Operating Instructions - SEW
Contents
1. 15 Cyclic duration factor 27 D Designated use u a S Spa aaa use 5 Digital inputs 18 Digital outputs seoser iii i 18 Dimension drawing 33 Dimensions u u sess 33 E equipotential bonding 19 Error memory sssssee eene 28 F Fault information Juan amanaya iskuta shaqta 28 G Grounding 18 19 Installation 15 Installation notes 15 Integrated components SEW field controller 14 M Maintenance 30 Minimum clearance 15 Motor cables 11 Motors aa a ua 26 MOUNINO 19 Mounting position 16 N Nameplate ahi qu 8 Non designated 5 Operating modes 27 Operating notes ssssesseeee 27 Operating principle 12 Operational environment 5 P Part number2. C nai Ss Ill G MOVIPRO PHC11A A040MI1 P00K 01 GC710000 Edition 10 2006 11521813 EN Operating Instructions SEW EURODRIVE Driving the world 1 Important Notes 4 ET lm S 6 3 Unit Design l rnit 8 SU Nameplate i enne e dba da tenn CR RR ha o Ree 8 32 Utaona ersteren desires 9 3 3 Scope of delivery ans 10 3 4 E etr en 12 3 5 Operating Principle oo uuu aaa eene nnne nennen nene 12 3 6 Power ClectrOniCS serre three but re e datos 13 8 7 Gontrolitechnology uuu eere e P e i ar eue eb rt dfe 14 4 EIC LoT 15 441 Installation cie de inte e hene eae ea 15 4 2 ene 21 4 3 Wiring diagrama u L ua Spa aaa apa Sha eren nennen nnns 21 Ec 26 Bly Generalirioles 26 5 2 Motors and brakes 26 6 Operation and Service l l l u u u J 27 6 1 Operating Notes 27 6 2 Faultinferimallofii u Lae EES ee eter e oa eg 28 6 3 lee una iis 30 6 4 Transportation ul 30 Ee TE un cetur nre diee 30 6 6 Maintenance a a panau akaun a nnns innen neret a aa a 30 f Technical D
3. 4 Installation Wiring diagrams Assignment 20x1 ProfiBus in M12 B coded pins 1 2 22 60251AXX Figure 11 ProfiBus in M12 5 pole B coded pins PIN Assignment Function 1 N C 2 A Data line 3 N C 4 B Data line 5 N C Assignment 20X14 RS485 connection for RS485 interface M12 A coded socket 3 4 O O O 2 1 60254AXX Figure 12 Connection for RS485 interface M12 5 pole A coded socket PIN Assignment Function 1 VO24V 24 V supply voltage 2 RS485 RS 3 0V24 Reference potential 24V 4 RS485 RS 5 N C _ Assignment 20x13 RS232 service M12 A coded socket 3 4 O O O 2 1 60254AXX Figure 13 RS232 service M12 5 pole A coded socket PIN Assignment Function 1 VO24V 24 V voltage supply 2 TxD RS 3 0V24 Reference potential 4 RxD RS 5 N C Operating Instructions MOVIPRO PHC11A A040M1 P00K 01 Installation Wiring diagrams Assignment 10X1 Motor connection HAN Q8 socket JE Pasal OCG mes ee e 57664AXX Figure 14 Motor connection 5 pole HAN Q8 socket Terminal Assignment Function 10X1 1 U Motor connection phase U 10X1 2 BG 0 14 Brake with high speed excitation 10X1 3 w Motor connection phase W 10X1 4 BG 0 15 0V24 brake 10X1 5 FU Ref 10V TF TH 10X1 6 BG 13 Brake 24 V 10X1 7 V Motor connection phas
4. The unit output may only be switched when the output stage of the inverter is inhibited 6 2 Fault information Only the manufacturing company is authorized to carry out repairs In case of malfunction contact SEW EURODRIVE GmbH amp Co KG for information on how to proceed Fault memory The error memory P080 stores the last five error messages errors t 0 to t 4 The error message of longest standing is deleted whenever more than five error messages have occurred The following information is stored when a malfunction occurs Error which has occurred Status of binary inputs outputs Operating status of the inverter Inverter status Heat sink temperature Speed Output current Active current Unit utilization DC link voltage Hours of operation Enable hours Parameter set Motor utilization Operating Instructions MOVIPROG 1 4 1 CZ ini Operation and Service SS Fault information lt Switch off responses Immediate stop Rapid stop Emergency stop Reset Timeout active There are three switch off responses depending on the error The inverter remains inhibited in fault status The unit can no longer brake the drive the output stage goes to high resistance in the event of a fault and the brake is applied immediately DBOO Brake 0 The drive is braked with the stop ramp t13 t23 The brake is applied once the stop speed is
5. 4 Installation 4 1 Installation notes Minimum clearance Cooling Installation Comply with the general safety notes during installation During installation provide adequate space on the connection panel for the connection cables in accordance with the dimension drawing page 33 Make sure that the heat sink segments can dissipate heat by means of free convection When attaching the unit to a mounting plate the best dissipation properties can be achieved by Using a mounting plate that is the same size as the unit itself Ensuring that the highest cooling fin is at least 25 mm away from the mounting plate The unit is fitted with bends on the front end for mounting These bends can be used to attach suitable mounting elements e g T slot nuts screws with appropriate screw heads The units can be installed in two ways Version A Screws are secured to the PHC housing from the back through the fastening elements Version B Screws are secured to the PHC housing from the front through the fastening element Operating Instructions MOVIPRO 1 4 1 15 4 Installation Installation notes The following figure shows the mounting hole positions EN 1 2 3 4 5 SEW EURODAWE voa SEW EURODRVE MOVPRO SEW EURODRVE MOVIPRO sew urcoave MOVIPRO A B 60214AXX F
6. Thailand Assembly Chon Buri SEW EURODRIVE Thailand Ltd Tel 66 38 454281 Sales Bangpakong Industrial Park 2 Fax 66 38 454288 Service 700 456 Moo 7 Tambol Donhuaroh sewthailand sew eurodrive com Muang District Chon Buri 20000 Tunisia Sales Tunis T M S Technic Marketing Service Tel 216 1 4340 64 1 4320 29 7 rue Ibn El Heithem Fax 216 1 4329 76 tms tms com tn 2014 M grine Erriadh Turkey Assembly Istanbul SEW EURODRIVE Tel 90 216 4419163 164 3838014 15 Sales Hareket Sistemleri San ve Tic Ltd Sti Fax 90 216 3055867 Service Bagdat Cad Koruma Cikmazi No 3 sew sew eurodrive com tr TR 34846 Maltepe ISTANBUL Ukraine Sales Dnepropetrovsk SEW EURODRIVE Tel 380 56 370 3211 Service Str Rabochaja 23 B Office 409 Fax 380 56 372 2078 49008 Dnepropetrovsk http www sew eurodrive ua sew sew eurodrive ua USA Production Greenville SEW EURODRIVE INC Tel 1 864 439 7537 Assembly 1295 Old Spartanburg Highway Fax Sales 1 864 439 7830 Sales P O Box 518 Fax Manuf 1 864 439 9948 Service Lyman S C 29365 Fax Ass 1 864 439 0566 Telex 805 550 http www seweurodrive com cslyman seweurodrive com Address List 1 USA Assembly San Francisco SEW EURODRIVE INC Tel 1 510 487 3560 Sales 30599 San Antonio St Fax 1 510 487 6381 Service Hayward California 94544 7101 cshayward seweurodrive com Philadelphia PA SEW EURODRIVE INC Tel 1 856 467 2277 Pureland Ind Complex
7. 00 Parc d Affaires Roosevelt Fax 433 4 72 15 37 15 Rue Jacques Tati F 69120 Vaulx en Velin Paris SEW USOCOME Tel 33 1 64 42 40 80 Zone industrielle Fax 33 1 64 42 40 88 2 rue Denis Papin F 77390 Verneuil l Etang Additional addresses for service in France provided on request Algeria Sales Alger R ducom Tel 213 21 8222 84 16 rue des Fr res Zaghnoun Fax 213 21 8222 84 Bellevue El Harrach 16200 Alger Argentina Assembly Buenos Aires SEW EURODRIVE ARGENTINA S A Tel 454 3327 4572 84 Sales Centro Industrial Garin Lote 35 Fax 54 3327 4572 21 Service Ruta Panamericana Km 37 5 sewar sew eurodrive com ar 36 Address List 1 Australia Assembly Melbourne SEW EURODRIVE PTY LTD Tel 61 3 9933 1000 Sales 27 Beverage Drive Fax 61 3 9933 1003 Service Tullamarine Victoria 3043 http www sew eurodrive com au enquires sew eurodrive com au Sydney SEW EURODRIVE PTY LTD Tel 61 2 9725 9900 9 Sleigh Place Wetherill Park Fax 61 2 9725 9905 New South Wales 2164 enquires sew eurodrive com au Townsville SEW EURODRIVE PTY LTD Tel 61 7 4779 4333 12 Leyland Street Fax 61 7 4779 5333 Garbutt QLD 4814 enquires sew eurodrive com au Austria Assembly Wien SEW EURODRIVE Ges m b H Tel 43 1 617 55 00 0 Sales Richard Strauss Strasse 24 Fax 43 1 617 55 00 30 Service A 1230 Wien http sew eurodrive at sew sew eurodrive at Belgium
8. 7139253 Katlakalna 11C Fax 371 7139386 LV 1073 Riga http www alas kuul com info alas kuul com 39 40 i Address List Lebanon Sales Beirut Gabriel Acar Fils sarl Tel 961 1 4947 86 B P 80484 961 1 4982 72 Bourj Hammoud Beirut 961 3 2745 39 Fax 961 1 4949 71 gacar beirut com Lithuania Sales Alytus UAB Irseva Tel 370 315 79204 Naujoji 19 Fax 370 315 56175 LT 62175 Alytus info irseva lt http www sew eurodrive lt Luxembourg Assembly Br ssel CARON VECTOR S A Tel 32 10 231 311 Sales Avenue Eiffel 5 Fax 32 10 231 336 Service B 1300 Wavre http www caron vector be info caron vector be Malaysia Assembly Johore SEW EURODRIVE SDN BHD Tel 60 7 3549409 Sales No 95 Jalan Seroja 39 Taman Johor Jaya Fax 60 7 3541404 Service 81000 Johor Bahru Johor sales sew eurodrive com my West Malaysia Mexico Assembly Queretaro SEW EURODRIVE MEXIKO SA DE CV Tel 52 442 1030 300 Sales SEM 981118 M93 Fax 52 442 1030 301 Service Tequisquiapan No 102 http www sew eurodrive com mx Parque Industrail Queretaro scmexico seweurodrive com mx C P 76220 Queretaro Mexico Morocco Sales Casablanca Afit Tel 212 22618372 5 rue Emir Abdelkader Fax 212 22618351 MA 20300 Casablanca richard miekisiak premium net ma Netherlands Assembly Rotterdam VECTOR Aandrijftechniek B V Tel 31 10 4463 700 Sales Industrieweg 175 Fax 31 10 41
9. Fax 1 856 845 3179 2107 High Hill Road P O Box 481 csbridgeport seweurodrive com Bridgeport New Jersey 08014 Dayton SEW EURODRIVE INC Tel 1 937 335 0036 2001 West Main Street Fax 1 937 440 3799 Troy Ohio 45373 cstroy seweurodrive com Dallas SEW EURODRIVE INC Tel 1 214 330 4824 3950 Platinum Way Fax 1 214 330 4724 Dallas Texas 75237 csdallas seweurodrive com Additional addresses for service in the USA provided on request Venezuela Assembly Valencia SEW EURODRIVE Venezuela S A Tel 58 241 832 9804 Sales Av Norte Sur No 3 Galpon 84 319 Fax 58 241 838 6275 Service Zona Industrial Municipal Norte http www sew eurodrive com ve Valencia Estado Carabobo sewventas cantv net sewfinanzas cantv net 43 Gearmotors Industrial Gear Units Drive Electronics Drive Automation Services How we re driving the world H au With people who With comprehensive With uncompromising think fast and With a worldwide With drives and controls knowledge in virtually quality that reduces the develop the service network that is that automatically every branch of cost and complexity of future with you always close at hand improve your productivity industry today daily operations YW m SEW EURODRIVE Driving the world eg ke dc n With a global presence With innovative With online information that offers responsive technology that solves and software updates and reliable solutions tomorrow s pro
10. No 4 Gide Fax 91 265 2831087 Service Por Ramangamdi Baroda 391 243 http www seweurodriveindia com Gujarat mdoffice seweurodriveindia com Technical Offices Bangalore SEW EURODRIVE India Private Limited Tel 91 80 22266565 308 Prestige Centre Point Fax 91 80 22266569 7 Edward Road salesbang seweurodriveinindia com Bangalore Ireland Sales Dublin Alperton Engineering Ltd Tel 353 1 830 6277 Service 48 Moyle Road Fax 353 1 830 6458 Dublin Industrial Estate Glasnevin Dublin 11 Israel Sales Tel Aviv Liraz Handasa Ltd Tel 972 3 5599511 Ahofer Str 34B 228 Fax 972 3 5599512 58858 Holon lirazhandasa barak online net Italy Assembly Milano SEW EURODRIVE di R Blickle amp Co s a s Tel 39 02 96 9801 Sales Via Bernini 14 Fax 39 02 96 799781 Service 20020 Solaro Milano http www sew eurodrive it sewit sew eurodrive it Ivory Coast Sales Abidjan SICA Tel 225 2579 44 Ste industrielle et commerciale pour l Afrique Fax 4225 2584 36 165 Bld de Marseille B P 2323 Abidjan 08 Japan Assembly Toyoda cho SEW EURODRIVE JAPAN CO LTD Tel 81 538 373811 Sales 250 1 Shimoman no Fax 81 538 373814 Service Iwata sewjapan sew eurodrive co jp Shizuoka 438 0818 Korea Assembly Ansan City SEW EURODRIVE KOREA CO LTD Tel 82 31 492 8051 Sales B 601 4 Banweol Industrial Estate Fax 82 31 492 8056 Service Unit 1048 4 Shingil Dong http www sew korea co kr Ansan 425 120 master sew korea co kr Latvia Sales Riga SIA Alas Kuul Tel 371
11. a resistance of 1 to 100 MQ is permitted for ESD protection in the stationary system section Only use shielded control cables Connect the shield by the shortest possible route and make sure it is grounded over a wide area at both ends Ground one end of the shield via suppression ca pacitor 220 nF 50 V to avoid ground loops If using double shielded cables ground the outer shield on the unit end and the inner shield on the other end Operating Instructions MOVIPRO 1A A040M1 PO00K 01 3 Unit Design Nameplate 3 Unit Design The following short name is used in this operating instruction Designation Short name MOVIPRO PHC11A A040M1 P00K 01 drive and control unit PHC11A 3 1 Nameplate Nameplate Each unit has a nameplate that provides important information TYP PHC11A i P00K 04 Sachnr 4 arte Seriennr H HOA Ji H WIR E Nr 1 300 043 T eech i 0000053 Eingang Input Ausgang Output EURODRIVE 1777 D 76646 Bruchsal U Dre MOM f 50Hz f 0 180 Hz Made in Germany 9 5AAC l 55AAC T 5 40 C IP65 P 4 0kW 5 3 HP Max Gesamtausgangsleistung 4 kVA Figure 1 Nameplate of the PHC11A U Voltage f Frequency Current T Temperature P Power 60181AXX Operating Instructions MOVIPROG PHC1 1 4 1 Unit Design Unit designation 3 2 Unit designation The units of the MOVIPRO product series have a unit designatio
12. for the power supply and control of the 24 V disc brakes system used in the motors connected to PHC11A In the PHC11A unit described in these operating instructions brake control is installed internally A brake rectifier type BMV 5 is used for the PHC11A unit When configuring the motors note that if brake motors are used an SEW brake coil must be fitted for each one When selecting the SEW brake coil note the permitted operating voltage for the brake coil The brake coil type is determined depending on the motor power Operating Instructions MOVIPRO PHC11A A040M1 POOK 01 13 14 Unit Design Control technology 3 7 Control technology Processing unit LI The PHC11A drive and control unit is equipped with a processing unit This SEW field controller is responsible for communication between PHC11A and the higher level controller It functions as a gateway between the higher level controller and the connect ed frequency inverters For a detailed descriptiion of the interfaces and the gateway functionality see the MOVIPRO Interface Description specification part number 11471417 EN To connect the SEW field controller to a ProfiBus network a suitable ProfiBus module is connected The application software can easily be loaded to the processing unit via the ProfiBus interface or RS232 diagnostic interface Operating Instructions MOVIPROG PHC1 1 4 1 Installation Installation notes
13. operating the unit The operating instructions contain important information about service and should be kept near the unit Operating Instructions MOVIPROG 1 4 1 Important Notes Designated use Non designated use MOVIPRO PHC11A A040M1 P00K 01 drive and control units are designed for station ary use in industrial and commercial systems for operating AC asynchronous motors with squirrel cage rotors These motors must be suitable for operation with frequency inverters No other loads must be connected to the units In terms of power supply the MOVIPRO PHC11A A040M1 P00K 01 drive and control units are designed for systems with direct supply that use pick ups to draw power from a line cable The components required for energy conversion are integrated in the unit Do not operate the unit until you have established that the machine complies with the EMC Directive 89 336 EEC and that the conformity of the end product has been determined in accordance with the Machinery Directive 98 37 EEC with reference to EN 60204 Observe all information on the technical data and the permitted conditions where the unit is operated The rules and regulations of the Professional Association Berufsgenossen schaft BG in particular BG rule B11 Electromagnetic fields must be observed during installation startup and operation of systems with contactless energy transfer by induc tion for use in industrial work
14. pole 0 coded socket Terminal Assignment Function 30X5 1 DI00 Digital input of field controller 30X5 2 DI01 Digital input of field controller 30X5 3 DI02 Digital input of field controller 30X5 4 DI03 Digital input of field controller 30X5 5 DI04 Digital input of field controller 30X5 6 DI05 Digital input of field controller 30X5 7 DO00 Digital output of field controller 30X5 8 DO01 Digital output of field controller 30X5 9 0V24 Reference potential 30X5 10 0V24 Reference potential 30X5 11 24V 24 V supply voltage 30X5 12 Weight Equipotential bonding Operating Instructions MOVIPRO PHC11A A040M1 P00K 01 25 5 26 General notes Startup O 5 Startup 5 1 General notes It is essential to comply with the safety notes in section 2 during startup Prerequisites for startup The following prerequisites must be met for these steps PHC11A must be connected in accordance with the instructions in the Installation section The system and connected drives must be configured correctly You can configure the PHC11A using the MOVITOOLS and MOVIVISION software PHC11A must be supplied with voltage Important Potentially fatal voltages may occur if the unit is connected incorrectly Ensure that the unit is connected as specified Appropriate safety measures must be taken to prevent the motor from starting unintentionally Moreover additional safety precautions must be
15. reached DB Brake 0 The output stage goes to high resistance after the brake reaction time has elapsed P732 P735 The drive is braked with the emergency ramp t14 t24 The brake is applied once the stop speed is reached DBOO Brake 0 The output stage goes to high resistance after the brake reaction time has elapsed P732 P735 An error message can be acknowledged by Switching the voltage supply on and off Recommendation Adhere to a minimum switch off time of 10 s Reset with parameter 840 YES or Parameter Manual reset Auto reset performs up to five unit resets with an adjustable restart time Do not use auto reset with drives where an automatic restart could represent a danger to people or units If the inverter is controlled via a communication interface fieldbus RS485 or SBus and the power was switched off and back on again or a fault reset was performed then the enable remains ineffective until the inverter receives valid data again via the interface which is monitored with a timeout Operating Instructions MOVIPRO 1 4 1 29 E Cn Operation and Service 6 B Shut down 6 3 Shut down To shut down PHC11A disconnect the unit using appropriate measures Important Dangerous voltages may still be present at the terminals and connections for up to ten minutes after switching off the PHC11A 6 4 Transportation Observe the following inst
16. the unit is operated Operating Instructions MOVIPROG PHC1 1A A040M1 PO0K 01 Unit Design 3 Power electronics Siructure The following block circuit diagram shows the connections of peripherals with MOVIPRO PHC11A RS232 M12 i SEW Feldsteuerung ProfiBus In One RS 485 Wire ProfiB SB Modul rotibus mmm i us ProfiBus Out Dig VO1 M23 Dig YO2 M3 3 R485 2 Py FU E HAN Q5 HAN Q8 n HAN Q8 XD 4 yr pe Fahrantrieb M1 Netzzuleitung 60179AXX Figure 3 Block circuit diagram 3 6 Power electronics MOVIDRIVE The MOVIDRIVE MCS20A 0040 drive inverter is not equipped with a fan It is connect MCS20A 0040 ed to the heat sink in cold plate technology drive inverter The supply voltage is DC 500 V A 24 V switched mode power supply with 4 A continu ous output power is integrated independent of the inverter electronics The MOVIDRIVE drive inverter type MCS20A 0040 serves for controlling asynchro nous motors Observe the information on the system properties and motor assignments in the MOVIDRIVE compact system manual part number 11493410 EN ee ee Brake control Brake control is responsible
17. 11 Power electronics 13 ProfiBus ID module 18 Protective measures 6 Publications u u lle 33 R Reset atul ette 29 s Safety Notes ssssssessssseeeeeennneen 6 Safety notes Installation and startup 6 Operation and service 6 Safety requirements Electrical protection 7 ESD protection 7 Interfaces aio e te ded is 7 Mechanical protection 7 Shielding sa asse 7 Scope of delivery 10 SEW field controller 14 Shielding u cei 18 Shon El aa ner Res 8 Shut down ee 30 Standards 33 Standards and certifications 33 Startup PrOCOQUIe 26 SIOI8g6 2 30 SIUC ie cate 19 Switch off response to faults 29 T Technical data Data power section output 32 Digital inputs and outputs 32 General information 31 General power section 31 Power s
18. 55 552 Service NL 3044 AS Rotterdam http www vector nu Postbus 10085 info vector nu NL 3004 AB Rotterdam New Zealand Assembly Auckland SEW EURODRIVE NEW ZEALAND LTD Tel 64 9 2745627 Sales P O Box 58 428 Fax 64 9 2740165 Service 82 Greenmount drive http www sew eurodrive co nz East Tamaki Auckland sales sew eurodrive co nz Christchurch SEW EURODRIVE NEW ZEALAND LTD Tel 64 3 384 6251 10 Settlers Crescent Ferrymead Fax 64 3 384 6455 Christchurch sales sew eurodrive co nz Norway Assembly Moss SEW EURODRIVE A S Tel 47 69 241 020 Sales Solgaard skog 71 Fax 47 69 241 040 Service N 1599 Moss http www sew eurodrive no sew sew eurodrive no Peru Assembly Lima SEW DEL PERU MOTORES REDUCTORES Tel 51 1 3495280 Sales S A C Fax 51 1 3493002 Service Los Calderos 120 124 http www sew eurodrive com pe Urbanizacion Industrial Vulcano ATE Lima sewperu sew eurodrive com pe 1 Address List Poland Assembly Lodz SEW EURODRIVE Polska Sp z o o Tel 48 42 67710 90 Sales ul Techniczna 5 Fax 48 42 67710 99 Service PL 92 518 Lodz http www sew eurodrive pl sew sew eurodrive pl Portugal Assembly Coimbra SEW EURODRIVE LDA Tel 351 231 20 9670 Sales Apartado 15 Fax 351 231 20 3685 Service P 3050 901 Mealhada http www sew eurodrive pt infosew sew eurodrive pt Romania Sales Bucuresti Sialco Trading SRL Tel 40 21 230 1328 Service str Madrid nr 4 Fax 40 21 230 71
19. 70 011785 Bucuresti sialco sialco ro Russia Assembly St Petersburg ZAO SEW EURODRIVE Tel 7 812 3332522 7 812 5357142 Sales P O Box 36 Fax 7 812 3332523 Service 195220 St Petersburg Russia http www sew eurodrive ru sew sew eurodrive ru Senegal Sales Dakar SENEMECA Tel 221 849 47 70 M canique G n rale Km 8 Route de Rufisque B P 3251 Dakar Fax 221 849 47 71 senemeca sentoo sn Serbia and Montenegro Sales Beograd DIPAR d o o Tel 381 11 347 3244 381 11 288 Ustanicka 128a 0393 PC Ko um IV floor Fax 381 11 347 1337 SCG 11000 Beograd dipar yubc net Singapore Assembly Singapore SEW EURODRIVE PTE LTD Tel 65 68621701 Sales No 9 Tuas Drive 2 Fax 65 68612827 Service Jurong Industrial Estate http www sew eurodrive com sg Singapore 638644 sewsingapore sew eurodrive com Slovakia Sales Bratislava SEW Eurodrive SK s r o Tel 421 2 49595201 Rybnicna 40 Fax 421 2 49595200 SK 83107 Bratislava http www sew sk sew sew eurodrive sk Zilina SEW Eurodrive SK s r o Tel 421 41 700 2513 ul Vojtecha Spanyola 33 Fax 421 41 700 2514 SK 010 01 Zilina sew sew eurodrive sk Bansk Bystrica SEW Eurodrive SK s r o Tel 421 48 414 6564 Rudlovsk cesta 85 Fax 421 48 414 6566 SK 97411 Bansk Bystrica sew sew eurodrive sk Slovenia Sales Celje Pakman Pogonska Tehnika d o o Tel 386 3 490 83 20 Service UI XIV divizije 14 Fax 386 3 490 83 21 SLO 3000 Celje p
20. 8Ig amp u l IIIa sasa ua iswaswikanaawassyarasyawakpasawayksquyaaapassayadayassskaqwayaya 31 72 MOVIPRO er E EE 31 7 2 Dimension 33 4 9 Additional informatlon EEN 33 8 eee 34 Betriebsanleitung MOVIPRO PHC11A A040M1 P00K 01 gt Important Notes 1 Important Notes Safety and warning instructions D P P E Always comply with the safety and warning instructions in this publication Hazard Indicates an imminently hazardous situation which if not avoided WILL result in death or serious injury Warning Indicates an imminently hazardous situation caused by the product which if not avoided WILL result in death or serious injury This symbol also indicates potential for damage to property Caution Indicates a potentially hazardous situation which if not avoided MAY result in minor injury or damage to products Note Indicates a reference to useful information e g on startup Documentation reference Indicates a reference to a document such as operating instructions a catalog or a data sheet You must adhere to the operating instructions to ensure Fault free operation Fulfillment of any rights to claim under limited warranty Therefore read the operating instructions before you start
21. 9 Service DK 2670 Greve http www sew eurodrive dk sew sew eurodrive dk Estonia Sales Tallin ALAS KUUL AS Tel 372 6593230 Mustam e tee 24 Fax 4372 6593231 EE 10620Tallin veiko soots alas kuul ee Finland Assembly Lahti SEW EURODRIVE OY Tel 358 201 589 300 Sales Vesim entie 4 Fax 358 3 780 6211 Service FIN 15860 Hollola 2 sew sew fi http www sew eurodrive fi Gabon Sales Libreville Electro Services Tel 241 7340 11 B P 1889 Fax 241 7340 12 Libreville Great Britain Assembly Normanton SEW EURODRIVE Ltd Tel 44 1924 893 855 Sales Beckbridge Industrial Estate Fax 44 1924 893 702 Service P O Box No 1 http www sew eurodrive co uk GB Normanton West Yorkshire WF6 1QR info sew eurodrive co uk Greece Sales Athen Christ Boznos amp Son S A Tel 30 2 1042 251 34 Service 12 Mavromichali Street Fax 30 2 1042 251 59 http www boznos gr info boznos gr 38 Address List 1 Hong Kong Assembly Hong Kong SEW EURODRIVE LTD Tel 852 2 7960477 79604654 Sales Unit No 801 806 8th Floor Fax 852 2 7959129 Service Hong Leong Industrial Complex sew sewhk com No 4 Wang Kwong Road Kowloon Hong Kong Hungary Sales Budapest SEW EURODRIVE Kft Tel 36 1 437 06 58 Service H 1037 Budapest Fax 36 1 437 06 50 Kunigunda u 18 office sew eurodrive hu India Assembly Baroda SEW EURODRIVE India Pvt Ltd Tel 91 265 2831086 Sales Plot
22. Assembly Br ssel SEW Caron Vector S A Tel 32 10 231 311 Sales Avenue Eiffel 5 Fax 32 10 231 336 Service B 1300 Wavre http www caron vector be info caron vector be Brazil Production Sao Paulo SEW EURODRIVE Brasil Ltda Tel 55 11 6489 9133 Sales Avenida Amancio Gaiolli 50 Fax 55 11 6480 3328 Service Caixa Postal 201 07111 970 http www sew com br Guarulhos SP Cep 07251 250 sew sew com br Additional addresses for service in Brazil provided on request Bulgaria Sales Sofia BEVER DRIVE GmbH Tel 359 2 9151160 Bogdanovetz Str 1 Fax 359 2 9151166 BG 1606 Sofia bever fastbg net Cameroon Sales Douala Electro Services Tel 237 4322 99 Rue Drouot Akwa Fax 237 4277 03 B P 2024 Douala Canada Assembly Toronto SEW EURODRIVE CO OF CANADA LTD Tel 1 905 791 1553 Sales 210 Walker Drive Fax 1 905 791 2999 Service Bramalea Ontario L6T3W1 http www sew eurodrive ca reynolds sew eurodrive ca Vancouver SEW EURODRIVE CO OF CANADA LTD Tel 1 604 946 5535 7188 Honeyman Street Fax 1 604 946 2513 Delta B C V4G 1 E2 b wake sew eurodrive ca Montreal SEW EURODRIVE CO OF CANADA LTD Tel 1 514 367 1124 2555 Rue Leger Street Fax 1 514 367 3677 LaSalle Quebec H8N 2V9 a peluso sew eurodrive ca Additional addresses for service in Canada provided on request Chile Assembly Santiago de SEW EURODRIVE CHILE LTDA Tel 56 2 75770 00 Sales Chile Las Encinas 1295 Fax 56 2 75770 01 Service Parque Industrial Valle Grande www sew eurodrive cl
23. LAMPA RCH Santiago de Chile P O Box Casilla 23 Correo Quilicura Santiago Chile ventas sew eurodrive cl 37 i Address List P O Box 80136 GR 18545 Piraeus China Production Tianjin SEW EURODRIVE Tianjin Co Ltd Tel 86 22 25322612 Assembly No 46 7th Avenue TEDA Fax 86 22 25322611 Sales Tianjin 300457 gm tianjin sew eurodrive cn Service http www sew eurodrive com cn Assembly Suzhou SEW EURODRIVE Suzhou Co Ltd Tel 86 512 62581781 Sales 333 Suhong Middle Road Fax 86 512 62581783 Service Suzhou Industrial Park suzhou sew com cn Jiangsu Province 215021 P R China Additional addresses for service in China provided on request Colombia Assembly Bogot SEW EURODRIVE COLOMBIA LTDA Tel 57 1 54750 50 Sales Calle 22 No 132 60 Fax 57 1 54750 44 Service Bodega 6 Manzana B http www sew eurodrive com co Santaf de Bogot sewcol sew eurodrive com co Croatia Sales Zagreb KOMPEKS d o o Tel 385 1 4613 158 Service PIT 4 Fax 385 1 4613 158 HR 10 000 Zagreb kompeks net hr Czech Republic Sales Praha SEW EURODRIVE CZ S R O Tel 420 220121234 Business Centrum Praha Fax 4420 220121237 Luzna 591 http www sew eurodrive cz CZ 16000 Praha 6 Vokovice sew sew eurodrive cz Denmark Assembly Kopenhagen SEW EURODRIVEA S Tel 45 43 9585 00 Sales Geminivej 28 30 P O Box 100 Fax 45 43 9585 0
24. Once a housing connection screw is loosened the sealing property and conse quently degree of protection IP65 can no longer be ensured because the profiles have become distorted Operating Instructions MOVIPRO PHC11A A040M1 P00K 01 Installation 4 Connections 42 Connections The following sections describe the connections of PHC11A 1 2 3 4 5 6 7 I8 9 Di e 60216AXX Figure 9 Connection assignment of PHC11A 1 20x1 Connection for ProfiBus out M12 5 pole B coded socket 2 20X2 Connection for ProfiBus in M12 5 pole pins B coded 3 20X13 Connection for RS232 service M12 5 pole pins A coded 4 20x14 Connection for RS485 service M12 5 pole socket A coded 5 30X5 Connection for I O field control M23 12 pole socket 0 coded 6 10X13 Connection for I O frequency inverter M23 12 pole socket 0 coded 7 10X1 Connection for motor connector HAN Q8 8 10X5 Connection for braking resistor HAN Q5 socket 9 0X1 Connection for supply system lead HAN Q8 pins 43 Wiring diagrams Assignment 20X2 ProfiBus out M12 B coded socket 3 4 o O 2 1 60252AXX Figure 10 ProfiBus out M12 5 pole B coded socket PIN Assignment Function 1 5V Supply voltage 2 A Data line 3 DGND Reference potential 4 B Data line 5 N C Operating Instructions MOVIPRO PHC1 1A A040M1 P00K 01 21
25. akman siol net South Africa Assembly Johannesburg SEW EURODRIVE PROPRIETARY LIMITED Tel 27 11 248 7000 Sales Eurodrive House Fax 27 11 494 3104 Service Cnr Adcock Ingram and Aerodrome Roads http www sew co za Aeroton Ext 2 Johannesburg 2013 P O Box 90004 Bertsham 2013 dross sew co za 41 42 Address List i South Africa Capetown SEW EURODRIVE PROPRIETARY LIMITED Tel 27 21 552 9820 Rainbow Park Fax 27 21 552 9830 Cnr Racecourse amp Omuramba Road Telex 576 062 Montague Gardens dswanepoel sew co za Cape Town P O Box 36556 Chempet 7442 Cape Town Durban SEW EURODRIVE PROPRIETARY LIMITED Tel 27 31 700 3451 2 Monaceo Place Fax 27 31 700 3847 Pinetown dtait sew co za Durban P O Box 10433 Ashwood 3605 Spain Assembly Bilbao SEW EURODRIVE ESPANA S L Tel 34 9 4431 84 70 Sales Parque Tecnol gico Edificio 302 Fax 34 9 4431 84 71 Service E 48170 Zamudio Vizcaya http www sew eurodrive es sew spain sew eurodrive es Sweden Assembly J nk ping SEW EURODRIVE AB Tel 46 36 3442 00 Sales Gnejsv gen 6 8 Fax 46 36 3442 80 Service S 55303 J nk ping http www sew eurodrive se Box 3100 S 55003 J nk ping info sew eurodrive se Switzerland Assembly Basel Alfred Imhof A G Tel 41 61 417 1717 Sales Jurastrasse 10 Fax 41 61 417 1700 Service CH 4142 M nchenstein bei Basel http www imhof sew ch info imhof sew ch
26. blems via the Internet available Anywhere today around the clock beo EURODRIVE SEW EURODRIVE GmbH amp Co KG P O Box 3023 D 76642 Bruchsal Germany Phone 149 7251 75 0 Fax 149 7251 75 1970 sew sew eurodrive com WWW Sew eurodrive com
27. e V 10X1 8 FU Al21 TF TH 10X1 PE Weight Equipotential bonding Assignment 10X9 Braking resistor HAN Q5 socket PE 1 2 3 5 4 O 58255AXX Figure 15 Braking resistor 5 pole HAN Q5 socket Terminal Assignment Function 10X9 1 N C 10X9 2 N C 10X9 3 R Braking resistor 10X9 4 N C 10X9 5 R Braking resistor 10X9 PE Weight Equipotential bonding Operating Instructions MOVIPRO PHC11A A040M1 P00K 01 23 24 Installation Wiring diagrams Assignment 10X13 Digital inputs and outputs M23 0 coded socket 58256AXX Figure 16 Digital inputs and outputs M23 12 pole 0 coded socket Terminal Assignment Function 30X5 1 DI00 Digital input frequency inverter 30X5 2 DI01 Digital input frequency inverter 30X5 3 DI02 Digital input frequency inverter 30X5 4 DI03 Digital input frequency inverter 30X5 5 DI04 Digital input frequency inverter 30X5 6 DI05 Digital input frequency inverter 30X5 7 DO00 Digital output frequency inverter 30X5 8 DO01 Digital output frequency inverter 30X5 9 0V24 Reference potential 30X5 10 0V24 Reference potential 30X5 11 24V 24 V supply voltage 30X5 12 Weight Equipotential bonding Operating Instructions MOVIPRO PHC11A A040M1 P00K 01 Installation Wiring diagrams Assignment 30X5 Digital inputs and outputs M23 0 coded socket 58256AXX Figure 17 Digital inputs and outputs M23 12
28. e unit before plugging in the ProfiBus ID module Use two knurled screws to attach the ProfiBus ID module Tighten the knurled screws manually Maximum permitted tightening torque for the retaining screws 0 2 Nm Operating Instructions MOVIPRO 1 4 1 Installation Installation notes Position of the connection points The connection points on the MOVIPRO units for grounding or equipotential bonding are marked on the housing corners by a symbol Design The holes for grounding are prepared for M5 self tapping bolts e g M5 x 12 to DIN ISO 3506 or equivalent Proceed as follows to ground the unit 1 2 Tighten the elements using a self tapping screw Figure 8 Grounding installation First place a terminal clip onto the ground bore next the crimp cable lug for M5 and finally the tooth lock washer 60218AXX 1 Corner profile with M8 threaded hole 2 Housing bolts 3 Terminal clip 4 Crimp cable lug for M5 5 Tooth lock washer 6 Bolt self tapping Operating Instructions MOVIPRO PHC11A A040M1 P00K 01 19 20 Installation Installation notes Never loosen the connection screws at the housing corners Never secure the grounding or equipotential bonding cable using the housing connection screws They are tightened with a predefined tightenting torque at the fac tory
29. ecommended motor power Pivot 24 V voltage suppl PPIY Feature Data 24 V sensor power supply VO24 DIO Output voltage 24 V 5 sensors actuators Total output current limited to at least 500 mA Short circuit and overload protection Not interference voltage proof 24 V voltage supply VO24 Output voltage 24 V 5 communication interfaces bus Total output current limited to at least 500 mA Short circuit and overload protection Not interference voltage proof 24 V emergency stop relays Output voltage 24 V 5 Total output current limited to at least 3 5 A Short circuit and overload protection Not interference voltage proof Digital inputs and outputs Feature Data Digital inputs PLC compatible according to EN 61131 2 Ri 3 kQ 32 fy 2 8 kHz 15 V 30 V input HIGH 3 V 5 V input LOW Digital outputs PLC compatible according to EN 61131 2 lourT 500 mA per output output HIGH 24 V 596 output LOW 0 V 5 Short circuit and overload protection Not interference voltage proof Operating Instructions MOVIPROG 1 4 1 Technical Data Dimension drawing 7 2 Dimension drawing PHC11A A040M1 The dimension drawing shows the mechanical dimensions of PHC11A PO0K 01 e 2 w 8 _ e SEW EURODRIVE SEW EURODRIVE MOVIPRO SEW EURODRIVE MOWPRO sew euroo
30. ection input 31 24 V voltage supply 32 Timeout active 29 Transportation a 30 T slot profiles Dimensions 17 Operating Instructions MOVIPRO PHC11A A040M1 P00K 01 Index U Wiring diagrams 21 Unit design ek 8 Braking resistor 23 Unit OLTDUE ocio 18 Connection for RS485 interface 22 Use Digital inputs outputs 24 25 designated 5 Motor connection 23 w ProfiB s In uiis uu 22 warning instructions 4 TORIS aG al Waste disposal 5 EE Se Operating Instructions MOVIPRO PHC11A A040M1 P00K 01 i Address List Address List SiemensstraBe 1 D 40764 Langenfeld near D sseldorf Germany Headquarters Bruchsal SEW EURODRIVE GmbH amp Co KG Tel 49 7251 75 0 Production Ernst Blickle StraBe 42 Fax 49 7251 75 1970 Sales D 76646 Bruchsal http Awww sew eurodrive de P O Box sew sew eurodrive de Postfach 3023 D 76642 Bruchsal Service Central SEW EURODRIVE GmbH amp Co KG Tel 49 7251 75 1710 Competence Center Gear uni
31. esign Scope of delivery Part number SEW EURODRIVE identifies the units with the following part numbers Unit Part number MOVIPRO PHC11A A040M1 POOK 01 drive and control unit 13000438 Additional com ponents The scope of delivery does not include installation equipment mounting acces sories or connection cables If you have questions about which equipment material to choose please contact SEW EURODRIVE GmbH amp Co KG Motor cables We recommend the following cables for connecting PHC11A to the motor With motor round connector M23 part number 1 172 494 3 57744AXX With ASB8 connector HAN 10E part number 1 172 679 2 8 58241AXX With terminal box on motor part number 1 172 242 8 58242AXX Operating Instructions MOVIPRO 1A A040M1 PO00K 01 11 12 Unit Design Unit design 3 4 Unit design The following figure shows the unit design of PHC11A 60213AXX Figure 2 PHC11A A040M1 POO0K 01 basic unit T slot profiles 2 Heat sink e Front panel connectors 4 Housing cover 3 5 Operating principle Task The PHC11A unit is designed as decentralized field control for stationary use in indus trial and commercial systems Energy is supplied on the mains end 400 V Observe all information on the technical data and the permitted conditions where
32. evention regulations and operating instructions The regulations in force e g EN 60204 VBG 4 DIN VDE 0100 0113 0160 must also be complied with The following rules and regulations apply to the operator Qenerally recognized safety rules EC guidelines or other country specific regulations Follow the specific instructions during installation and startup of the other com ponents such as motor and brake Make sure that preventive measures and protection devices correspond to the applicable regulations e g EN 60204 or EN 50178 Required preventive measures Systems with MOVITRANS Systems with power supply module Protective separation DIN VDE 0100 410 1997 Grounding of the unit IEC 60364 4 41 2002 Low impedance equipotential bonding on the machine frame ESD protection for mobile components The unit meets all requirements for safe disconnection of power and electronics connections in accordance with EN 61800 All connected circuits must also satisfy the requirements for safe disconnection If safe disconnection is required the connected signal circuits have to meet the requirements according to SELV or PELV Before removing the protective cover disconnect the unit from the supply system Dangerous voltage levels may still be present inside the unit and at the terminal strips up to 10 minutes after mains disconnection When the protective cover is removed the unit has enclosure IP00 Dangero
33. igure 4 Installing the PHC11A Corner profile with threaded hole M8 x 20 2 Fastening element Housing cover Tapped hole M8 x 20 5 Screws for mechanical connection Use suitable supports or spacers to ensure optimum heat convection You must maintain a minimum distance of 25 mm from the highest cooling fin to the neighboring areas Maximum permitted tightening torque for the retaining screws 3 2 Nm Mounting The mounting position for units with cooling fins is vertical to allow for vertical air position convection between the cooling fins Any other position is not permitted due to the reduced heat convection Operation in a different mounting position can cause the unit to overheat leading to irreparable damage 16 Operating Instructions MOVIPRO8 PHC1 1A A040M1 PO0K 01 Installation 4 Installation notes 60215AXX Figure 5 Permitted mounting positions for PHC11A Always position the unit so that it will not collide with other components or design elements along the travel distance Dimensions of When selecting the mounting elements observe the dimensions of the angle profiles the T slot profiles shown in the figure below 57253AXX Figure 6 Dimensions of the angle profiles The dimensions of the PHC11A unit are shown in dimension drawing page 34 Ope
34. n that provides impor tant information on the drive and control unit type P HC 1 1 A A 040 M 1 P 00 K 01 Function level version 01 First function level Function level K Customer specific Protocol and version 00 No meaning Communication medium P ProfiBus Number of motor connectors 121 motor connector Type of power connector M Motor connector Maximum 51 power 040 4 0 kVA Power input type AC Version A First generation Depth of housing 1 300 mm Height of housing 1 70 mm without cooling fins Housing type C Modular Control type H Drive control Product family P MOVIPRO Operating Instructions MOVIPRO 1 4 1 10 Unit Design Scope delivery 333 Scope of delivery The scope of delivery includes the PHC11A A040M1 P00K 01 basic unit Basic unit Components PHC11A A040M1 P00K 01 basic unit The PHC11A modular housing includes the following components MOVIDRIVE MCF20A0040 drive inverter Supply system rectifier for DC link conversion Brake control for 24 V brakes from SEW SEW field control with ProfiBus Connectors without mating connectors for 2 x sensors actuators 1x power supply connection 1x RS232 service 1x RS485 service jx motor connector 2x braking resistor connection 2xProfiBus Operating Instructions MOVIPROG PHC1 1 4 1 Unit D
35. of operation at constant load and a time at rest Described by the cyclic duration factor cdf in 96 Intermittent periodic duty The starting current affecting the temperature rise Charac S4 S10 terized by a sequence of identical duty cycles each including a time of operation at B constant load and a time at rest Described by the cyclic duration factor cdf in and the number of cycles per hour t 03135AXX Figure 18 Duty types S1 S2 and S3 Cyclic duration The cyclic duration factor cdf is the ratio between the period of loading and the duration factor caf of the duty cycle The duration of the duty cycle is the sum of times of operation and times at rest and de energized A typical value for the duration of the duty cycle is ten minutes sum of times of operation t1 t2 t3 CPE duty cycle duration T 100 Operating Instructions MOVIPRO amp PHC1 1A A040M1 P00K 01 27 E oa Operation and Service n Fault information Important When the unit is switched on dangerous voltages are present at the output terminals as well as any connected cables and motor terminals This also applies even if the unit is inhibited and the motor is at standstill Donot change the switch under load Disconnect the unit from voltage supply before performing work on the unit Dangerous voltages may still be present for up to ten minutes after disconnection from the power supply source
36. places Customers are not permitted to remove covers or attempt to repair and set the MOVIPRO PHC11A A040M1 POOK 01 drive and control unit themselves Such actions are classified as non designated use Only the manufacturing company is authorized to carry out repairs and make settings In case of malfunction contact SEW EURODRIVE GmbH amp Co KG for information on how to proceed The manufacturer assumes no liability for operating the MOVIPRO PHC11A A040M1 POOK 01 units in conditions other than those specified in these operating instructions Operational environment Waste disposal The following uses are prohibited unless the units are expressly designed for the purpose Use in potentially explosive areas Use in areas exposed to harmful oils acids gases vapors dust radiation etc Please follow the current national regulations Dispose of materials separately in accordance with the regulations in force for example Electronics scrap circuit boards Plastic housing Sheet metal Copper etc Operating Instructions MOVIPRO 1A A040M1 PO00K 01 Safety Notes 2 Safety Notes Installation and startup Operation and service Never install damaged products or take them into operation Submit a complaint to the transportation company immediately in the event of damage Installation startup and service work may only be performed by trained personnel observing applicable accident pr
37. rating Instructions MOVIPRO amp PHC1 1A A040M1 P00K 01 17 18 Installation Installation notes Shielding Separate cable ducts Unit output Digital inputs digital outputs Only use shielded motor and control cables e Connect the shield by the shortest possible route and make sure it is grounded over a wide area at both ends Ground one end of the shield via suppression capacitor 220 nF 50 V to avoid ground loops For cables with single shielding apply the shielding to both ends For cables with double shielding e g hybrid cable apply the outer shielding to the MOVIPRO and the inner shielding to the other end e g motor Route power cables and electronics cables in separate cable ducts Connect only ohmic inductive loads such as for example motors at motor connector 10X1 Never connect capacitive loads f gt Z 60217AXX Figure 7 Connection of inductive ohmic loads at the motor connector The motor supply cable must not exceed a maximum length of 15 m The digital inputs are electrically isolated by opto couplers The digital outputs are electrically isolated by opto couplers and are short circuit proof Grounding and equipotential bonding ProfiBus ID module Caution Do not connect external brake rectifiers for example in the motor terminal box Do not install or remove the ProfiBus ID module when voltage is applied Switch off th
38. rive MOVIPRO MOVIPRO sew curoorve SEW EURODAVE MOVIPRO 6 5 M8x20 A 390 420 Figure 19 Dimension drawing for PHC11A dimensions in mm 73 Additional information 60219AXX Publications For further information refer to the following documentation Documentation Publication number MOVIDRIVE MCF MCV MCS20A operating instructions 11282916 EN MOVIDRIVE9 compact MCF MCV MCS20A operating instructions 10556214 EN MOVIDRIVE9 compact system manual 11533811 EN Standards and The PHC11A drive and control unit was developed and tested based on the following certifications standards VDE 0100 954 61800 Operating Instructions MOVIPRO PHC11A A040M1 P00K 01 33 Index 8 Index A Accessories ssssssssseeeerennnnnnn 11 Additional information 33 Publications x eise enti rh D 33 Standards and certifications 33 B BASIC UPS ba 10 Block circuit diagram 13 Brakes ovde 26 Gable ducte u n 18 Components 10 Connections 5 13 21 Control technology 14 Halo ne z
39. ructions when transporting the PHC11A unit Cover the connections with the supplied protective caps before transportation Pace the unit on the heat sink or on the side without connectors during transporta tion Make sure that the unit is not subject to mechanical impact during transport 6 5 Storage Observe the following instructions when storing the PHC11A unit f you shut down and store the unit for a longer period you must cover the connections with the protective caps supplied Only store the unit on the heat sink or on the side without connectors during trans portation Make sure that the unit is not subject to mechanical impact during storage 6 6 Maintenance PHC11A does not require any maintenance The manufacturer does not stipulate any inspection work that has to be performed regularly 30 Operating Instructions MOVIPRO PHC11A A040M1 POOK 01 MOVIPRO PHC11A Technical Data 7 Technical Data 71 MOVIPRO PHC11A The following tables list the technical data for PHC11A General data General data for power section Data for power section input Feature Size Data Interference immunity meets EN 61800 3 in preparation Ambient temperature Ou 5 C 40 C Non condensing no moisture condensation Py reduction 3 Iy per K to max 60 C When the temperature of the heat sink increases to more than 80 C the de
40. taken to avoid injury to persons and damage to machinery Comply with the safety notes during startup When the status display goes out this does not mean that the unit has been dis connected 5 2 Motors and brakes For U f operation of PHC11A only the following SEW standard motors in star and delta connection are permitted Motors Brakes DV motors Only brakes with a coil voltage of 24 V are permitted All other brakes may destroy the PHC11A Operating Instructions MOVIPRO PHC1 1A A040M1 PO0K 01 Operation and Service SS Ces 6 Operating notes lt io 6 Operation and Service 6 1 Operating notes Duty types The following operating modes are determined according to ED information information on the cyclic duration factor EN 60034 1 on ambient temperature Sy 0 40 C at Ip 100 ly and fpwy 4 kHz cyclic duration factor 50 cdf T 1 h each additional32 degree Celsius in temperature results in a decreased cdf of 4 96 operating Explanation mode S1 Continuous duty Operation at a constant load the motor reaches thermal equilibrium S2 Short time duty Operation at constant load for a given time followed by a time at rest The motor returns to ambient temperature during the rest period Intermittent periodic duty The starting current does not significantly affect the tempera S3 ture rise Characterized by a sequence of identical duty cycles each including a time
41. ts Ernst Blickle StraBe 1 Fax 49 7251 75 1711 Motors D 76676 Graben Neudorf sc mitte gm sew eurodrive de Central SEW EURODRIVE GmbH amp Co KG Tel 49 7251 75 1780 Electronics Ernst Blickle StraBe 42 Fax 49 7251 75 1769 D 76646 Bruchsal sc mitte e sew eurodrive de North SEW EURODRIVE GmbH amp Co KG Tel 49 5137 8798 30 Alte Ricklinger StraBe 40 42 Fax 49 5137 8798 55 D 30823 Garbsen near Hannover sc nord sew eurodrive de East SEW EURODRIVE GmbH amp Co KG Tel 49 3764 7606 0 Dankritzer Weg 1 Fax 49 3764 7606 30 D 08393 Meerane near Zwickau sc ost sew eurodrive de South SEW EURODRIVE GmbH amp Co KG Tel 49 89 909552 10 DomagkstraBe 5 Fax 49 89 909552 50 D 85551 Kirchheim near M nchen sc sued sew eurodrive de West SEW EURODRIVE GmbH amp Co KG Tel 49 2173 8507 30 Fax 49 2173 8507 55 sc west sew eurodrive de Drive Service Hotline 24 Hour Service 49 180 5 SEWHELP 49 180 5 7394357 Additional addresses for service in Germany provided on request 1619 Garin France Production Haguenau SEW USOCOME Tel 33 3 88 73 67 00 Sales 48 54 route de Soufflenheim Fax 33 3 88 73 66 00 Service B P 20185 http www usocome com F 67506 Haguenau Cedex sew usocome com Assembly Bordeaux SEW USOCOME Tel 33 5 57 26 39 00 Sales Parc d activit s de Magellan Fax 33 5 57 26 39 09 Service 62 avenue de Magellan B P 182 F 33607 Pessac Cedex Lyon SEW USOCOME Tel 33 4 72 15 37
42. us voltages are present at all components except for the control electronics The unit must be closed during operation When the unit switch is in the ON position dangerous voltages are present at the output terminals as well as any connected cables and motor terminals This also applies even when the unit is inhibited and the motor is at standstill Just because the operation LED and other display elements have gone out does not mean that the unit has been disconnected from the supply system and is de energized Internal safety functions or a mechanical blockage may cause the motor to stop Removing the cause of the malfunction or performing a reset can cause the drive to restart automatically As this is prohibited for the driven machine for safety reasons disconnect the unit from the power supply before correcting the fault In such cases it is also forbidden for the Auto Reset P841 to be activated Operating Instructions MOVIPROG 1 4 1 Safety Notes Safety technology The inverter output may only be switched when the output stage is inhibited Switching the inverter output when the output stage is enabled leads to increased wear and will finally cause irreparable damage to the switch contacts The switching equipment must be selected in accordance with the maximum DC voltage Warning of malfunctions i The MOVIPRO PHC11A A040M1 POOK 01 drive and control units may not execute an
43. vice switches off and the fault message Overtemperature is generated Derating ambient temperature EN 60721 3 3 Climate class Class 3K3 Storage temperature 25 C 70 C 60721 3 3 class 3K3 Enclosure IP65 Weight 11 kg Dimensions W xH x D 420 x 300 x 110 mm connector not taken into account Feature Size Data Operating mode OL continuous duty EN 60149 1 1 and 1 3 Overall rated output power Pn 6 6 kVA Rated current In 9 5 Aac Feature Size Data Operating voltage Ug 380 Vac 10 500 Vac 10 Rated input current lpick up 8 6 Aac The overall rated power depends on the connected load The total rated power is decisive for the maximum output power of the unit The power data of the individual axes may deviate from these values Operating Instructions MOVIPRO 1A A040M1 PO00K 01 DDate output power section axis 10x1 Technical Data MOVIPRO PHC11A Feature Size Data Operating mode OL continuous duty EN 60149 1 1 and 1 3 Rated output power PN 4 kW Rated output current IN 9 5 Aac Current limitation Imax motor and regenerative 150 IN Output voltage UA 0 0 500 Vac PWM frequency fPwM Can be set 4 8 16 kHz P860 P861 Speed range resolution 5000 0 5000 min 0 2 min across the entire range Maximum motor cable length 15m s Constant load S1 Puot 4 kW 5 3 HP R
44. y safety functions without higher level safety systems unless expressly designed for this purpose Malfunctions in the drive and control units of the MOVIPRO PHC11A A040M1 POOK 01 product series can result in injuries to persons and damage to material and equipment Use higher level safety systems to ensure protection of equipment and personnel Dangerous voltages Mechanical protection Electrical protection Interfaces ESD protection Shielding Do not connect or disconnect any plug connectors or interface connections when voltage is applied The complete energy and control electronics is accommodated in a modular IP64 enclosure to provide protection against contact The energy interfaces are designed using touch safe plug connectors with IP65 protection if locked The connections for resolver and sensor actuator boxes via M23 plug connector are designed in IP67 protection when connected All M12 connections sensors actuators diagnostic interfaces are designed in degree of protection IP67 All outgoing interfaces for energy supply pick up connections motor connection and the 24 V voltage supply are designed in such a way shape or color coded that they cannot be mixed up The connectors of the resolver connection are color coded so that they cannot be mixed up Sensor and actuator connections are designed with standardized M23 connectors so that they cannot be mixed up A high resistance discharge with
Download Pdf Manuals
Related Search