 22 95 24 95 43 95 19 95 16 95 50 95 21 95 31 95 284 95 61 95 109 95 18 95 24 95 18
388. or long wire aerials etc per metre 0 40 100m drum PVC covered multui stranded flexweave copper wire PVC covered multi stranded flexweave copper wire per meter 100m drum Adonis 8 core microphone cable per meter Adonis 8 core micr ophone cable 5mm single cable cleats for fastening RG 58 to walls etc 25pc packs 5mm twin cable sa ddle for fastening 2 x RG 58 to walls etc 25pc packs 10mm single cable cleats for fastening RG 213 to walls etc 25pc packs 10mm twin cable si addle for fastening 2 x RG 213 to walls etc 25pc packs ie wrap 100mm x 2 5mm black pack of 50 ie wrap 160mm x 2 5mm black pack of 50 ie wrap 200mm x 3 6mm black pack of 50 ie wrap 160mm x 4 8mm black pack of 50 ie wrap 300mm x 4 8mm black pack of 50 ie wrap 370mm x 7 8mm black pack of 50 ie wrap 100mm x 2 5mm natural white pack of 50 ie wrap 160mm x 2 5mm natural white pack of 50 ie wrap 200mm x 3 6mm natural white pack of 50 ie wrap 160mm x 4 8mm natural white pack of 50 ie wrap 300mm x 4 8mm natural white pack of 50 ie wrap 370mm x 7 8mm natural white pack of 50 7 5KV ceramic door knob capacitor 100pf CITIZEN BAND RADIOS AND ACCESSORIES PRESIDENT GRANT II CB Transceiver MINOR MINOR PLUS Mobile UK 40 channels 4 Watts FM Mobile 80 channel CB transceiver 4 Watts FM 12 24V PRESIDENT WALKER Citizens band transceiver AE 2990AFS AE 485S AE 6690 FA 5000 ALAN 42 MULTI SWR 125 B33 ANTRON 99 SIRIO 827 HF 360 GAIN MASTE
389. or needs 6 core cable 379 95 G 450C YAESU rotator needs 6 core cable 339 95 G 5500 YAESU Az EI rotator 1400 kg cm needs 2 x 6 core cables 629 95 G 550 YAESU elevation rotator 1000 kg cm needs 6 core cable 319 95 GC 038G YAESU lower mast clamps green 29 95 GC 038B YAESU lower mast clamps brown 29 95 GC 048 YAESU mast clamp for G 2800SDX 44 95 GS 050 YAESU light weight alignment bearing 36 95 GS 065 YAESU medium weight alignment bearing 54 95 GS 680U YAESU stay bearing heavy duty 89 95 GA 3000 YAESU heavy duty tower mounted shock absorber joint 99 95 GL 33 YAESU mast adjustment plate 8 95 25M WP 25m cable kit for Yaesu rotators 59 95 40M WP 40m cable kit for Yaesu rotators 99 95 ROT PLUG Plug kit for Yaesu rotators contains plug for rotator amp plug for controller 7 pin 17 95 ROT PLUG HD Plug kit for Yaesu rotators contains plug for rotator amp plug for controller 7 pin black heavy duty 27 95 8000534 Plug only for old style rotators SDX series 6 pin 20 95 GA 2500 YAESU tower mounted shock absorber Joint for G 450 650 800 56 95 C 1000 SDX ROTOR Interface Cable 19 95 GS 232B YAESU rotator interface for G 1000DXC amp G 5500 499 95 W AZEL Changes your beam antenna from horizontal to vertical or gives elevation 199 95 RPF COMMUNICATIONS TS 062 813 11 15 Microphone cable for Icom Kenwood modular RJ 45 1 5m long 9 95 TS 062 814 11 15 Microphone cable for Yaesu modular RJ 11 1 5m long FT 1500 1802E 2800 7
390. ote kit for SR 2200 499 95 C CR 5000 Tape recorder lead for SR 2200 21 95 A 8 MINI ACC1 8 pin connector for SR 2200 2 95 A 8LMINI ACC1 8 pin connector with free end lead for SR 2200 6 95 A DC 5500 12v DC lead for SR 2200 5 95 A USB AB USB PC lead type A to B 2m long for SR 2200 11 95 A 5000 PC 9 RS232 lead from AR 5000 to PC 9 way connector 11 95 A SM SR2200 Service manual for SR 2200 printed 19 95 A SM SR2200 CD Service manual for SR 2200 on CD ROM 19 95 A AR ALPHA Receiver DSP spectrum display TV 10KHz 3 3GHz 12v PSU extra 6 295 95 D AR IQ USB hardware key dongle forl Q software can run on any PC with this dongle plugged init 499 95 C PSU ALPHA AR 2300 AR IQ2 1Q 5001 APCO P25 GP 5001 RL 2300 M AR2300 R 2000PC RUB SB AB C 5600 SU 5500 AA 7000 EU SM 5600 P 5600 R STV VOICE gt BO F 300 F 500 F 4 F 6 5000 S 8000 R 5000 MINI 8LMINI 5000 PC 9 DC 3000 AA 5000 UK AA 5000 EU SM 5000 SM 5000A CEEE gopa OR ACCESSORIES FOR AR 5000 AC adaptor for AR ALPHA DSP black box receiver 40KHz 3150MHz with DC lead amp PC software 240V PSU extra USB hardware key dongle for UO software can run on any PC with this dongle plugged in it IQ option internal board with software for record playback for AR 2300 APCO 25 option internal board for AR 2300 for P25 decoding conventional mode External GPS receiver improves frequency stability accur
391. ouble Key Standard vibrokeyer plus straight key black base V DG O SK Double Gold original bug key plus straight key gold V DG O VK Double Gold original bug key plus Vibrokeyer gold V DG O 0I Double Gold original bug key plus lambic paddle V DD O SK Double Deluxe original bug key plus straight key deluxe V DD O VK Double Deluxe original bug key plus Vibrokeyer deluxe V DD O Ol Double Deluxe original bug key plus lambic paddle deluxe V TG O SKIVK Triple Gold original bug key plus straight key plus Vibrokeyer gold base V TG O SKII Triple Gold original bug key plus straight key plus lambic paddle gold base V TD O SKIVK Triple Deluxe original bug key plus straight key plus Vibrokeyer deluxe V TG O SKII Triple Deluxe original bug key plus straight key plus lambic paddle deluxe W2IYH AUDIO PROCESSING W2 IPLUS iPlus single controller to route your external audio to 3 radios W2 EQPLUS EQplus audio Compressor with speech processor and downward expander W2 EDGE 8 band audio equaliser and noise gate for any microphone W2 DUO Dual band audio equaliser and noise gate W2 IBOX Variable attenuator and interface box audio devices and so much more to your radio equipment W2 IC8 Lead for W2 EDGE and Icom 8 pin round IC 718 735 W2 IBMC Lead for W2 EDGE and Icom 8 pin din balanced mod cable for IC 756 We2 IM Lead for W2 EDGE and Icom modular IC 706 etc W2 IMO com modular to 8 pin mic adaptor W2 K8 Lead for W2 EDGE and Kenwood 8 pin round
392. p and office hours are 9am to 5 30pm Monday to Saturday inclusive We only close Sundays amp Bank Holidays We accept Cheques for any amount as long as you put a cheque guarantee card number and the expiry date on the back of them Goods so ordered will not be delayed as we use the Transax checking system Cash amp Postal Orders send by special delivery are also accepted as are Mastercard Visa Solo Delta Maestro Electron JCB Fortoak and American Express Maestro customers please let us have the issue number as well as the Maestro card number and the start date and expiry date of your card Sorry no Electron cards by mail order For our customers who require credit we offer a variety of agreements including Buy Now Pay Later on items over 250 00 Please contact us to discuss your requirements Also available are gift vouchers for any amount These are ideal as presents prizes and incentives There is no time limit imposed on using them Gift vouchers can only be used to purchase goods and services from our company There is no extra charge for the voucher when it is purchased or on redemption However no change can be given when spending the vouchers We charge posting and packaging at cost and try to keep these charges to a minimum We also take into account security and our postage charges do include insurance in case the parcel is lost or damaged In transit Peace of mind is therefore guaranteed when you buy from Waters amp Stanton
393. pare battery charger for IC R6 Charger stand for use with IC R6 and BC 07 or CP 18L Cigarette lighter cable for IC R6 Earphone for IC R6 Acoustic tube earphone with clothing clip Earpiece for IC R6 Communications headphones for IC R6 Cloning cable radio to radio for IC R6 Cloning cable for radio to PC RS 232C for IC R6 Cloning cable for radio to PC USB cable for IC R6 Antenna connector adaptor SMA plug to BNC socket for IC R6 Cloning software for IC R6 needs OPC 478 CI V level converter RS 232 computer interface for IC R6 Spare Flexible aerial for IC R6 ACCESSORIES FOR IC R3 BC 07 BC 135 CP 18E BP 206 LC 151 OPC 474 OPC 478 SP 13 CS R3 SM R3 FA BO4RE 0001 Spare Lithium battery charger for IC R3 Desktop rapid charger for IC R3 Cigarette lighter cable for IC R3 Spare Ll ion battery pack 3 7V 1600mAh for IC R3 Leatherette case for IC R3 Cloning cable for radio to radio for IC R3 Cloning cable for radio to PC for IC R3 Earphone for IC R3 Cloning software for IC R3 Service manual for IC R3 Spare aerial for IC R3 ACCESSORIES FOR IC RX7 BC 07 BP 244 BP 262 EARPIECE 003 HP 4 LC 170 CP 18E OPC 474 OPC 478 OPC 478UC AD 92SMA CS RX7 CT 17 FA S270C MB 112G IC R20 BC 07 BP 206 CP 18E LC 158 MB 86 MB 98 Spare lithium battery charger for IC RX7 Spare 3 7V 1100mAh Li lon battery for C RX7 Dry cell case 3 x AA not supplied for IC RX7 Earpiece for C RX7 Communications headphones for C RX7
394. peaker 2 inputs 6 selectable high low filters 5W 8 Ohms for TS 990S 219 95 KES 3 Mobile speaker for TS 990S replaces SP 50B 29 95 HS 5W Deluxe large over the head headphones for TS 990S 56 95 HS 6 Medium sixe on the ear headphones for TS 990S 38 95 ARCP 990 0 ARHP 990 nternet radio host program for TS 990S free download from www kenwoodusa com 0 ARUA 10V2 00 USB audio controller program for TS 990S free download from www kenwoodusa com 0 TS 590SG HF amp 6m 100W transceiver DSP auto ATU 12V USB 1 199 95 ARCP 590 Radio control program for TS 590S free download from www kenwoodusa com 0 ARHP 590 nternet radio host program for TS 590S free download from www kenwoodusa com 0 SP 23 K Base speaker for TS 590S 74 95 KES 3 Mobile speaker for TS 590S 9replaces SP 50B 29 95 HS 5 Deluxe headphones for TS 590S 56 95 HS 6 Ultra light headphones for TS 590S 38 95 MC 43S Spare dynamic hand microphone with Up down 8 pin plug for TS 590S 20 95 MC 60A Dual impedance desk microphone internal pre amplifier for TS 590S 127 95 MC 47 Hand mic with 4 programmable buttons for TS 590S 42 95 MC 90 Desk microphone for DSP transceivers for TS 590S 204 95 MB 430M2 Mobile mounting bracket for TS 590S 21 95 PG 20 DC cable 7m long for TS 590S 38 95 PS 60 Regulated matching power supply 22 5 Amps 13 8 Volts for TS 590S 329 95 0 3 K Superior stability TCXO for TS 590S 108 95 WDC HF4 Replacement 12 v DC lead for TS 590S 16 95 VGS 1 Voice guide amp s
395. perstar 360 3900 13 95 SGC 52 88 Remote control on off unit for SG 500 69 95 G 211 Mini Smartuner auto antenna tuner 1 8 60MHz 60W max powered by internal batts 209 95 FRrAQDAQVIININNINOA QAAA9QN90N90 E CET CC C CT CE EE EEE CTE CTC A C E CC EC C C C C CC CG0 OOT K KOG TOO KO T K GOGO GGG GO G d e CC CC EC I E I e T G MAC 200 Master antenna controller for up to 5 antennas with built in Smartuner amp memories SG 239 Automatic aerial tuner 1 8 30MHz 200 Watts SG 230 Automatic aerial tuner 1 6 30MHz 200 Watts 24V OPTION 24 12V option for SG 230 SG 237 Automatic aerial tuner 1 8 60MHz 100 Watts SG 237PCB Automatic aerial tuner printed circuit board version of SG 237 ADSP 2 EXT MK11 Improved external speaker unit with DSP 70 14 ADSP 2 LLK DSP board low level kit for fitting in any transceiver ADSP 2 HLK DSP board high level kit with 5 Watts AF output MOUNT 55 75 Mobile marine swivel mount stainless steel for SG 303 SG 307 needs whip WHIP SG 303 55 67 Marine mobile aerial 9ft long in 2 sections needs 55 75 mount SMART LOCK PRO Remote locking control for SG 231 235 SMART LOCK Remote locking control for SG 230 237 DIGITAL SGC CD ROM SHARMAN MULTICOM MP EZ Eazytalk hands free system MPA EZIC Eazytalk interface lead to Icom F1010 series MPA EZKW6 Eazytalk interface lead to Kenwood TK752 series MPA EZKW8 Eazytalk interface lead to Kenwood TK762 series MPA EZMT Eazytalk interface le
396. plug WATSON WEATHER STATION W 8681 PROII Wireless weather station colour TFT Atomic date time in out temp wind rain humidity SD card Wi Fi W 8681 SOLAR Wireless weather station LCD Atomic date time in out temp wind rain humidity USB solar TX W 8681 MKIl Wireless weather station touch LCD screen Atomic date time in out temp wind rain humidity USB W 8682 MKIl Wireless weather station atomic date time in out temp wind speed and direction rain humidity W 8683 Compact Wireless weather station with remote temperature and humidity sensor W 8684 Digital Clock with remote sensor for indoor amp outdoor temperature can take 2 extra sensors W 8685 Clock with alarm and inside amp wireless outside temperature display 2001 CD Spare software for W 2001 on CD ROM 8681 SOLAR PSU Power supply for the LCD display for W 8681 SOLAR 6V 3 pin UK 8681 AA Spare pack of 2 x AA rechargeable alkaline batteries 1 5V 2000mAh for the W 8681 solar transmitter 8681 CD Spare software for W 8681 on CD ROM 8681 LCD Spare touch screen LCD display for W 8681MKII 8681 LCD S Spare screen LCD display for W 8681 SOLAR 8681 LCD PRO Spare screen LCD display for W 8681 PRO 8681 RHS Spare mounting bracket for either rain guage or humidity sensor 1 piece needed for each for W 8681 8681 BWS Spare mounting bracket for wind sensors for W 8681 8681 ST1 Upgrade solar transmitter for W 8681 MKI 8681 ST2 MKI Spare transmitter for W 8681 SOLAR code S7 8681 ST2 MKIl Spare transmitter for W 86
397. plug WYL 8M Lead for WM S to Yaesu large modular RJ 45 8 pin plug WKL 8M Lead for WM S to Kenwood modular plug WIL 8M Lead for WM S to Icom modular plug WYL 8R Lead for WM S to Yaesu 8 pin round plug WKL 8R Lead for WM S to Kenwood 8 pin round plug WIL 8R Lead for WM S to Icom 8 pin round plug WAL 8M Lead for WM S to Alinco modular type mic plug RJ 45 B 1 Single diaphragm directional condenser microphone with shock mount UB SK8 8 pin Kenwood adaptor set with PTT line for UB 802A UB SY8 8 pin Yaesu adaptor set with PTT line for UB 802A UB SI8 8 pin Icom adaptor set with PTT line for UB 802A K 413 25 Microphone holder slide in type K 414 Microphone holder clip on type FOAM 1 Foam windshield to fit most sizes of dynamic microphones FOAM 6 Foam windshield for condenser microphone 20mm diameter 20mm long K 601 Desk stand for microphone foldable tripod complete with microphone clip K 701 Desk stand for microphone with gooseneck K 901 Desk stand for microphone with boom MTWB Metal twin microphone bar for two microphes with 5 8ths threads AB 1 Brass threaded adaptor for microphone stands internal thread 3 8ths external thread 5 8ths AS 10 Steel threaded adaptor for microphone stands internal thread 3 8ths external thread 5 8ths AS 20 Steel threaded adaptor for microphone stands internal thread 3 8ths external thread 5 8ths WATSON EARPHONES amp HEADPHONES FBI 9 Over the ear earpiece 3 5mm mono jack plug beige colour FBI 9K Over
398. power divider 1 7m long 50 Ohms frequency range 50 50 5MHz 2 port 28MHz power divider 2 7m long 50 Ohms frequency range 28 29MHz 4 port 28MHz power divider 2 7m long 50 Ohms frequency range 28 29MHz 80 channel handheld CB Handheld scanner 108 174MHz 99 memories Spare aerial for AR 109 DV DONGLE Work D Star repeaters all over the world from your PC powered from USB software inc DV ACCESS 2 Provides a 2m access point for use with D STAR radio DV ACCESS 70 Provides a 70cm access point for use with D STAR radio JETSTREAM JTCE1G2 Dipole center piece 2KW SO 239 JTBDOG End insulator black KANTRONICS PACKET RADIO ETC KAM 98 Single port multi mode digital controller KAM XL HF VHF TNC KENT MORSE KEYS amp ACCESSORIES TPKA Twin paddle brass Morse key assembled TPKK Twin paddle brass Morse key kit SPKA Single paddle key assembled SPKK Single paddle key kit HKA Standard brass straight key with wooden base assembled HKK Standard brass straight key with wooden base kit 199 95 299 95 299 95 59 95 79 95 69 95 82 95 79 95 95 95 99 95 129 95 199 95 239 95 114 95 59 95 12 95 179 95 239 95 249 95 14 95 0 95 429 95 169 95 112 95 96 95 94 95 88 95 98 95 85 95 L L R L La a L LL OOO AARMAAAADAAAAAAADADADADAAAAADA CX ET E O OO ET ET ET Ea a L a La R L OOO TO OOO Lala A a L r R
399. proof speaker microphone for HX 760E Speaker microphone for HX 760E Vox headset for HX 760E Earpiece microphone for HX 760E Charging cradle for HX 760E needs PA 46 Antenna connector adaptor SMA BNC for HX 760E Spare charger for CD 39 and HX 760E 3 pin EU old style Spare charger for CD 39 and HX 760E 3 pin UK new style Spare charger for CD 39 and HX 760E 3 pin EU new style Dry cell case for HX 760E 5 x AAA cells Spare 1150mAh Lithium lon battery pack for HX 760E DC cable with cigar lighter plug for HX 760E External DC cable for HX 760E Spare antenna for HX 760E Programming software for HX 760E Programming cable for HX 760E Handheld marine transceiver Li Ion battery and charger DSC GPS strobe light 6W Waterproof speaker microphone for HX 851E Speaker microphone for HX 851E Vox headset for HX 851E Earpiece microphone for HX 851E Charging cradle for HX 851E Antenna connector adaptor SMA BNC for HX 851E Spare charger for CD 39 and HX 851E 3 pin EU old style Spare charger for CD 39 and HX 851E 3 pin UK new style Spare charger for CD 39 and HX 851E 3 pin EU new style Dry cell case for HX 851E 5 x AAA cells Spare 1150mAh Lithium lon battery pack for HX 851E DC cable with cigar lighter plug for HX 851E External DC cable for HX 851E Spare antenna for HX 851E Programming software for HX 851E Programming cable for HX 851E LE TRANSCEIVERS VHF DSC fixed marine transceiver with AIS receiver Black VHF DSC fixed m
400. r RTTY ASCII CW AMTOR reader with built in screen CW Keyer and Morse reader with LCD Memory keyer with built in paddle Memory keyer fit your own paddle Menu driven memory keyer CW tutor As 492 but with 8K memory MFJ 80 built in Millenium CW memory keyer with LCD Budget Morse Optional keyboard for MFJ 493 495 464 Allows you to use CW on your 2m or 70cm hand held transceiver Classroom Morse practice oscillator Kit of 554 oscillator 281 speaker 550 key amp AC PSU Practice key amp built in oscillator Mini Morse lambic paddle Mini Morse lambic paddle kit Deluxe iambic paddle on a heavy chrome base Deluxe iambic paddle on a heavy black base Speech intelligibility enhancer Dual channel speech intelligibilty enhancer Phone patch with VU meter 8 pin modular microphone socket Speaker mic wi amp 2 2 radio receive audio mixer Boom mic SO2R switch Universal SO2R switch Computer controller SO2R switch Equaliser 4 band for voice Speech articulator transmit audio Equaliser and conditioner for voice Deluxe equaliser and conditioner 8 band for voice Simplex pocket repeater Ferrtite supression choke for RG58 59 6U 8X Ferrtite supression choke for RG58 59 6U 8X 4 pack Ferrtite supression choke for RG213 6X Ferrtite supression choke for RG213 6X 4 pack Ferrtite supression choke for RG11 8U Ferrtite supression choke for RG11 8U 4 pack Ferrtite supression choke for LMR600 Ferrtite s
401. r AR 8600 optional substitute 99 95 A MF 6 Collins mechanical filter AM 6 0KHz for AR 8600 optional substitute 99 95 C 20 8600 DC plug and cable no fuse for AR 8600 3 95 A EM 8200 External memory slot card for AR 8600 79 95 C VI 8200 Voice inverter slot card analogue for AR 8600 79 95 C RU 8200 Record playback slot card for AR 8600 79 95 C CT 8200 CTCSS slot card for AR 8600 99 95 C TE 8200 Tone eliminator slot card for AR 8600 use to lock out up to 256 unwanted frequencies 59 95 C CR 5000 Tape recorder lead for AR 8600 21 95 A 8 MINI ACC1 8 pin connector for AR 8600 2 95 A 8LMINI ACC1 8 pin connector with free end lead for AR 8600 6 95 A BP 8600 Optional internal NiCad battery pack workshop fitting needs PSU 7030 49 95 C PSU 8600 Optional AC power supply for AR 8600 19 95 A PSU 7030 Spare PSU for AR 8600 when BP 8600 fitted 39 95 A DC 8600 Spare DC lead for AR 8600 5 95 A MM 8600 Mobile mount for AR 8600 88 95 C 5000 PC 9 RS232 lead from AR 8600 to PC 9 way connector 11 95 A FA 8200 2 Replacement MW bar aerial for AR 8200 MKII 7 95 A RA 8600 Spare telescopic whip for AR 8600 1795 A SM 8600 1 Service Manual for AR 8600 mark 1 24 95 A SM 8600 2 Service Manual for AR 8600 mark 2 24 95 A OP 8600 Spare operating manual for AR 8600 mark 1 amp 2 7 95 A TV 8600 Internal PCB for AR 8600MKII NTSC demodulato not PAL 139 95 A P25 8600 Internal PCB for AR 8600MKII APCO25 demodulator not trunking 259
402. r DJ V57 16 95 SAW FILTER Part number MA04282 1090MHz GSRF TA1090EC saw filter for RadarBox 7 95 A EDC 144 Multiple 2 fast charger basket for DJ V57 39 95 EDC 159 Rapid charger for Li lon for DJ V57 29 95 AKD EDC 160 Quick charger for DJ V57 29 95 AKD MM Mobile mount for any AKD transceiver 11 95 A EDH 34 Dry cell case 6 x AA for DJ V57 12 95 AKD HAA 30kHz 30MHz HF active antenna 7m coax 54 95 C EA 114 Spare aerial for DJ V57 and DJ V5 was EA 70 11 95 EDS 10 Speaker microphone cable adaptor 2 pin to 1 pin for DJ V57 9 95 ALPIN AMPLIFIERS EDS 14 Speaker microphone cable adaptor 2 pin to 1 pin for DJ V57 9 95 ALPIN 100MKIII HF linear amplifier 160 6m 1kW 2 449 95 D EDS 11 Clone cable for DJ V57 8 95 ALPIN 200 HF linear amplifier 160 10m 2kW 3 499 95 D EME 4 Earphone microphone for DJ V57 needs either EDS 10 or EDS 14 20 99 ALPIN GU 74B Spare Valve for ALPIN 100MKII 269 95 C EME 6 Straight cord earphones for DJ V57 needs either EDS 10 or EDS 14 11 95 EME 26 Curly cord earphones for DJ V57 needs either EDS 10 or EDS 14 10 95 ALBRECHT SCANNER EME 12 Headset with single headphone VOX PTT for DJ V57 needs either EDS 10 or EDS 14 52 95 EME 13 Headset inner ear type with microphone and VOX for DJ V57 needs either EDS 10 or EDS 14 52 95 AE 355M Mobile desktop scanner close call 25 88 108 174 406 412 amp 806 960MHz 99 95 C EME 15 Tie pin microphone with VOX for DJ V57 needs either EDS 10 or EDS 14 49 95 EME 32A Earpho
403. r USB 2 tone 5 tone unit 40 pin type Scrambler unit inversion for IC F3022 4022 Scrambler unit inversion and rolling for C F3022 4022 Digital unit provides IDAS 6 25KHz digital capacity Man down unit VOXIPTT unit Earpiece for IC R5 Programming software for IC F3162 F4162 dealers only Service manual on CD ROM for IC F3162 F4162 ICOM PMR MOBILE TRANSCEIVERS amp ACCESSORIES IC F5012 IC F6012 F5022 201 HM 152 HM 152T SM 26 PC 1122 PC 1122 002 PC 1132A PC 1939 PC 2078 PC 347 EE L EE E D S S S F5012 6012 M F5012 6012 108R 109R 110R IC F5022 IC F6022 HM 152 HM 152T SM 25 OPC 347 CECD PMR VHF 8 ch 136 174MHz mic mobile mount amp DC lead 25W built in 5 tone PMR UHF 8 ch 400 470MHz mic mobile mount amp DC lead 25W built in 5 tone Din mount for IC F110 110S 5012 5022 Spare standard mobile microphone for IC F5012 6012 DTMF microphone for IC F5012 6012 Desk microphone for IC F5012 6012 Cloning cable dealers only RS232 type for IC F5012 6012 Cloning cable dealers only USB type for IC F5012 6012 Spare DC power cable 3m for IC F5012 6012 15 pin accessory cable for IC 5012 6012 25 pin accessory cable for IC F5012 6012 DC power cable 7m for IC F5012 6012 Mobile extension speaker 20W rated input power 30W max for IC F5012 6012 Programming software for IC F5012 6012 dealers only Service manual for IC F5012 6012 on PC CD ROM DTMF decoder unit 40 pin type
404. r splitter with N cable connector set 81mm long 89 95 231423 1250 1300 MHz 4 port power splitter with N cable connector set 81mm long 139 95 29224 Old 1250 MHz 2 port power splitter with N cable connector set 81mm long 89 95 29424 Old 1250 MHz 4 port power splitter with N cable connector set 81mm long 139 95 231213 2300 2400MHz 2 port power splitter with output cable connector set 55mm long 94 95 231413 2300 2400MHz 4 port power splitter with output cable connector set 55mm long 108 95 20018 Old Stack frame for 4 X 55 elements 1250 1300 MHz 71 95 TONNA SPARES 210105 Spare 50 51MHz element for 220505 17 95 220105 Spare 50 51MHz driven element for 220505 31 95 210111 Spare 144 146MHz element for 220804 220808 220089 and 220822 3 95 220111 Spare 144 146MHz driven element for 220804 220808 220089 and 220822 40 95 210131 Spare 144 146MHz element for 220809 220818 220817 and 220899 3 95 220131 Spare 144 146MHz driven element for 220809 220818 220817 and 220899 40 95 220141 Spare 144 146MHz element for PRO XL 220309 220311 220317 and 220318 5 95 210141 Spare 144 146MHz driven element for PRO XL 220309 220311 220317 and 220318 55 95 210122 Spare 430 440MHz element for 220909 220919 220921 and 220922 3 95 210132 Spare 430 440MHz element for 220899 3 95 220205 Spare 430 440MHz driven element for 220909 and 220919 29 95 220204 Spare 430 440MHz driven element for 220899 29 95 220203 Spare 430 440MHz dr
405. r with leads test signal output Mini digital multi meter with leads Power transisitor Bipolar power transistor Bipolar power transistor Power module Power module Power module TOKYO HY POWER SOLID STATE AMPLIFIERS AND TRANSVERTER HF amp 6m auto antenna tuner 1 8 54MHz 1 100 Watts HC 100AT TONNA BEAM ANTENNAS 6m 5 element 10 1dBi gain bracket connector 3 45m long 2m 4 element 8 9dBi gain N socket 0 93m long 2m 4 element crossed 8 9dBi gain N socket 0 93m long 2m 9 element 13 1dBi gain N socket 3 47m long 2m 9 element portable 13 1dBi gain N socket 3 47m long 2m 9 element crossed 13 1dBi gain N socket 3 47m long 2m 11 element 14 1dBi gain N socket 4 62m long 2m 11 element crossed 14 1dBi gain N socket 4 62m long 2m 17 element 15 3dBi gain N socket 6 57m long 2m 9 element PRO XL series 1kW 13 1dBi gain N socket 3 47m long 2m 11 element PRO XL series 1kW 14 2dBi gain N socket 4 89m long 2m 17 element PRO XL series 1kW 17dBi gain N socket 10 45m long 2m 9 element crossed PRO XL series 13 2dBi gain N socket 3 95m long 70cm 9 element 12081 gain N socket 1 24m long 70cm 19 element 16 2dBi gain N socket 2 82m long 70cm 19 element crossed 16 2dBi gain N socket 2 82m long 70cm 21 element 18 2dBi gain N socket 4 6m long 70cm ATV 21 element 18 2dBi gain N socket 4 6m long 220505 220804 220808 220809 220089 220818 220811 220822 220817 220309 220311 220317 220318 220909 220919 220
406. ransverters 54 95 KX3 F 10W HF amp 6m Portable Transceiver Fully Assembled 959 95 KX3 K 10W HF amp 6m Portable Transceiver Modular Ki 899 95 KX3 2M AT K 2m all mode internal transverter for KX3 with KXAT3 installed for install by user 199 95 KX3 2M AT F 2m all mode internal transverter for KX3 with KXATS installed includes install amp cal by W amp S 249 95 KX3 2M NOATU K 2m all mode internal transverter for KX3 without ATU for install by user 229 95 KX3 2M NOATU F 2m all mode internal transverter for KX3 without ATU includes install amp cal by W amp S 279 95 KX3 4M AT K 4m all mode internal transverter for KX3 with KXATS installed for install by user 199 95 KX3 4M AT F 4m all mode internal transverter for KX3 with KXATS installed includes install amp cal by W amp S 249 95 KX3 4M NOATU K 4m all mode internal transverter for KX3 without ATU for install by user 229 95 KX3 4M NOATU F 4m all mode internal transverter for KX3 without ATU includes install amp cal by W amp S 279 95 PX3 K Panadaptor for the KX3 Modular Kit 499 95 PX3 F Panadaptor for the KX3 Fully Assembled 559 95 QS 112E Handheld speaker microphone with PTT for Elecraft KX3 single pin 4 pole 39 95 KX3VFOMDK Replacement KX3 VFO A ball bearing encoder 64 95 EM 184 KX3 YOGA lightweight communications heaset with boom microphone for KX3 29 95 MH3 Hand Microphone with Up Down Buttons for the KX3 64 95 KXPA100 AT F 100W Power Amplifier amp KXAT 100F ATU for K
407. read DV wing nut and bolt for use with DV mount and DV banjo DV power stick base body mount fixing 3 8th thread to DV socket DV lead complete with 4m coax PL 259 to DV winkle fitted Microphone clip HF 3 element beam antenna 10 15 20m 1 2kW SSB HF 2 element beam antenna 10 15 20m 1 2kW SSB 6 boom length HF rotary dipole antenna 10 15 20m 1 2kW SSB element length 23 92 HF 3 element beam antenna 10 12 15 17 20m 1 2kW SSB HF rotary dipole antenna 10 15 20m 1kW SSB element length 17 0625 HF 2 element beam antenna 10 15 20m 1kW SSB 6 boom element length 19 6875 HF 3 element beam antenna 10 15 20m 1kW SSB 6 boom element length 19 6875 99 95 279 95 9 95 399 95 199 95 59 95 269 95 49 95 79 95 299 95 329 95 399 95 429 95 649 95 0 25 59 95 4 95 6 95 1 95 9 95 2 50 1 95 0 99 3 50 1 95 1 09 124 95 24 95 3 95 3 95 4 95 9 95 9 95 1 09 1 59 1 95 1 29 6 95 499 95 14 95 26 95 26 95 26 95 26 95 26 95 26 95 26 95 26 95 26 95 26 95 325 00 245 00 1 900 00 695 00 725 00 695 00 725 00 115 00 350 00 350 00 350 00 475 00 525 00 475 00 525 00 475 00 525 00 425 00 475 00 475 00 525 00 99 95 22 95 24 95 8 95 0 95 0 95 1 95 3 95 4 95 9 95 2 95 9 95 7 95 12 95 3 95 8 95 10 95 2 95 8 95 5 95 6 95
408. receiver kit with matching case and knob set 49 95 FT 146C 2m transmitter kit with matching case and knob set 93 95 FR 6C 6m FM receiver kit with matching case and knob set 48 95 HR 20C 20m direct conversion receiver kit with matching case and knob set 44 95 HR 40C 40m direct conversion receiver kit with matching case and knob set 44 95 SR 2C Shortwave receiver kit any 2MHz portion between 4 11MHz plus case amp knobs 48 95 TV 6C Television transmitter kit with matching case and knob set 39 95 QRP 20C 20m 1 Watt QRP transmitter kit including VXO with case and knob set 48 95 QRP 40C 40m 1 Watt QRP transmitter kit including VXO with case and knob set 48 95 QAMP 20C 20 meter 20 Watt power amplifier kit with matching case and knob set 44 95 QAMP 30C 30 metre 20 Watt power amplifier kit with matching case and knob set 44 95 QAMP 40C 40 meter 20 Watt power amplifier kit with matching case and knob set 44 95 SOFTNC BayPac portable Packet with J Com SofTNC software 66 95 TC K Software interface between Kenwood radios and computer 53 95 TC Y1 Software interface between Yaesu radios and computer 53 95 SA 7 Broadband receiving pre amplifier kit 22 95 RFS 1 Radio frequency switch using 1 100W 22 95 VS 1 RA Voice activated switch kit 13 95 TS 1 Electronic touch switch kit 13 95 LPA 1C Linear power amplifier kit up to 1 Watt 100KHz 1000MHz with case and knob set 53 95 TT 1C Telephone call recorder adapter with matching case an
409. rine Frequency Guide Seldec Oct 2008 Edition PAFG BK e Pocket UK amp Ireland Airband Frequency Guide Seldec 17th Edition UIFR 11 BK e UK Northern Ireland amp Ireland Flight Routes Seldec 2011 Edition WALR BK Worldwide Airline Routes Seldec 5th Edition MRFG BK e UK amp Ireland Marine Radio Guide With Near Continent Seldec July 2007 Edition UPLO BK UK Ireland With Near Continent Upper amp Lower Airspace Routes Seldec 3rd Edition September 2008 HFMB BK HF Marine Band Frequency List Seldec TOP5 BK op 500 Three Letter Airport Codes Seldec UKIA BK e UK amp Ireland Airband Frequency Guide Seldec 17th Edition ARLB BK Aeronautical Radio Logbook Seldec SPLB BK Spotters Log Book Seldec AMPS BK Amplifiers by Peter Rodmell BUTTERNUT ANTENNAS HF 2V 80 amp 40 vertical 9 75m long 1KW 160 amp 30 optional HF 6V 80 40 30 20 15 10m vertical 7 9m long 160 17 12 6m optional 1KW HF 9V 80 40 30 20 17 15 12 10 6m vertical 7 9m long 1KW HF 5B 10 17 15 20 12m 3 element butterfly beam 1200 W PEP 30 MRK 30m resonator for HF 2V A 17 12 17 amp 12m adaptor for HF 6V and HF 9V A 6 6m resonator for HF 6V and HF 9V TBR 160S 160m resonator for HF 6V HF 9V and HF 2V TLK Top loading kit for increased band width on 80 amp 160 4 x 25m wires for HF 2V CPK Counterpoise kit for HF 6V and HF 9V GRK Complete radial kit for ground mounted antennas for HF 2V HF 6V and HF 9V STR II Complete radial kit for roof mounted or elevated of the
410. rophone for FTM 400DE MLS 200 M10 High power external mobile type speaker waterproof FTM 400DE BU 2 Bluetooth adaptor unit for FTM 400DE SMB 201 Desktop cooling fan includes SAD 11C FVS 2 Voice guide unit for FTM 400DE MMB 98 Vacuum Cup bracket mount for controller of FTM 400DE SAD 11U C 220 240VAC PSU for SMB 201 SCU 20 PC connection cable CT 162 Seperation cable 6m long CT 166 Cloning cable CT 163 MDIN10 pin to MDIN6 pin Dsub9 CT 164 MDIN10 pin to MINIG pin CT 165 MDIN10 pin to Dsub9 CT 167 MDIN10 pin to open end BH 2A Bluetooth stereo headset for FTM 400DE CD 40 Charge cradle for BH 2A PA 46U Charger for CD 40 for BH 2A for FTM 400DE 3 pin UK PA 46C Charger for CD 40 for BH 2A for FTM 400DE 2 pin Euro FTM 100DE 2m 70cm digital transceiver Bluetooth GPS APRS 50 50W MH 48A6JA Spare DTMF microphone for FT 400DE MH 42C6J Hand microphone for FTM 400DE MLS 200 M10 High power external mobile type speaker waterproof FTM 400DE BU 2 Bluetooth adaptor unit for FTM 400DE SMB 201 Desktop cooling fan includes SAD 11C FVS 2 Voice guide unit for FTM 400DE MMB 98 Vacuum Cup bracket mount for controller of FTM 400DE SAD 11U C 220 240VAC PSU for SMB 201 SCU 20 PC connection cable CT 162 Seperation cable 6m long CT 166 Cloning cable CT 163 MDIN10 pin to MDING pin Dsub9 CT 164 MDIN10 pin to MINIG6 pin CT 165 MDIN10 pin to Dsub9 CT 167 MDIN10 pin to open end FTM 350E Accessories MH 48A6JA Spare DTMF microphone for FT 350E
411. rophone single pin 4 pole right angled plug 26 95 MS 800ID Hand held speaker microphone special connector for Icom IC DPR5 26 95 EM 14M Earphone with tie clip microphone PTT 2 pin straight plug for Icom Yaesu Standard Alinco 19 95 EM 14K Earphone with tie clip microphone PTT 2 pin right angled plug for Kenwood 19 95 EM 141D Earphone with tie clip microphone PTT special connector for Icom IC DPR5 19 95 EM 14L Earphone with tie clip microphone PTT 2 pin right angled plug for Icom Yaesu Standard Alinco 19 95 MS 900WID Speaker microphone with special connector for Icom IC DPR5 49 95 MS 900KD Speaker microphone with special connector for Kenwood TPZ D503 49 95 MS 900VD Speaker microphone with special connector for Yaesu VXD 10 49 95 EM 1000M Neck mic with acoustic tube earpiece amp PTT for 2 pin Yeasu Icom Alinco Standard 99 95 EM 1000K Neck microphone with acoustic tube earpiece with PTT for 2 pin Kenwood 99 95 EM 12M Earphone with tie clip microphone PTT 2 pin plug for Icom Yaesu Standard Alinco 18 95 EM 12K Earphone with tie clip microphone PTT 2 pin plug for Kenwood 18 95 EM 12V Earphone with tie clip mic PTT 4 contact single pole plug for Icom Yaesu Standard 18 95 EM 12S Earphone with tie clip mic PTT 4 contact single pole plug with screw for Yaesu Standard 18 95 EM 13M Earphone with boom microphone PTT 2 pin plug for Icom Yaesu Standard Alinco 24 95 EM 13K Earphone with boom microphone PTT 2 pin plug for Kenwood 24 95 EM 1
412. rpiece for connection to speaker mic for TK 2202 3202 2302 3302 Headset with VOX PTT for TK 2202 3202 2302 3302 Over the head heavy duty headset with boom microphone for TK 2202 3202 2302 3302 Headset boom mic less VOX for TK 2202 3202 2302 3302 Headet with PTT for TK 2202 3202 2302 3302 33 95 354 95 354 95 30 95 36 95 38 95 57 95 62 95 43 95 18 95 16 95 8 95 40 95 23 95 36 95 194 95 33 95 17 95 174 95 62 95 86 95 61 95 61 95 33 95 149 95 149 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 35 95 41 95 41 95 23 95 319 95 14 95 37 95 8 39 41 95 41 95 69 95 47 95 91 95 194 95 41 95 23 95 30 95 33 95 50 95 48 95 101 95 61 95 Programming software for TK 2000 3000T contact Kenwood order desk for this and licence ID 0 00 184 95 184 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 29 95 38 95 33 95 41 95 319 95 319 95 16 95 11 95 9 95 14 95 37 95 37 95 6 95 26 95 41 95 194 95 41 95 23 95 Boom mic with D type earpiece amp PTT for TH F7E was KHS 28F for TK 2202 3202 2302 3302 30 95 Single headset with boom microphone no PTT for TK 2202 3202 2302 3302 Single headset with boom microphone with PTT for TK 2202 3202 2302 3302 2 wire palm microphone kit for TK 2202 3202 2302 3302 3 wire mini
413. rs only Service manual on CD for C F44 GS GT MPT PMR VHF 136 174MHz BC 160 BC 145 BP 232 MB 94 aerial PMR VHF 136 174MHz BC 160 BC 145 BP 232 MB 94 aerial keypad PMR UHF 440 470MHz BC 160 BC 145 BP 232 MB 94 aerial PMR UHF 440 470MHz BC 160 BC 145 BP 232 MB 94 aerial keypad Charger adaptor for BC 119N 121N Earphone jack adaptor Fast charger includes AD 106 amp BC 145 6 way fast charger includes 6 x AD 106 amp BC 124 UK mains PSU for BC 119N fast charger Spare AC adaptor for BC 121 Spare Desktop rapid charger BNC J adaptor for F3 30 M21 31 AD 98FSC converts aerial socket to BNC Spare Li ion battery pack 7 4V 1150mAh High capacity Li ion battery pack 7 4V 2000mAh Dry cell case 6 x AAA batteries not supplied UHF antenna for 400 430MHz VHF antenna for 150 174MHz UHF antenna for 430 470MHz Spare Stubby antenna 160 174MHz Spare Stubby antenna 450 470MHz Compact style speaker microphone with earphone jack Full sized durable speaker microphone Waterproof speaker microphone Waterproof speaker microphone with programmable button Waterproof speaker microphone with GPS for BIIS mode position tracking GPS speaker microphone Headset earpiece type for use with VS 1 IC Headset with boom microphone for use with VS 1 IC Earphone with throat microphone for use with VS 1 IC Swivel belt clip Spare belt clip Fixed type non swing belt hanger Swivel type leather belt hanger Cloning cable Serial Cloning cable fo
414. s V IP lambic Presentation 24K gold plated chrome plate chrome base V ID lambic Deluxe chrome base and components V IS lambic Standard black base chrome components V CWJ Code Warrior Junior small iambic keyer ideal for QRP V CW Chrome Warrier iambic paddle V LW Lite Warrier iambic paddle V BRIT Brass Racer lambic Triangular solid brass paddle key hardwood triangular base V BRIS Brass Racer lambic Square solid brass paddle key hardwood square base V SRD Square Racer Deluxe iambic paddle chrome base and components red finger pieces V SRS Square Racer Standard iambic paddle black base chrome components black finger pieces V SKG Straight Key Gold 24K gold plated base chrome components V SKD Straight Key Deluxe highly polished chrome base and components V SKS Straight Key Standard black base chrome components V SKKC Straight key know code red base V VKG Vibrokeyer Gold entire base is 24K gold plated chrome components V VKD Vibrokeyer Deluxe chrome base and components V VKS Vibrokeyer Standard black base chrome components V DKG SK I Double Key Gold lambic paddle plus straight key 24K gold plated base V DKG SK VK Double Key Gold Vibrokeyer plus straight key 24K gold plated base V DKD SK I Double Key Deluxe lambic paddle plus straight key chrome base V DKD SK VK Double Key Deluxe vibrokeyer plus straight key chrome base V DKS SK I Double Key Standard lambic paddle plus straight key black base V DKS SK VK D
415. sed antenna switch Transmit receive switch automatic RF sensed PTT foot switch terminated 1 4 jack 2m 3 8th wave telescopic handy whip BNC 5 5 collapsed 2m 3 8th wave telescopic handy whip SMA male 5 5 collapsed 2m 70cm telescopic antenna BNC 2m 70cm telescopic antenna SMA 2m 70cm BNC 8 5 flexible whip for handheld 2m 70cm SMA 8 5 flexible whip for handheld 2m telescopic whip 40 long BNC 2m 70cm BNC 14 5 flexible whip for handheld 2m 70cm SMA 14 5 flexible whip for handheld 2m 70cm BNC flexible whip for handheld 2m 70cm SMA flexible whip for handheld 2m 70cm 15 75 flexible whip for handheld BNC plug 2m 70cm 15 75 flexible whip for handheld SMA plug 2m 70cm 15 75 flexible whip for handheld SMA socket Wouxun Quansheng 2m 70cm 16 5 flexible whip for FT 817 PL 259 2m 70cm 16 5 flexible whip for FT 817 foldover PL 259 2m 70cm amp 23cm mini rubber duck 4 5cms BNC male 2m 70cm amp 23cm mini rubber duck 4 5cms SMA male 2m 70cm amp 23cm mini rubber duck 4 5cms SMA female 6m 2m 70cm rubber duck SMA 2m tiny magmount and 20 whip 2m 70cm tiny magmount and 20 whip BNC 2m 70cm tiny magmount and 20 whip SMA Dual band mobile whip 2m 70cm with mag mount and coax PL 259 19 tall 2m 6m mobile whip aerial 5 8th wave magnetic mount coax amp PL 259 2m 70cm mobile whip on a mag mount 27 5 inches high coax amp PL 259 2m roll up portable half wave J type aerial 70cm roll up portable J type aerial BNC
416. set with boom microphone with PTT for TK 2360 3360 2 wire palm microphone kit for TK 2360 3360 3 wire mini lapel microphone kit for TK 2360 3360 Palm size speaker microphone for TK 2360 3360 Speaker microphone for TK 2360 3360 Advanced motion detector license for TK 2360 3360 Programming interface cable serial for TK 2360 3360 Serial to USB adapter with driversfor TK 2360 3360 Programming software for windows for TK 2360 3360 VHF handy 136 174MHz 12 5 20 25KHz 1 5W 128 CH needs aerial battery charger with 12 key keypad VHF handy 136 174MHz 12 5 20 25KHz 1 5W 128 CH needs aerial battery charger no keypad UHF handy 440 470MHz 12 5 20 25KHz 1 4W 128 CH needs aerial battery charger with 12 key keypad UHF handy 440 470MHz 12 5 20 25KHz 1 4W 128 CH needs aerial battery charger no keypad UHF handy 400 430MHz 12 5 20 25KHz 1 4W 128 CH needs aerial battery charger with 12 key keypad 319 95 33 95 319 95 16 95 6 95 24 95 27 95 14 95 37 95 41 95 194 95 41 95 23 95 30 95 41 95 69 95 47 95 91 95 50 95 33 95 48 95 61 95 101 95 39 95 179 95 239 95 239 95 199 95 199 95 179 95 239 95 239 95 199 95 199 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 9 95 39 95 39 95 49 95 319 95 38 95 28 95 16 95 6 95 11 95 15 95 14 95 37 95 18 95 26 95 41 95 194 95 41 95 23 95
417. sory pack MFJ 92AA10 MFJ 1312DX 10 x AA Ni MH MFJ accessory pack for MFJ 269PRO 24 hour wall clock Single 24 hour digital clock Dual 12 24 hour UTC local time clock DX ers world map clock 24 hour world map wall clock 12 hour clock with 10 minute ID timer 12 24 hour analoigue wall clock 24 maxi wallclock Grid dip meter 1 100 MHz receive noise bridge Antenna tuning bridge 1 8 30 MHz up to 500 Ohms 160 10m SWR analyser 142 156 MHz SWR analyser Analogue analyser 1 8 170MHz Matchmaker lets you tune an aerial without transmitting 30 56MHz 6m analogue analyser Analogue analyser 420 450MHz N type plug SWR analyser 24 49MHz SWR analyser 34 69MHz SWR analyser 45 91MHz SWR analyser 67 135MHz SWR analyser 90 176MHz SWR analyser 190 350MHz SWR analyser 140 260MHz Analyser 143 5 148 5MHz Two port graphic antenna analyser LCD graphics PC interface 1 180MHz 1 230MHz Antenna Expert Graphic Antenna Analyser UHF digital antenna analyser 270 480MHz N HF digital SWR analyser 530KHz 230MHz MHz frequency counter Dummy load in a can with oil 1KW max Dry dummy load 16 6 25 50 100 or 150 Ohms 300W for 30secs DC 60MHz PL 259 Dummy load in a can without oil 1KW max HF VHF digital SWR analyser 530KHz 230MHz counter resistance meter AC wall charger for MFJ 259B 12VDC 300 mAh 300 Watt dummy load DC 650 MHz PL 259 300 Watt dummy load DC 650MHz N type 100 Watt dummy load DC 500 MHz PL 259 15 Watts average 100 Watt dummy load
418. ssories CS 2200 Cloning software for IC 2200 needs OPC 478 HM 133 Remote control microphone for IC 2200 was HM 98 HM 154 Mobile hand microphone for IC 2200 HM 154T Mobile hand microphone for IC 2200 with keypad SP 10 Mobile speaker 5W 4 Ohms for IC 2200 OPC 347 DC power cable 7m for IC 2200 OPC 440 Microphone extension cable 5m for IC 2200 OPC 441 Speaker extension cable for IC 2200 OPC 474 Cloning cable set to set for C 2200 OPC 478 Cloning cable computor to IC 2200 OPC 589 Microphone adaptor cable for IC 2200 to 8 pin OPC 1132 DC power cable 3m for IC 2200 UT 108 DTMF decoder unit UT 118 DSTAR unit for 1C 2200H SM 2200H Service manual on CD ROM for IC 2200H OPC 346 Spare DC power cable for IC 2200 IC T70E accessories BC 01 Spare UK mains charger for BC 192 also needs BC 192 to charge IC T70E BC 06 Spare UK mains PSU for BC 191 and BC 193 BC 191 Rapid desktop charger for BP 264 2 hours comes with BC 06 for C T70E BC 192 Spare charger for IC T70E and BP 264 16 hours comes with BC 01 BC 193 Rapid desktop charger for BP 265 2 5 hours comes with BC 06 for IC T70E BP 263 Dry cell case for IC T70E 6 x AA cells not included BP 264 Spare Ni MH battery pack 7 2V 1400mAh for IC T70E BP 265 Li lon battery pack 7 4V 1900mAh 2000mAh for IC T70E 169 95 149 95 155 95 145 95 41 95 155 95 18 95 36 95 181 95 99 95 88 95 51 95 99 95 63 95 18 95 499 95 649 95 49 95 31 95 46
419. st state 6 12 or 18 stand off required 10 5m ground mounted manual tilt over heavy duty aluminium mast needs concrete base 12m ground mounted manual tilt over heavy duty aluminium mast needs concrete base 10 5m post mounted manual tilt over heavy duty aluminium mast with base plate 12m post mounted manual tilt over heavy duty aluminium mast with base plate 10 5m wall mount parallel tit heavy duty al mast 2 winches state 18 24 or 36 stand off and L or R tit 12m wall mount parallel tit over heavy duty al mast 2 winches state 18 24 or 36 stand off and L or R tit 10 5m wall mounted manual tit heavy duty aluminium mast 1 winch state 18 24 or 36 stand off 12m wall mount manual tit over heavy duty aluminium mast 1 winch state 18 24 or 36 stand off 10 5m wall mounted manual winched tit heavy duty aluminium mast 2 winches state 18 24 or 36 s o 12m wall mounted manual winched tilt heavy duty aluminium mast 2 winches state 18 24 or 36 s o MOONRAKER CB ANTENNAS AND ACCESSORIES WHIZZ WHIP GAV H GAV F PANTHER METEOR NI METEOR SUPER FLEXI 36 SUPER FLEXI 48 TORNADO STINGER S T CARLET WARRIOR URBO LIMPET PIGMY MHM 38 MSF 38 MBM 38 MGM 38 MRM 38 MMM 38 MCK 38 E MOSLEY ANTENNAS TA 33 JR N TA 32 JR N TA 31 JR N TA 53 M MINI 31 A MINI 32 A MINI 33 A Portable antenna with built in tuner for 3 5 460MHz 10W 130cm long PL 259 G A P 1 2 wave base station vertical antenna 18 long SO 239 fitting
420. su FT 100 817 857 897 radios 3 5mm to 8 pin mini din 11 95 A WR G31DDC Excalibur SDR shortwave receiver 9KHz 49 995MHz 699 95 CAT 6D CBL CAT cable for Yaesu FT 736 747 767 980 990 1000 1000D radios 3 5mm to 6 pin din 11 95 A WR G33DDC Excalibur Pro SDR shortwave receiver 9KHz 49 995MHz 1 599 95 CB 6 nstant setup connectors for RIGblaster Plus Il Plus amp Pro 18 95 A WR G39DDCi internal PCI card High performance HF VHF UHF SHF SDR receiver 20KHz 3500MHz POA WOUXUN KWD Cable for Wouxun Kenwood and instant setup connector 31 95 A WR G39DDCe External USB High performance HF VHF UHF SHF SDR receiver 20KHz 3500MHz POA M8 CBL Lead RJ 45 to 8 pin mic 3 long as included with M8 and Plus 18 95 A WR G303i internal PCI card HF receiver with standard demodulator 9KHz 30MHz 589 95 M8 CBL 6 Lead RJ 45 to 8 pin mic 6 long optional cable for RIGblaster duo 18 95 A WR G303i PD internal PCI card HF receiver with professional demodulator 9KHz 30MHz 659 95 M4 CBL Lead RJ 45 to 4 pin mic 3 long as inc with 4 pin kit can be used with nomic 18 95 A WR G303e External USB HF receiver with standard demodulator 9KHz 30MHz 679 95 RJ CBL Lead RJ 45 to RJ 45 3 long can be used with nomic 9 95 A WR G303e PD External USB HF receiver 9KHz 30MHz with professional demodulator 9KHz 30MHz 789 95 RJ CBL 6 Lead RJ 45 to RJ 45 6 long optional cable for RiGblaster duo 14 95 A WR G313i internal PCI card professional HF receiver 9KHz 30MHz 1 099 95 ST CBL
421. t 148cm long F 2405L Mast mounted 2400 2500MHz 5dBi vertical 10W N socket 60cm high F 2407L Mast mounted 2400 2500MHz 7dBi vertical 10W N socket 72cm high 8x1 2 wave F 2409L Mast mounted 2400 2500MHz 9dBi vertical 10W N socket 90cm high 12x1 2wave FL 2401A Mast mounted 2400 2500MHz 9dBi 4W 106x116x25mm N socket adjustable mount DIAMOND BASE STATION ANTENNAS F718 70cm fibre glass 11 5dBi gain 250W 4 6m long N type socket 430 440MHz F718A 70cm fibre glass 11 5dBi gain 250W 4 6m long N type socket 440 450MHz 150MV VHF fibre glass vertical marine 1 2 wave TX 156 157MHz 2 15dBi gain 50W 1 23m long SO 239 DP KE137 Receiving antenna for weather satellite NOAA amp ACARS 137MHz 1m long SO 239 239 95 369 95 589 95 429 95 129 95 629 95 799 95 999 95 369 95 569 95 209 95 699 95 209 95 37 95 33 95 499 95 209 95 999 95 459 95 449 95 639 95 549 95 69 95 95 95 309 95 349 95 299 95 329 95 359 95 369 95 399 95 399 95 299 95 979 95 139 95 174 95 289 95 139 95 199 95 245 95 639 95 179 95 199 95 389 95 99 95 249 95 119 95 89 95 72 95 109 95 49 95 109 95 119 95 149 95 229 95 419 95 79 95 149 95 229 95 129 95 89 95 129 95 54 95 149 95 74 95 99 95 204 95 19 95 19 95 19 95 19 95 29 95 19 95 19 95 20 95 34 95 40 95 25 95 27 95 1
422. t antenna 400 450MHz for TK 220 320 UHF antenna 440 490MHz for TK 220 320 UHF antenna 400 450MHz for TK 220 320 VHF short antenna 146 162MHz for TK 220 320 VHF short antenna 162 174MHz for TK 220 320 VHF short antenna 136 150MHz for TK 220 320 VHF antenna 146 162MHz for TK 220 320 VHF antenna 162 174MHz for TK 220 320 VHF antenna 136 150MHz for TK 220 320 Dry cell case 6 x AA for TK 220 320 Li lon battery 1480mAh for TK 220 320 Ni MH battery 1400mAh for TK 220 320 Li lon battery 2000mAh for TK 220 320 Rapid charger for TK 220 320 Regular charger for TK 220 320 6 way charger for TK 220 320 Spare belt clip for TK 220 320 Over the head heavy duty headset with boom microphone for TK 220 320 Lightweight single muff headset with boom microphone ant PTT for TK 220 320 2 wire palm microphone with earphone for TK 220 320 3 wire mini lapel microphone with earphone for TK 220 320 Optional wall hanging bracket for KSC 256 Palm size speaker microphone for TK 220 320 Speaker microphone for TK 220 320 GPS speaker microphone for TK 220 320 Telephone interconnect cable for NX 220 320 Water resistant bag for TK 220 320 Serial to USB adaptor with drivers for TK 220 320 Programming software for NX 220 320 Programming interface cable serial for TK 220 320 Digital and analogue mobile transceiver VHF 136 174MHz 1 25W 512ch c w mount DC cable Digital and analogue mobile transceiver UHF 400 470MHz 1 25W 512ch c w mount DC cable Hand microp
423. t clip scrambler Li lon battery 7 2V 1700mAh ATEX APPROVED Antenna VHF 150 174MHz ATEX APPROVED Antenna UHF 400 470MHz ATEX APPROVED Antenna VHF 136 150MHz ATEX APPROVED Aerial VHF 160 174MHz ATEX APPROVED stubby Aerial UHF 450 490MHz ATEX APPROVED stubby Waterproof speaker microphone ATEX APPROVED Swivel belt clip ATEX APPROVED Alligator style belt clip ATEX APPROVED Charger adaptor for BC 119N amp BC 121N Spare UK mains charger for use with BC 152 Fast charger includes AD 100 amp BC 145 6 way charger including 6 x AD 100 adaptors and BC 157 UK mains PSU for BC 119N fast charger 31 95 18 95 124 95 18 95 11 95 11 95 18 95 14 95 28 95 46 95 8 95 25 95 62 95 142 95 67 95 31 95 83 95 69 95 376 21 392 64 376 21 392 64 14 95 18 95 66 95 394 95 14 95 94 95 31 95 26 95 46 95 18 95 18 95 18 95 18 95 18 95 18 95 18 95 27 95 21 95 36 95 73 95 27 95 57 95 31 95 18 95 124 95 27 95 11 95 11 95 18 95 18 95 11 95 28 95 46 95 8 95 89 95 119 95 60 95 67 95 9 95 31 95 83 95 62 95 429 95 429 95 18 95 14 95 66 95 394 95 14 95 31 95 94 95 41 95 41 95 18 95 25 95 78 95 18 95 18 95 18 95 18 95 80 95 67 95 179 95 94 95 18 95 124 95 27 95 41 95 11 95 11
424. t for NXR 710 810 219 95 KMC 9C Control station desktop microphone for NXR 710 810 62 95 KMC 30 Hand microphone standard for NXR 710 810 30 95 KMC 35 Hand microphone heavy duty for NXR 710 810 38 95 KES 5 External speaker for NXR 710 810 36 95 KPG 46A PC interface cable for NXR 710 810 61 95 KPG 129DM Programming software for NXR 710 810 49 95 KCT 53U Serial to USB adaptor with drivers for TK 7162 8162 61 95 NXR 700E Digital and analogue FM base transceiver VHF 146 174MHz 5 25W 30ch clw mount DC cable handle 2 690 00 NXR 800E Digital and analogue FM base transceiver UHF 440 470MHz 5 25W 30ch cw mount DC cable handle 2 690 00 NXR 800E3 Digital and analogue FM base transceiver UHF 400 430MHz 5 25W 30ch cw mount DC cable handle 2 690 00 KMC 9C Control station desktop microphone for NXR 700 800 62 95 KMC 30 Hand microphone standard for NXR 700 800 30 95 KMC 35 Hand microphone heavy duty for NXR 700 800 38 95 KMC 38GPS GPS speaker microphone for NX 700 800 219 95 KXK 3M2 High stability TCXO 1 per site only required for 6 25KHz tuning for NXR 700 800 699 95 KES 5 External speaker for NXR 700 800 36 95 KPG 109DM Programming software for NXR 700 800 49 95 KPG 110SM Programming software for trunking network for NXR 700 800 234 95 KSL 1TR Trunking software licence per repeater for NXR 700 800 769 95 KSL 2NW Multi site network software licence per repeater for NXR 700 800 1 399 95 NX 200S Digital and analogue FM hand hel
425. takes 2 antennas 1 8 30 MHz antenna tuner 300 Watts takes 2 antennas In kit form 1 8 54 MHz mobile antenna tuner 300 Watts meter 1 8 30 MHz antenna tuner 300 Watts 1 8 30 MHz antenna tuner dummy load 300 Watts SW MWILW Preselector tuner ATU for 0 30 MHz receiver with built in 20dB preamp 1 8 30 MHz 1 5KW antenna tuning unit 160 6m all band 300W ATU 1 8 30 MHz 200W portable ATU cross needle SWR PWR meter 3 6 54MHz 300W Balanced line antenna tuner with X needle SWR PWR meter 1 8 54MHz 300W Balanced line antenna tuner with X needle SWR PWR meter 1 8 30MHz 1500W Balanced line antenna tuner with X needle SWR PWR meter 1 8 30MHz 3KW differential ATU 1 8 30MHz full 1500 Watts SSB CW roller tuner 1 8 30MHz automatic antenna tuner Dual power 150W or 300W SSB 100W CW Analog meter 99 95 194 95 189 95 204 95 254 95 149 95 149 95 149 95 139 95 145 95 129 95 159 95 169 95 76 95 122 95 289 95 209 95 119 95 189 95 209 95 479 95 339 95 379 95 229 95 1 8 30MHz automatic antenna tuner 300W SSB 150W CW Anal amp digital display Needs MFJ 5124 cable 239 95 1 8 30MHz remote automatic antenna tuner 300W Remote control for MFJ 991 MFJ 993 and MFJ 994 ATU s 1 8 30MHz automatic antenna tuner 600W Analogue meter Needs MFJ 5124 type cable 1 8 30MHz remote automatic antenna tuner 600W 1 8 30MHz 1 5KW Automatic Antenna tuner Needs MFJ 5114 cable 1 8 30MHz 1 5KW Re
426. terproof Li lon batt pack amp charger last message record ACCESSORIES FOR IC M71 AD 114 BC 01 BC 119N 004 BC 121N 001 BC 145 Charge adaptor for use with BC 119N 121N and IC M71 Spare UK mains AC unit for BC 166 and IC M71 Desktop fast charger includes BC 145UK and IC M71 6 way charger for IC M71 needs BC 157S and 6 x AD 114 and IC M71 UK mains PSU for BC 119N fast charger and IC M71 6 95 98 95 62 95 70 95 fi E 1 1 4 2 1 10 9 i 1 8 E 4 3 3 2 D 3 1 1 i 2 2 19 95 1 95 29 95 14 95 21 95 9 95 11 95 18 95 88 95 25 95 86 95 51 95 70 95 49 95 31 95 07 95 98 95 76 95 25 95 18 95 21 95 59 00 99 95 63 95 99 95 98 95 81 95 81 95 24 95 9 95 18 95 28 95 10 95 10 95 86 95 94 95 27 95 46 95 31 95 39 95 46 95 82 95 63 95 61 95 35 95 77 95 54 95 44 95 4 95 66 95 94 95 36 95 4 95 93 95 29 95 8 95 42 95 8 95 21 95 1 95 1 95 8 95 8 95 45 95 36 95 8 95 46 95 82 95 69 95 49 95 14 95 14 95 52 95 14 95 18 95 21 95 18 95 10 95 22 95 28 95 46 95 75 95
427. torage unit for TS 590S 86 95 TS 2000E HF 6m 2m 70cm all mode transceiver Listed 1699 95 1 549 00 TS 2000XE HF 6m 2m 70cm 23cm all mode transceiver Listed 1999 95 1 799 95 RC 2000 Remote head for TS 2000 includes brackets cable and speaker 228 95 ARCP 2000 Software for TS 2000 48 95 UT 20 23cm optional unit for TS 2000 399 95 DRU 3A Digital recording unit for TS 2000 108 95 VS 3 Voice synthesizer for TS 2000 49 95 SP 23 K Base speaker for TS 2000 74 95 HS 5W Deluxe headphones for TS 2000 56 95 HS 6 Ultra light headphones for TS 2000 38 95 MC 43S Spare dynamic hand microphone with Up down 8 pin plug for TS 2000 20 95 MC 47 Hand mic with 4 programmable buttons for TS 2000 42 95 MC 60A Dual impedance desk microphone internal pre amplifier for TS 2000 127 95 E30 1692 08 Spare cable for MC 60A 8 pin round plug fitted 40 95 MC 90 Desk microphone for DSP transceivers for TS 2000 204 95 MB 430M2 Mobile mounting bracket for TS 2000 21 95 PG 2Z Spare DC cable for TS 2000 2m long 20 95 PCF 2 9 pin D socket to 9 pin D socket computer lead for TS 2000 15 95 TS 480SATE HF amp 6m 100W transceiver DSP auto ATU 12V Listed 859 95 699 95 TS 480HXE HF 200W amp 6m 100W transceiver DSP 12V Listed 969 95 839 95 PCF 2 9 pin D socket to 9 pin D socket computer lead for TS 480 13 95 ARCP 480 Radio control program for TS 480 free download 0 00 ARHP 10 nternet radio host program for TS 480 free download 0 00 VGS 1 Vo
428. ty tilt angle adjustable gutter mount needs cable kit Universal hatchback thumbwheel ratchet adjustment needs cable kit Heavy duty roofrail tilt angle adjustable mount 15 25mm needs cable kit Heavy duty roofrail tilt angle adjustable mount 15 40mm needs cable kit Ultra heavy duty tilt angle adjustable gutter mount needs cable kit Heavy duty compact tilt angle adjustable 2 axis gutter mount needs cable kit Tilt angle adjustable 2 axis gutter mount needs cable kit Heavy duty tilt adjustable hatch boot mount needs cable kit Heavy duty hatch boot mount 2 axis adjustable needs cable kit Heavy duty hatch boot mount 3 axis adjustable needs cable kit Hatchback boot door antenna bracket mount 3 axis adjustable needs cable kit Hatchback boot door antenna bracket mount 3 axis adjustable needs cable kit SILVER Heavy duty hatch boot mount 3 axis adjustable needs cable kit Roofrail mounting bracket heavy duty 2 axis adjustable needs cable kit Roofrail mounting bracket 3 axis adjustable needs cable kit Roofrail mounting bracket 2 axis adjustable for bigger rails needs cable kit Roofrail mounting bracket tilt angle adjustable 15 25mm needs cable kit Roofrail mounting bracket tilt angle adjustable 15 25mm needs cable kit Wing shaped luggage rack mount up to 3 inches wide needs cable kit Streamlined boot mount SO 239 socket cable amp PL 259 plug Magnetic mount SO 239 socket 4m cable amp PL 259 plug Magnetic mount SO 23
429. type 5dBi gain 49 95 C DJ V57 2m 70cm hand held transceiver 5W water resistant VOX SMA 159 95 RADAR EXTENDER External antenna for RadarBox 1m long inc mounting tube c w clamps N type 6dB gain 59 95 C EBP 63 Li ON battery pack DC 7 4V 1100mAh for DJ V57 39 95 SHIP FINDER External antenna for Shiptrax 1 5m long inc mounting tube c w clamps SO 239 79 95 C EBP 64 Li ON battery pack DC 7 4V 1600mAh for DJ V57 44 95 RADAR BEAM External beam antenna for RadarBox 490x200x180mm c w clamps SMA socket 14 5dBi gain 49 95 C EBP 65 Spare Ni MH battery pack DC 7 2V 700mAh for DJ V57 27 95 ACARS DECODER PC stand alone product gets data from scanner or internet can use with RadarBox 115 95 C EBP 66 Ni MH battery pack DC 7 2V 2000mAh for DJ V57 42 95 RADAR AMP Low noise 1096MHz mast head pre amp for RadarBox 12dB gain c w Bias Tee amp PSU 129 95 C EDC 36 Cigarette lighter cable with filter for DJ V57 19 95 A12 1090 Low noise 1096MHz mast head pre amplifier for RadarBox 114 95 C EDC 37 12V DC cable bare ends for DJ V57 6 95 BT 12 Bias Tee allows 12V feed to mast head pre amp A12 1090 via the antenna coax 34 95 C EDC 43 12V DC cigarette lighter cable for charging Ni MH battery packs for DJ V57 8 95 BT 12 PSU Optional 3 pin UK mains 230V power supply for Elad BT 12 24 95 A EDC 148 Spare wall charger 230V UK plug fror DJ V57 9 95 USB MINI 5 Spare PC lead for RADAR BOX lead USB A to mini USB 5pin B 2m long 4 95 A EDC 143 UK trickle charger fo
430. ufacturers offers the prices in this list can change on a day to day basis Therefore we offer our original PRICE MATCH You can t buy cheaper Guaranteed If you see any products advertised or get a written quotation from any of our competitors who must be authorised dealers for that product cheaper then the prices listed here then tell us and we ll match or better the price on the spot And don t forget our 10 DAY MONEY BACK GUARANTEE if you purchase your goods by mail order and you are not completely delighted with your purchase therefore orders received after this will be sent out the next day We aim to maintain quantities of all the goods listed but as there are over 6300 items on this price list we can be out of stock of an item from time to time If we are out of stock of the item that you have ordered we will advise you as soon as possible and await your further instructions Once we receive an order It is transferred straight onto computer so that every customer is given a unique order number We can therefore look up any order within seconds to find out the current progress and put a customers mind at rest There is a large showroom at these premises 2000 square feet for those who can visit us It is well worth a browse The shop Is near Hockley railway station Liverpool Street 45 minutes Southend Airport 24 hour taxi rank is 3 miles away There is ample free parking at the front and rear of the premises for those
431. uminium tripod for YP 450 telescopic mast Spring loaded quick disconnector 3 8 adaptor Plastic trunk mount and cable kit 3 8 Mobile antenna mount for any flat surface SO 239 to SO 239 drill a hole Rail mount horizontal SO 239 socket 4m coax amp PL 259 plug Mast and mount for 2 x 3 8th thread mobile antennas to make a dipole SO 239 Rail mount horizontal SO 239 socket x 2 Mobile matching transformer 3 5 24MHz 400 Watts for aerials without SO 239 base for wire Mobile matching transformer 3 5 24MHz 400 Watts for aerials with SO 239 base Mobile aerial cable kit 5m low loss 5D FB 30cms PTFE lead Hatch boot universal mount black stainless steel Universal rail mount stainless steel multi angle adjustable Mobile aerial cable kit 5m cable SO 239 to PL 259 Coaxial cable extension lead SO 239 to PL 259 5m long RG 58A U Magnetic mount 14cm with SO 239 New Stay Put design Magnetic mount 8cm with SO 239 New Stay Put design Heavy duty 7 inch magnetic mount SO 239 with cable amp PL 259 Medium 5 inch magnetic mount SO 239 with cable amp PL 259 Patch lead 50 Ohms RG 58 2 x PL 259 50cm long Patch lead 50 Ohms RG 58 2 x BNC plugs 50cm long Patch lead 50 Ohms RG 58 1 x PL 259 1 x BNC plug 50cm long Patch lead 50 Ohms RG 58 1 x Phono plug 1 x BNC plug 50cm long Patch lead 50 Ohms RG 58 1 x SMA plug 1 x BNC plug 50cm long na aa Patch lead 50 Ohms 5D FB 2 x PL 259 high quality semi rigid STAY PUT design 2 25 long Patch lead 5
432. und card adaptor for all digital modes 8 pin modular plug RJ 45 220V PSU Sound card adaptor for all digital modes 4 pin round mic plug 220V PSU Sound card adaptor with auxiliary inputs 8 pin round mic plug PSU Sound card adaptor with auxiliary inputs 8 pin modular plug RJ 45 PSU Sound card adaptor with auxiliary inputs 4 pin round mic plug PSU Packet only host mode software for MFJ 1270C IBM multimode control software for WINDOWS no cable Soundcard programs PSK 31 SSTV FAX SATIRTTY SITOR DSP RC DSP soundcard programs as 1296 plus analysers 240V 12V adaptor for MFJ equipment Ground plane kit converts mobile aerial to base station 2m 70cm mobile whip 0 45m long PL 259 base 2m 70cm mobile whip 40 long PL 259 base 2m 70cm mobile whip 1 2 wave 3 8ths thread 2m 70cm mobile whip 41 5 long PL 259 base 2m 70cm mobile whip 62 5 long PL 259 base 144MHz 220MHz 440MHz_ mobile whip PL 259 base 6m 2m 70cm mobile whip 59 long PL 259 base 10 6 2 70cm mobile whip HF VHF UHF multi band mobile aerial 2m base aerial 7 8dB gain 15 tall SO 239 2m 70cm base aerial 3dB on 2m 5 5dB on 70cm 4 5 tall 2m 70cm base aerial 4 5dB on 2m 7 2dB on 70cm 5 5 tall 2m 70cm base aerial 6 5dB on 2m 9dB on 70cm 10 tall SO 239 2m 70cm base aerial 8 3dB on 2m 11 7 on 70cm 17 high SO 239 2m 70cm base aerial 8 3dB on 2m 11 7 on 70cm 17 high N type 2m 70cm 23cm base aerial 5 5 tall N type 6m 2m 70cm base aerial 8 2 tall SO 239 50 144 220 440MHz base aer
433. undcard interface rig control and more 12V USB 259 95 C PP 21 J Power pole to 5 5 x 2 1mm jack 9 95 RB ADVANTAGE RiGblaster with internal soundcard only one USB cable needed to PC and power 189 95 C PP 21 P Power pole to 5 5 x 2 1mm plug 9 95 RB PL2 CUSB RiGblaster PLUS II data mode soundcard interface amp mic switch 8 pin 12v USB 149 95 C PP CLR Power pole to cigarette lighter receptacle 9 95 RB NO CUSB RiGblaster nomic 8 pin RJ 45 data mode soundcard interface passive USB 69 95 C PP FCLP Power pole to cigarette lighter plug 13 95 RB PP RiGblaster Plug amp Play USB interface needs adaptor 109 95 C PP LAC Power pole to large alligator clips 13 95 RPAII8D Adaptor for RB PP and Icom 8 pin ACC1 such as IC 746 756PROIII 910 10 95 A PP GCC Power pole to gel cell connectors 13 95 RPAII13D Adaptor for RB PP and Icom 13 pin din such as IC 703 706 718 7000 10 95 A PP YC Power pole Y connector 9 95 RPA K13D Adaptor for RB PP and Kenwood ACC2 13 pin din such as TS 50 570 850 2000 450 690 870 950 10 95 A USB CABLE Connects Rigblaster to any computer that has USB port but not serial port 18 95 RPAVK13D2 Adaptor for RB PP and Kenwood ACC2 13 pin din such as TS 440 940 10 95 A USB AUDIO USB audio adaptor sound card 17 95 RPA TT8D Adaptor for RB PP and TenTec JUPITER and OMNI VII 10 95 A CIVICBL Cable for RIGtalk and Cl V Icom and OMNI VI OMNI VI and Paragon II TenTec radios 10 95 A WIN RADIO RECEIVERS CAT 8D CBL CAT cable for Yae
434. upply for any BHI unit 500mAh 12V DC unregulated 2 1mm DC plug Vehicle power adaptor Vehicle power adaptor 6m long Spare DC lead for any BHI unit 2m long with in line fuse 2 way vehicle power adaptor Audio extension lead Audio extension lead 3m long Mono earpiece Spare knob for NEIM1031 NES10 2MK3 Extension speaker 8W 8 Ohms Extension speaker 20W 4 Ohms ANR noise cancelling headphones NC 4 Vertical or horizontal acrylic stand for NEIM 1034 Stereo headphones with adaptor for 3 5mm socket inc ADP S001 2 5mm mono jack plug to 2 5mm mono jack plug 1 2m long 3 5mm mono jack plug to 3 5mm mono jack plug 1 2m long 3 5mm mono jack plug to 3 5mm mono jack plug 2 5m long Phono to phono lead 1 2m long 3 5mm stereo 2 x phono lead 1 2m long 3 5mm mono to phono lead 1 2m long Phono plug to 2 phono plugs 1 2m long Adaptor 1 4 stereo jack plug to 3 5mm mono jack socket Adaptor 3 5mm stereo jack plug to 3 5mm mono jack socket Adaptor phono plug to 3 5mm mono jack socket Adaptor 2 5mm mono jack plug to 3 5mm mono jack socket Adaptor 2 5mm stereo jack plug to 3 5mm mono jack plug needs ADP P003 Aircraft 2 pin headphone adaptor Phono plug to 3 5mm stereo socket Adaptor 3 5mm stereo jack socket to 3 5mm mono jack plug Adaptor 1 4 mono jack socket to 3 5mm mono jack plug Adaptor 1 4 stereo jack socket to 3 5mm mono jack plug Adaptor 2 5mm stereo jack socket to 3 5mm mono jack plug Adaptor 2 5mm mono jack socket to 3 5mm mono jac
435. upression choke for LMR600 4 pack Ferrtite supression choke combination pack of 9 RFI choke kit 4 pieces No need to take off plugs Low Pass Filter 200W 1 5 30MHz 50 Ohm Low Pass Filter 1 5 KW 1 8 30 MHz 50 OHM Low pass TVI filter 2500 Watts Emergency communications box for IC 706 needs power source includes ATU High pass filter 75 Ohm Not suitable for UK use ntermod fighter PL 259 Audio filter SSB CW a Ultrafast intelligent charger for AA AAA C D 9V amp 18650 NiMH Alkaline and Li ion batteries 24 95 29 95 25 95 79 95 115 95 7 95 1 95 22 95 22 95 9 95 9 95 6 95 6 95 8 95 9 95 9 95 40 95 40 95 44 95 40 95 4 95 21 95 21 95 1 95 6 95 1 95 1 95 39 95 44 95 24 95 44 95 48 95 44 95 36 95 44 95 34 95 68 95 16 95 33 95 77 95 77 95 77 95 77 95 77 95 77 95 72 95 72 95 64 95 79 95 84 95 54 95 49 95 225 95 52 95 52 95 73 95 89 95 99 95 05 95 99 95 89 95 99 95 14 95 02 95 29 95 05 95 59 95 29 95 94 95 99 95 99 95 239 95 39 95 29 95 39 95 79 95 17 95 29 95 05 95 05 95 29 95 43 95 27 95 22 95 78 95 78 95 194 95 219 95 159 95 44 95 53 95 134 95 159 95 244 95 136 95 148 95 203 95 223 95 99 95 3 95 14 95 4 95 17 95 5 95 19 95 6 95 24 95 37 95 29 95 53 95 67 95 142 95 399 95 32 95
436. ut fixing SMA plug for RG 58 SMA plug for RG 174 crimp type solder centre SMA plug large entry for Westflex 103 crimp type SMA plug for RG 58 crimp type TNC plug for RG 58C U 5 5mm max TNC plug for RG 58C U 5 5mm max crimp type SMA in line socket for RG 58 crimp type SMA in line socket for RG 174 316 crimp type FME crimp plug for RG 58 Adaptor FME plug to SMA plug F plug twist on type TV coax plug in line TV coax socket in line Y splitter one plug to two sockets Adaptor TV aerial plug to F socket Adaptor TV aerial plug to F plug Adaptor TV aerial socket to F socket Adaptor TV aerial socket to F plug Adaptor F socket to F socket joins 2 x F plugs Adaptor TV aerial socket to TV aerial socket joins 2 x TV plugs Adaptor TV aerial plug to TV aerial plug joins 2 x TV sockets Adaptor SMA socket to SMA socket Adaptor SMA plug to SMA plug Adaptor SMA socket to reverse SMA plug F type 3 way aerial splitter Adaptor SO 239 to mini UHF plug Adaptor BNC socket to mini UHF plug Adaptor SMA socket to BNC socket Adaptor SMA plug to BNC socket Adaptor SMA socket to SO 239 Adaptor SMA plug to SO 239 Adaptor SMA plug to N socket Adaptor SMA socket to N socket Adaptor SMA socket to N plug Adaptor SMA socket to BNC plug Adaptor SMA socket to PL 259 plug Adaptor BNC plug to F socket Adaptor BNC socket to F plug Adaptor BNC plug to phono socket Adaptor PL 259 plug to BNC socket Adaptor PL 259 to BNC socket right
437. ut out plug 2 5mm long barrel DC battery cut out plug 3mm DC battery cut out plug Car radio aerial plug Plastic in line fuse holder for 5 x 20mm and 6 3 x 32mm fuses Plastic in line 1 1 4 inch fuse holder with fitted wire ends 3 Amp with fuse Plastic in line 1 1 4 inch fuse holder with fitted wire ends 5 Amp Din plug 13 pin Din plug 8 pin circular 270 degrees Din plug 8 pin off set 262 degrees Din plug 7 pin same as Kenwood E07 0751 25 Din plug 5 pin 180 degrees Din plug 5 pin domino type pin configuration Din plug 5 pin 240 degrees Din plug MINI 5 pin Din plug MINI 6 pin Din plug MINI 8 pin Chrome plated cover for D plug or socket eg 150 0520 or 150 0515 or 150 3243 D socket 9 way needs 150 2349 D plug 9 way needs 150 2349 High density D plug 15 way needs 150 2349 High quality metal XLR 3 pin in line plug High quality metal XLR 3 pin in line socket High quality metal XLR 4 pin in line plug High quality metal XLR 4 pin in line socket XLR 3 pin chassis socket Medium duty crocodile clip insulated handle 5 Amp maximum RED Medium duty crocodile clip insulated handle 5 Amp maximum RED Heavy duty crocodile clip insulated handle 15 Amp maximum RED Heavy duty crocodile clip insulated handle 15 Amp maximum BLACK Heavy duty crocodile clip insulated handle 50 Amp maximum RED Heavy duty crocodile clip insulated handle 50 Amp maximum BLACK Ad Ad Ad pi pi pi pi pi pi pi pi pi pi pi Adapt pi pi
438. ver kit 1 Watt 20m band CW QRP transceiver kit 1 Watt 30m band CW QRP transceiver kit 1 Watt 40m band CW QRP transceiver kit 1 Watt 80m band CW QRP transceiver kit 1 Watt 15m band CW QRP transceiver assembled 1 Watt 17m band CW QRP transceiver assembled 1 Watt 20m band CW QRP transceiver assembled 1 Watt 30m band CW QRP transceiver assembled 1 Watt 40m band CW QRP transceiver assembled 1 Watt 80m band CW QRP transceiver assembled 2m SSB 7 Watts PEP 144 144 3MHz without microphone 2m SSB 7 Watts PEP 144 144 3MHz with microphone 6m SSB rig 10W PI 6m SSB rig 10W P EP without microphone EP with microphone 10m SSB rig 20 Watts PEP without microphone 10m SSB rig 20 Wai 20m SSB rig 12 Wal 20m SSB rig 12 Wal 40m SSB rig 12 Wal 40m SSB rig 12 Wai 80m SSB rig 12 Wal 80m SSB rig 12 Watts wi Mmode USB interface ow ssb am fm RTT Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microham radio cal Microha
439. verted V 4 1 50 Ohm balun 400 Watts for folded dipoles 6 1 50 Ohm balun 400 Watts for folded dipoles 30m braided white polypropylene nylon cord 3mm will not stretch or rot 30m braided white polypropylene nylon cord 4mm will not stretch or rot 30m braided white polypropylene nylon cord 6mm will not stretch or rot 30m braided black polypropylene nylon cord 3 5mm will not stretch or rot up to 330KG load 30 95 25 95 21 95 22 95 18 95 26 95 36 95 46 95 24 95 29 95 42 95 209 95 259 95 69 95 54 95 59 95 35 95 25 95 24 95 19 95 49 95 34 95 49 95 19 95 29 95 29 95 29 95 8 95 16 95 30 95 12 95 Medium duty guy kit stakes rope grips wire thimbles turn buckles 30m guy rope 3 way guy hook 29 95 Heavy duty guy kit stakes rope grips wire thimbles turn buckles 30m guy rope 3 way guy hook 49 95 G5RV choke balun 1 1 1 38MHz 400 Watts 50 Ohms Dipole centre piece for 50 Ohm coax Centre piece for G5RV SO 239 to ribbon wire Dipole centre piece for 300 Ohm ribbon Straight dipole center 2 x 3 8ths mobile thread 1 x SO 390 Right angled V dipole center 2 x 3 8ths mobile thread 1 x SO 390 WATSON STATION ACCESSORIES TravelPaddle DAB OMNI FERRITE DAB DIR 3 DAB DIR 5 WAT 7515 MW 3392 MW 274 MW 276 MW 233 ER MKII CP ER MKII SC HPF 450 WAM 599 WRP M100 WRP 1300MKII WRP 2500 USB AB SL9 9 SL9 25 26 4787 261 0887 USB MINI 4 USB MINI 5 CAB 184
440. w 30m coax 359 95 AT 144 HF automatic aerial tuner 579 95 MN 100 Antenna matcher comes with 2 x 8m antenna wires 229 95 OPC 1465 Shielded control cable 46 95 OPC 1466 Separation cable 31 95 OPC 478 Cloning cable PC to transceiver 28 95 OPC 478UC Cloning cable for radio to PC USB cable 46 95 HM 135 hand speaker microphone for IC M801 67 95 HS 98 Telephone handset 154 95 MB 108 Mounting bracket for IC M801 main transceiver unit 219 95 MB 75 Flush mount kit 21 95 RC 25 Remote controller 289 95 SP 24 External speaker 35 95 CS M801 Programming software for IC M801 on CD ROM 79 95 SM M801 Service manual for IC M801 on CD 69 95 ICOM PMR 446 HANDHELD TRANSCEIVERS AND ACCESSORIES IC 4088SR PMR446 transceiver c w dry cell case Listed 105 95 IC 4088SR CP PMR446 transceiver c w charger 4 x AA rechargeable batteries 119 95 AD 105 Charger adaptor for BC 119N 121N and IC 4088SR 14 95 BC 06 UK mains PSU for BC 119N fast charger 18 95 BC 119LM 446S Twin fast charger for 2 x BP 202M includes BC 06 41 95 BC 149N IC4088 Fast charger includes AD 105 amp BC 145 for IC 4088SR 66 95 BC 121N IC4088 6 way fast charger including 6 x AD 105 adaptors and BC 124 for IC 4088SR 389 95 BC 145 Spare mains PSU for BC 119N 14 95 BC 157 Spare mains PSU for BC 121N 94 95 CP 18E Cigarette lighter cable for IC 4088SR 21 95 BP 202M Rechargeable battery for IC 4088SR 3 6V 1400mAh 15 95 BELT 014 Spare belt clip for IC 4088SR 2 95 HM 5
441. wi 10m single band folded dipole aerial wi i a direct coax feed i 17m single band folded dipole aerial wi i i a direct coax feed a direct coax feed 20m single band folded dipole aerial with a direct coax feed 30m single band folded dipole aerial with a direct coax feed 40m single band folded dipole aerial with a direct coax feed Rotary dipole 40 20 15 10 6 2m 14 feet long 1 5KW Warc bands version of MFJ 1775 40 20m dipole 80 40m dipole 6m dipole aerial 160 6m Allband Doublet 102ft 1500wai G5 RV aerial 160 10m 102 feet long G5 RV Junior 10 40m 1500W 52 feet long Single band dipole 265 feet long 160m Single band dipole you adjust it for either 40 or 80m dipole 135 feet long Single band dipole you adjust it for either 20 or 6m dipole 35 feet long Portable Box fan loop 14 30MHz continuous 20 10m Super loop antenna 10 30MHz continuous 30 10m Rotary dipole 80 40 20m 33 feet long 1 5KW balun included Super loop antenna 10 30MHz continuous 30 10m with remote control amp PSU Super loop antenna 7 21MHz continuous 15 40m with remote control amp PSU Stainless steel antenna whip 10 feet long was MFJ 1954 80 40 metre vertical 80 40 20 metre vertical Compact HF vertical 40 20 15 amp 10m 1500 Watts PEP Warc bands version of MFJ 1795 2 6 10 15 20 and 40m vertical antenna 12 17 30 amp 60m vertical antenna 10 12 15 17 20 30 40 vertical 24 hig 10 12 15 17 20 30 40 compact low profile vertical 9 high 2 6 10 12 15 17 20 30
442. wireless band monitor receiver kit VEC 1000KC Metal case for VEC 1002 06 10 12 16K VEC 1120K 20m receiver kit VEC 1130K 30m receiver kit VEC 1140K 40m receiver kit VEC 1180K 80m receive kit VEC 1100KC Metal case for VEC 1120 30 40 80K VEC 1202K 5 Watt 2m FM transmitter kit VEC 1202KC Metal case for VEC 1202K VEC 1220K 20m QRP transmitter kit VEC 1230K 30m QRP transmitter kit VEC 1240K 40m QRP transmitter kit VEC 1280K 80m QRP transmitter kit VEC 1200KC Metal case for VEC 1220 30 40 80K VEC 1320K 20m transceiver kit VEC 1330K 30m transceiver kit VEC 1340K 40m transceiver kit VEC 1380K 80m transceiver kit 83 95 37 95 19 95 239 95 199 95 139 95 499 95 79 95 99 95 99 95 61 95 64 95 89 95 97 95 239 95 249 95 87 95 64 95 109 95 89 95 29 95 34 95 92 95 141 95 104 95 82 95 82 95 299 95 99 95 109 95 109 95 99 95 89 95 89 95 99 95 88 95 199 95 46 95 109 95 299 95 34 95 39 95 99 95 69 95 109 95 219 95 74 95 279 95 119 95 29 95 17 95 84 95 95 95 26 95 31 95 17 95 26 95 17 95 69 95 17 95 49 95 17 95 29 95 17 95 22 95 17 95 22 95 17 95 31 95 17 95 22 95 17 95 36 95 17 95 36 95 36 95 36 95 36 95 36 95 17 95 31 95 31 95 31 95 31 95 17 95 99 95 17 95 31 95 31 95 31 95 31 9
443. with HC 6 insert needs AD 1 Large dual headphones boom microphone with Icom element comes with AD 1 IC8 Large dual headphones boom mic with HC 6 element and Heil PI Large dual headphones boom mic with IC element amp Heil Phase Reversal comes with AD 1 IC8 Large dual headphones boom microphone for Elecraft with AD 1 K8 Pro Set Media state of the art computer boomset with electret insert needs AD 1 Boom microphone for QUIET PHONE PRO with HC 6 insert needs AD 1 Boom microphone for QUIET PHONE PRO with HC IC insert needs AD 1 Optional base for Heritage studio microphone with soft touch PTT switch Deluxe PTT foot switch for all microphones Budget PTT dual foot switch for all microphones ase Reversal System needs AD 1 1 329 95 1 229 95 leritage studio classic vocal microphone 600 Ohm balanced 3 pin XLR needs CC 1XLR 159 95 199 95 199 95 219 95 219 95 219 95 199 95 219 95 99 95 99 95 29 95 44 95 34 95 27 95 124 95 29 95 29 95 29 95 56 95 59 95 59 95 16 95 99 95 99 95 19 95 19 95 35 95 5 95 5 95 89 95 62 95 69 95 18 95 9 95 9 95 6 95 14 95 6 95 7 95 7 95 7 95 7 95 9 95 14 95 22 95 49 95 9 95 12 95 159 95 69 95 79 95 79 95 99 95 99 95 114 95 249 95 249 95 164 95 179 95 34 95 34 95 34 95 119 95 39 95 94 95 09 95
444. y YGVU BK Your Guide To VHF UHF Amateur Radio by lan Poole UBAN BK Basic Antennas ARRL ANTB BK ARRL Antenna Book 21st Edition ON4U BK ARRL ON4UN s Low Band DX ing 5th Edition TASA BK The ARRL Satellite Anthology ARDX BK The ARRL DXCC Lisi SAFA BK Simple amp Fun Antennas PRAC BK Practical Projects VHFH BK VHF Contesting Handbook PRPR BK Packet Radio Primer 2nd edition YFPS BK Your First Packet Station 1st edition TRAS BK The Radio Amateurs Satellite Handbook ARMH BK The Amateur Radio Mobile Handbook WMHB BK Microwave Handbook Volume 3 WATF BK World At Their Fingertips 1st edition RIAR BK Reflections In A Rosebowl TERA BK Test Equipment For The Radio Amateur 3rd edition PRFB BK Practical Receivers For Beginners CB2015 BK RSGB Year Book with free CD Biggest ever 544 pages 2015 edition CD ROM RSGB TSOE CD The Story Of Enigma CD TCCD CD Telegraph Collectors CD RV3953 CD ROM set of RADCOMS 1939 53 RV5363 CD ROM set of RADCOMS 1954 63 RV6469 CD ROM set of RADCOMS 1964 69 RV7075 CD ROM set of RADCOMS 1970 75 RV7680 CD ROM set of RADCOMS 1976 80 RV8185 CD ROM set of RADCOMS 1981 85 RV8690 CD ROM set of RADCOMS 1986 90 RV9195 CD ROM set of RADCOMS 1991 95 RC 00 CD ROM of all 2000 RADCOMS RC 01 CD ROM of all 2001 RADCOMS RC 02 CD ROM of all 2002 RADCOMS RC 03 CD ROM of all 2003 RADCOMS RC 04 CD ROM of all 2004 RADCOMS RC 05 CD ROM of all 2005 RADCOMS RC 06 CD ROM of all 2006 RADCOMS RC 07 CD ROM of all 2007 R
445. z KP 1 6M 6m pre amplifier in shack type 50 52MHz KP 1 2M 2m pre amplifier in shack type 144 148MHz KP 1 440 70cm pre amplifier in shack type 420 470MHz KP 2 10M 10m masthead pre amplifier 28 30MHz KP 2 6M 6m masthead pre amplifier 50 52MHz KP 2 2M 2m masthead pre amplifier 144 148MHz KP 2 440 70cm masthead pre amplifier 420 470MHz MIRAGE REMOTE CONTROL RC 1 Remote for Mirage amplifiers on off power pre amp SSB FM RC 2 Remote for Mirage amplifiers on off power pre amp SSB FM for 5018 2518 MIRAGE SWRIWATT METERS MP 2 MIRAGE HF Wattmeter 50 200MHz MP 3 UHF Wattmeter 420 450MHz MP 4 UHF Wattmeter 1260 1300MHz MP 13 SWR Watt meter 140 525MHz 200 Watts 138 95 119 95 207 95 151 95 234 95 224 95 179 95 49 95 69 95 174 95 184 95 214 95 99 95 192 95 182 95 284 95 102 95 169 95 129 95 219 95 203 95 223 95 289 95 199 95 234 95 139 95 139 95 249 95 429 95 1 299 95 229 95 162 95 239 95 619 95 1 699 95 289 95 499 95 695 95 417 95 119 95 1 95 139 95 264 95 529 95 439 95 429 95 429 95 799 95 799 95 209 95 11 95 11 95 11 95 11 95 11 95 11 95 214 95 324 95 474 95 444 95 464 95 414 95 609 95 499 95 659 95 724 95 724 95 724 95 694 95 216 95 175 95 324 95 356 95 458 95 164 95 164 95 164 95 164 95 214 95 214
446. z CWIRTTY filter 500Hz for IC 718 399 95 67 95 19 95 4 699 95 5 795 00 9 95 41 99 114 95 228 95 259 95 98 95 2 499 95 295 95 331 95 41 95 114 95 228 95 99 95 139 95 98 95 20 95 399 95 75 00 1 449 95 295 95 331 95 52 95 52 95 41 95 228 95 114 95 154 95 99 95 139 95 98 95 19 95 399 95 4 699 95 36 95 63 95 1 079 95 399 95 290 95 331 95 1 379 95 515 95 31 95 228 95 114 95 4 699 95 41 95 41 95 46 95 46 95 46 95 tba 799 95 279 95 18 95 47 95 15 95 42 95 98 95 47 95 52 95 99 95 21 95 36 95 21 95 47 95 16 95 279 95 290 95 331 95 515 95 18 95 11 95 11 95 57 95 36 95 46 95 67 95 19 95 19 95 21 95 36 95 155 95 51 95 46 95 46 95 98 95 63 95 359 95 839 95 290 95 331 95 352 95 515 95 41 95 155 95 36 95 51 95 181 95 99 95 90 95 62 95 12 95 31 95 75 00 569 95 290 95 334 95 359 95 519 95 179 95 TO T T OOO T TOH TOHO OOO OOO OOO OOO GOGO OOO GOGO GO OOO GOGO OOO mO GO T TGO CG0 GOGO GOGO OT OOO TEO OGO GOGO GOGO GOOOOOOOOO T K K T KO T T TG GG FL 53A FL 96 FL 222 FL 257 HM 36 SM 20 MB 23 OPC 599 SP 20 SP 21 UT 106 CR 338 CT 17 SM 718 OPC 025A 455KHz CWIRTTY filter 250Hz for IC718 SSB wide filter 2 8KHz for IC
447. z RX 10W 40 5cm long SMA 2m antenna 2 5cm long Reverse SMA for Wouxun Quansheng 2m 70cm rubber duck antenna 6W SMA 120 300 VHF UHF airband receive and transmit dualband flexible whip 4 5cm long SMA 2m 70cm dualband flexible whip 10W 21cm long SMA 2m 70cm dualband handheld antenna 15cm long SMA 2m 70cm RX 118 900MHZz flexible whip 10W 19cm long SMA 2m 70cm RX 118 900MHZz flexible whip 10W 40cm long SMA 2m 70cm RX 118 900MHZz telescopic whip 10W 44cm max long with hinge SMA 95 1100MHz wide band receive telescopic whip 80 5cm max long with hinge SMA 2m 70cm dualband mini handheld antenna 4 5cm long SMA 6m 2m 70cm flexi 109mm long 6W wide band receive 150 300 450 800 900MHz SMA 6m 2m 70cm flexi 45cm long wide band receive 150 300 450 900MHz SMA 6m 2m 70cm 23cm 4 band handheld antenna 50cm long wide band receive SMA 2m 70cm flexible whip 6W 7 5cm long SMA 2m 70cm flexible whip 10W 40cm long Reverse SMA for Wouxun Quansheng 2m 70cm rubber duck antenna 10W 40 5cm long SMA 139 399MHz flexible whip receive only 40 5cm long BNC UHF 350 520MHz handheld antenna 10 Watts 19cm long with cutting chart SMA UHF 350 520MHz handheld antenna 10 Watts 19cm long with cutting chart SMA VHF 137 174MHz handheld antenna 10 Watts 40cm long with cutting chart NC VHF 137 174MHz handheld antenna 10 Watts 19cm long with cutting chart Low profile BNC plug to SMA socket adaptor black in colour Low profile BNC socket to SMA plug adaptor black in colour Low profile

Download Pdf Manuals

image

Related Search

Related Contents

Init PR-TVPF004 User's Manual  Using the System  HP 24uh  Compos X - 株式会社メトラン  lcd tv service manual - Pdfstream.manualsonline.com  Bedienungsanleitung ACX 200 WiFi  Manual de Usuario  SonoCalc® IMT 4.0.0  L04B-- / L24E-- ISTRUZIONI D`USO  

Copyright © All rights reserved.
Failed to retrieve file