Home

Red Digital Cinema Scarlet X 2.0.2 Operation Guide

1. 34 Graphical User Interface and Navigation 35 RED LCD Touchscreen LCD BOMB EVF External Monitors 35 Side Handle 40 REDMOLG seserian 41 Navigating Menus 42 Using Touchscreen LCD 42 ShHOrtCuls 43 Power Down 43 Lock Unlock Touchscreen Opreration 44 FIRST TIME USE SETTING UP YOUR RED SCARLET X 45 1 Attach Power Source 45 Battery 45 DC Pow er 46 2 Power UP 46 3 Preparing to Record 46 Connect and Format Meja u ul u u SS usus 47 Perform a Black Shading Calibration 48 Adjust Project Settings 48 4 Recording 49 Record Indicator 50 S T iayDaCK u L Susana 51 MENU CONTROLS 52 Adjustments 52 Basic Setting Adjustments 52 Advanced Setting Menus 53 MAIN MENU 54 FPP e E E E kawasan 54 Varispeed 54 Basic Settings 55 Advanced Settingos 55 ISO Sensitivity 56 F STOD enian 56 RED SCARLET X DSMC Ti PL Mount Installed 56 RED SCARLET X Canon EOS Mount
2. Version 2 0 2 A 111 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE NAME Allows you to manually designate a unique camera NAME Each device in the network needs to have a unique NAME Like CAM_A_L or CTRL_PAD The name is limited to 8 characters This is also required if only two devices are connected The device name can be used to uniquely address a command to a specific device When selected a keyboard will appear Presets Media Settings Power DEFAULT GROUP A device can also be part of a GROUP of devices For example the group RIG_A could include the two cameras on a stereo rig CAM_A_L and CAM_A_R The default group is named DEFAULT Groups like names can be used to send commands to a selected group of devices When selected a keyboard will appear Presets Media Settings Power DEFAULT Version 2 0 2 l 12 2011 RED COM INC NOVEMBER 18 2011 TARGET Commands can either be sent to ALL devices to NONE of the devices So this device will only listen or to a specific TARGET Which can either be the NAME of a specific device or a whole GROUP This allows for a lot of flexibility in bigger setups For example on a 3D shoot with multiple rigs one can either send commands to individual cameras Set CAM_A_L to 1 64th exposure to a group of cameras Set RIG_A to 48 FPS or to all cameras Start Recording on all cam
3. OVERLAY Allows you to enable and color code graphic overlays visible the on the Viewfinder and Preview outputs Presets Media Settings Power Version 2 0 2 pa 7 L NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE SHOW Check the box adjacent to each overlay type to show Overlays available are AF Zones Center and Grid Look Around is always enabled Check the boxes below Look Around are File Name Time Code and Lens Info When selected will be displayed on the main screen By default all three are checked Transparency The transparency setting for AF Zones AE Zone Faces Center Grid and Look Around may be adjusted Options are 0 25 50 75 and 100 Color The color setting for AF Zones AE Zone Faces Center Grid and Look Around may be adjusted Options are White Blue Yellow Green Red or Black Select the color that provides maximum contrast with the scene you are shooting Grid The Grid display is shown below The grid may be used as a rule of thirds indicator Presets Media Settings Power A001_C006 13 48 40 04 Version 2 0 2 88 l 2011 RED COM INC NOVEMBER 18 2011 ET X OPERATION GUIDE Look Around Highlights the look around area A001_C012 20 27 45 05 MODES Available GUI display mode adjustments are Exposure Shutter Mode Aperture and Focal Distance Presets Media Settings Power EXPOSURE
4. RED SCARLET X OPERATION GUIDE At 10 remaining capacity the media status will turn yellow at 5 it will turn red At 2 remaining the camera will cease recording This reserves a small amount of capacity for ancillary data to be written to the media NOTE When media is full the Side SSD LED will flash Red EJECT MEDIA FROM CAMERA UNMOUNT IMPORTANT Media must always be Ejected un mounted prior to removal or disconnection from the camera This ensures power is removed from the digital media and any open data files are closed Failure to do so may result in lost data or corrupted files Removing an SSD without first un mounting it will not physically damage the media however it does increase the risk of file corruption so it s good operational practice to un mount the media if possible before removing or disconnecting IMPORTANT Unmounting the digital media takes a few seconds protects the integrity of your recorded data and helps clips mount instantly to your workstation once in postproduction so it s a recommended habit to develop If you do not un mount the media the camera will offer a warning your files may not be damaged but you will have been warned NOTE The camera will respond to physical removal of the media without un mounting and display MEDIA REMOVED PRIOR TO UNMOUNT DATA INTEGRITY RISK USING REDMOTE TOUCHSCREEN LCD 1 Goto SECONDARY MENUS gt MEDIA Presets Media Settings Po
5. The spot focus square can be moved around the screen Touchscreen Tap on the spot focus square directly on the touchscreen and drag to the location you wish to relocate the spot focus circle Version 2 0 2 69 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE Side Handle REDmote 1 Navigate to the focus menu 2 Press the down arrow on the Navigation Group 3 The spot focus square line weight will increase and the Red cursor under FOCUS will dim slightly Presets Media Settings Power A001_C024 17 42 11 02 4 Press the ENTER button 5 Use the directional arrows to move the Spot Focus square to the desired location Presets Media Settings Power A001_C024 17 42 11 02 6 To exit Press the ENTER button the spot focus square line weight will increase then press the UP arrow to go back to the FOCUS menu Press the MENU button Resizing The spot focus square can be resized using the Navigational Wheel or the Touchscreen Touchscreen Tap two times on the square directly on the touchscreen to increase size You can increase the size 3 times After that when you double tap the spot focus square it will decrease in size Version 2 0 2 70 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE RED SCARLET X DSMC TI PL MOUNT LENS When a RED SCARLET X DSMC Ti PL Mount is installed and a Lens equipped with Cooke s S4 i system or
6. HED SGABLEIEX MIC 2 MYSTERIUM X WWW RED COM THIS PAGE INTENTIONALLY BLANK RED SCARLET X OPERATION GUIDE TABLE OF CONTENTS TABLE OF CONTENTS DISCLAIMER Copyright Notice Trademark Disclaimer COMPLIANCE Industry Canada Compliance Statements Federal Communications Commission FCC Compliance Statements Austrailia and New Zeland Compliance Statements European Union Compliance Statements Information BEFORE YOU START A Important Safety Instructions Magic Motion V Audio Recording Microphone Level Analog Line Level Analog Inputs Video Monitoring Outputs Bomb EVF REDmote Digital Magazine Media Metadata Clip Naming Conventions SMPTE Timecodes Power Consumption CAMERA OPERATIONAL BASIC OPERATION Power Sources Side Handle Version 2 0 2 NOVEMBER 18 2011 External DC Power 32 Power UP 33 Power Down
7. Presets Media Settings Power Use the NAV GROUP to make changes to the cameras settings Use the scroll wheel and directional pad to move the cursor to navigate and make changes to the desired settings When a desired setting change Is made press the ENTER button or the directional pad UP arrow to exit from that setting Exiting Menus to Main Screen To EXIT from the Secondary Menus and return to the main screen e Press the MENU button until the main screen is displayed Version 2 0 2 183 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE USING REDMOTE LCD STAND ALONE The LOCAL function of the REDmote allows you to control the camera settings directly on the REDmote LCD as opposed to having to see the settings on the camera LCD or external monitors For complete details refer to REDMOTE MENUS gt SOFT MENU BUTTONS 1 3 gt 2 REMOTE gt LOCAL HOR 1 1 OFF LAN RIG SYNC GEN TC Aperture Focus m Zoom gi Sensitivity Exposure Color Temp B60 Format g 1 Sensor FPS CA FPS C aes B 740 48 50 l REDMOTE DISPLAYS CAMERA MESSAGES AND ON SCREEN PROMPTS When the REDmote is connected to the camera wirelessly and the camera displays a message example trying to record with no media attached or ejecting media the REDmote will display the same message HOR 1 1 OFF LAN RIG SYNC GEN TC HOR 1 1 OFF LAN RIG SYNC GEN TC Aperture Focus m Zoom Aperture Focus m Zoom 3
8. Select False Color Video note the y V icon in the GUI when active This mode allows us to check the RGB video levels of the scene As the peak white chips on the test chart are showing up in green and the underexpose areas are showing up in dark blue this says the monitor path video levels are only ranging between 44 IRE and 1 IRE Because the scene is under exposed when the recorded R3D file is color corrected in post production the scene s highlight information will certainly not be clipped however the shadow information will probably display with significant noise once pushed to an acceptable brightness OVEREXPOSURE 2 STOPS D4 vs 0 000 s gt vM CLR 48 5600 D c aqmacbeth Internal Drop Temp Media Power ISO 800 Monitor Output In the image above it is obvious the camera is over exposed The monitor is very bright and the histogram is justified to the right Note the red bar at the right edge of the histogram and the vertical color stack to the right of the histogram is showing red plus the three traffic lights to the right of that are all illuminated These indicators are suggesting that a signification portion of the sensor s RAW data is at clip and this clipping is occurring on Red Green and Blue channels Version 2 0 2 198 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE D4 vs so800 vM CLR VE 48 sec 5600 sane de w T a
9. Version 2 0 2 146 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE 2 Open the Disk Utility First Aid Erase RAID Restore 93 2 GB ST910021AS Media Laptop Mac 7 5 GB Generic STORAG e Erasing a disk erases all data and volumes on a disk leaving the disk empty Erasing a _ RED ONE selected volume erases that volume only leaving other volumes on the disk unchanged e To securely erase data click Security Options and select an option before clicking Erase To help prevent recovery of deleted files click the Erase Free Space button To erase a disk or volume select its icon specify a format and name and click Erase Volume Format Name RED_ONE Carefully choose the drive from the list on the left Select the Erase tab Choose MS DOS FAT as the Volume Format You can add a Name if desired however the camera will overwrite this IMPORTANT Before performing the next step double check that this is the correct SSD that you wish to erase DATA FROM 6 Select Erase When the pop up window appears click on the Erase button 7 When the media is erased drag its icon to the trashcan and physically disconnect it 8 The media will need to be formatting by the camera before use Refer to FORMATTING MEDIA WINDOWS 1 Connect the REDMAG 1 8 SSD via RED STATION REDMAG 1 8 2 Open Windows Explorer go to my computer icon right click and select EXPLORE 3 Double click on the driv
10. XL batteries RED BRICK Attach to the camera using a V Plate and 2B to 1B Power Adapter Cable P N 790 0138 to the DC IN connector DC POWER Connect a DC power source to the camera in one of the following ways e Plug the RED AC Power Adapter into AC power and the LEMO connector to the DC IN connector e Plug the RED CHARGER into AC power and the LEMO connector to the DC IN connector via 2B to 1B Power Adapter Cable P N 790 0138 e Plug a 12V XLR based power source into the DC IN connector via adaptor cable P N 790 0164 NOTE The maximum sustainable power load of the SCARLET X AC Power Adapter is 150W 15V 10A The output of the adapter is over current protected and will shut down if an excess load condition occurs If the output trips for any reason remove any external loads from the camera such as lights motors etc turn off the Adapter and repeat the above procedure 2 POWER UP Locate the camera s Power ON OFF button on the right face of the Brain If the Power Status LED is illuminated Red depress and then release the Power Record button If not illuminated check your battery charge status or external power source cable connection Once powered up the Power Status LED will illuminate Green confirming the camera is ready to use 3 PREPARING TO RECORD Before each days recording the camera should be prepared as follows Physically set up camera as desired Verify camera is using the latest firmware vers
11. DISPLAY gt FALSE COLOR for complete information e Touching System Status in the lower Center of the screen will bring up the Settings menu Refer to SECONDARY MENUS gt SETTINGS for complete information e Touching Media Status indicator will bring up the Media menu Refer to SECONDARY MENUS gt MEDIA for complete information e Touching Power Status indicator will bring up the Power menu Refer to SECONDARY MENUS gt POWER for complete information e Touching the Audio Meter will display the Audio Input menu Refer to SECONDARY MENUS gt SETTINGS gt AUDIO VIDEO for complete information POWER DOWN NOTE Camera will automatically power down if supply voltage drops to 11 5 Volts THROUGH POWER MENU 1 Select the MENU icon in the right corner of the Upper Status Bar to reveal the Secondary Menus 2 Select POWER 3 Select SHUTDOWN Version 2 0 2 43 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE 4 The camera will immediately power down Presets Media Settings Power USING POWER STATUS DISPLAY 1 Select the POWER status located between the audio channels and media remaining indicator to reveal the same menu illustrated above 2 Select SHUTDOWN 3 The camera will immediately power down LOCK UNLOCK TOUCHSCREEN OPRERATION LOCK To lock out the touchscreen operation touch and hold the MENU icon until the LOCK icon 2 displays indicating the touchscreen ha
12. Hold at 3 3V e Stop Record 3 3V Ground Transition e During Stop Hold at Ground Trigger button circuit Push to make push to break button or toggle Female BNC 1000hm 1 7v 20 mA Input Voltage On when output signal is hi is 3 3v to Ww N 10 uF Component values are approximate use available standard values NOTE A pre fabricated SYNC interface cable is available from RED Digital Cinema e P N 790 0154 Video Sync Camera to 3 BNC 3 ft 1m e White BNC Shutter Sync GPI e Yellow BNC SMPTE Timecode e Green BNC RS170A Genlock Version 2 0 2 157 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE CTRL RS232 CONTROL A 4 pin LEMO connector supports RS232 remote control for stereoscopic camera image capture and third party metadata ingest applications The shutter Sync Output signal acts as an immediate response hardware tally of a scan This is useful for 3D or motion control applications where a slave camera or lighting device needs to be synchronized to a master camera Alternatively this output pin may be used as a GPO General Purpose Output tally whose function is programmed in the USER KEYS menu Default is Record Tally Figure 23 View into camera CTRL RS232 Control Interface connector Mating Connector LEMO FGG 00 304 CLAD27Z PIN SIGNAL DESCRIPTION 232 RX RS232 RX SS GPO Shutter Sync GPO Output 232 TX RS232 TX NOTE When active t
13. Settings Power General Purpose Out Version 2 0 2 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE SYNC MODE Allows the shutter timing scan start to be synced to an external signal Presets Media Settings Power Sync Out Available options are OFF GENLOCK SHUTTER INTERNAL PROXY and SLAVE Default is Off OFF Shutter start time is defined by internal camera timing GENLOCK Shutter start time is slaved to an external RS170A tri level sync signal a k a Genlock SHUTTER Shutter start time is slaved to an external Shutter Sync signal INTERNAL Not implemented at this time PROXY Not implemented at this time SLAVE Not implemented at this time IMPORTANT If Sync gt Genlock mode is selected DO NOT set fps to higher than 72fps and to a speed NOT a multiple of the project base rate and genlock input Version 2 0 2 119 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE SYSTEM Available options are FAN CONTROL RECORD SPEED and STANDBY SPEED as well as BEEP SPEAKER and EVF TALLY LIGHT Presets Media Settings FAN CONTROL Specifies cooling fan operation Available options are AUTO and MANUAL Manual will run the fan at the speeds specified in RECORD SPEED and STANDBY SPEED Default setting is AUTO Auto This setting selects VARIABLE speed fan operation in standby based on the camera core temperature Manual This sett
14. Side Handle LCD display The display elements include e Power Camera power status DC Shown e ISO Rating Camera sensitivity e Frame Rate Image capture rate e Shutter Speed Exposure Time or Degrees e Resolution Recording Resolution e White Balance Color Temp e Quality REDCODE setting Version 2 0 2 40 l 2011 RED COM INC NOVEMBER 18 2011 REDMOTE Aperture 3 0 Sensitivity isoBU0 Format 4K HD A001 C003 DEFAULT S SSD Redcode SCARLET X OPERATION GUIDE Zoom mm I Color Temp J6U0k Sensor FPS CArFps Focus m u8cm Exposure 7ABsEc 8 1 17 58 54 145 CH4 CONNECT REMOTE SETUP kl The display elements include e Camera ID Displays camera ID DEFAULT shown e Wireless Status Displays signal strength when connected wirelessly e Battery Indicator Displays battery life or charge status shown of REDmote e Resolution Recording Resolution e Quality REDCODE setting e Frame Rate Image capture rate e ISO Rating Camera sensitivity e Frame Rate Current frame capture rate e Shutter Speed Exposure Time or Degrees e White Balance Color Temp e Resolution Record Resolution e Quality REDCODE setting e Clip Filename Filename of the clip that will be shot Version 2 0 2 NOVEMBER 18 2011 e Project Frame Rate Current project TIME BASE e Clip Meter RGB sensor RAW clipping status e HDR Mode Displays HDRx mode status e
15. and QuickTime are registered trademarks of Apple Inc Intel is the registered trademark of Intel Corporation Windows Microsoft Windows and Windows Vista are the registered trademarks of Microsoft Corporation AVID is a registered trademark of Avid Technology Inc NUKE is a trademark of The Foundry Visionmongers Ltd Torx is a registered trademark of Textron Inc Canon and EOS are registered trademarks of Canon Kabushiki Kaisha Corporation Torx is a registered trademark of Textron Inc Version 2 0 2 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE COMPLIANCE INDUSTRY CANADA COMPLIANCE STATEMENTS This device complies with Industry Canada license exempt RSS standards RSS 139 and RSS 210 Operation is subject to the following two conditions 1 this device may not cause interference and 2 this device must accept any interference including interference that may cause undesired operation of the device This Class B digital apparatus complies with Canadian ICES 003 Le present appareil est conforme aux CNR d Industrie Canada applicables aux appareils radio exempts de licence L exploitation est autoris e aux deux conditions suivantes 1 l appareil ne doit pas produire de brouillage et 2 l utilisateur de l appareil doit accepter tout brouillage radioelectrique subi m me si le brouillage est susceptible d en compromettre le fonctionnement Cet appareil num rique de la classe B est confo
16. preset which are more flexible as they can be image settings or other settings Go to SECONDARY MENUS gt PRESETS for details HDRX HDRx is an option for extending dynamic range from 1 to 6 stops over the baseline Dynamic Range offered by the camera HDRx mode simultaneously shoots two images of identical resolution and frame rate a primary track A track that is normally exposed and a the secondary track X track that has an exposure value that reflects the additional stops of highlight protection desired EXAMPLE If you select an HDR value of 2 and your primary exposure is 1 48th sec the X track exposure will be 2 stops faster 1 192 sec The ISO and Aperture remain the same for both exposures During acquisition and recording the two tracks are motion conjoined meaning there is no gap in time between the two separate exposures This is important to note because if they were two standard alternating exposures there would be a time gap between the two tracks that would show up as an undesirable motion artifact Both tracks A amp X are stored in a single R3D file Since there are two exposures when in HDRx mode the camera is recording double the amount of frames For example if you are shooting 24fps the camera is recording two 24fps tracks which is the data rate equivalent of 48fps However after combining the two tracks in postproduction you see only one 24fps motion stream HDRx provides multiple options for ex
17. HU 5200k 5300x 5400x 5500x 5600x 5700x 5800x 5900x 6000x Range is 1 700 K to 10 000 K Default is 5600K Version 2 0 2 61 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE ADVANCED SETTINGS When selected allows additional adjustment of the White Balance Available options are PRESET COLOR TEMP TINT and CALCULATE WHITE BALANCE Press APPLY PRESET for settings to take effect CAFps 0800 PB ABsee 5600k 4KHD _RC8 1 Daylight 5600k EE a Apply Preset PRESET Available preset options are SHADE DAYLIGHT FLOURESCENT INCANDECENT Preset to 9 000K Preset to 5 600K Preset to 4 500K Preset to 2 800K CLOUDY FLASH TUNGSTEN Preset to 7 500K Preset to 5 500K Preset to 3 200K CAFPs 1 s0800 ABsec 5600k 4K HD RC8 1 ayiov 5600 0 000 Version 2 0 2 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE COLOR TEMP Allows you to manually set Color Temperature in the range from 1 700 to 100 000 degrees Kelvin Default is 5600K CA rps 150800 ve ABsec 5600x 4K HD RC8 1 E 5600 E 0 000 EE A001_C006 TINT Color Temperature calculations assume a pure light source that may not be true in the specific scene the camera is imaging To compensate for any residual colorcast the TINT parameter can adjust the RGB color balance with a compensating Magenta Green color component Default
18. Handle Navigation Group A Scroll Wheel BI Direction Keys Enter Button o Scroll Wheel Selects and adjusts camera parameter value o Direction Keys Navigates camera menus and may select parameter for adjustment o Enter Button Confirms selected parameter value adjustment e User Keys User Function Keys A D F The specific function of these keys may be programmed by the user Default settings for User Function Keys A D are as follow User Key A Press to execute user defined function Default Toggles Focus Assist Indicator User Key B Press to execute user defined function Default Performs WB Calc User Key C Press to execute user defined function Default Toggles False Color gt 1 1 Magnify User Key D Press to execute user defined function Default Toggles False Color gt Exposure Check e System Keys Function is defined by System Firmware The specific function of these keys may be programmed by the user Upper Toggles false color Exposure Check Center Not currently defined Lower Ejects unmounts the currently selected Media Version 2 0 2 25 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE INSTALLATION REMOVAL WARNING THE SIDE HANDLE IS NOT HOT SWAPPABLE MEANING YOU CANNOT REMOVE OR INSTALL WHILE THE CAMERA IS POWERED ON BEFORE INSTALLING OR REMOVING THE SIDE HANDLE YOU MUST POWER DOWN THE CAMERA FAILURE TO DO SO MAY RESULT IN DAMAGE TO THE SIDE HANDLE AND OR CAM
19. LEMO connector accepts a DC voltage between 11 5V and 17V DC Power conditioning circuits provide protection against reverse polarity connection ESD under voltage and over current Figure 25 View into camera DC IN Power Input connector Mating Connector LEMO FGJ 1B 306 CWLD72Z SIGNAL DESCRIPTION VBATT Power input 11 5 to 17VDC SCL BATT Serial Battery Bus Clock GROUND Power Return Camera Ground SCA BATT Serial Battery Bus Data WARNING It is very important that both pairs of VBATT and GROUND pins are wired up DO NOT fabricate power cables with just one each of VBATT and GROUND pins wired as this may cause damage to the camera s power supply this is not covered by Warranty NOTE Two pre fabricated DC Power input cables are available from RED Digital Cinema e P N 790 0138 DC Power REDBRICK to Camera 18 in 0 5m e P N 790 0164 DC Power XLR to Camera 10 ft 8m Version 2 0 2 160 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE HDMI OUT The HDMI output supports an HDTV compatible 10 bit 4 2 2 progressive scan video signals with embedded audio at 720p and 1080p resolution The HDMI output may be specified as a PROGRAM output clean feed video or as a PREVIEW output with SurroundView look around Clip Name Timecode and Safe Action Safe Title frame guides In addition to video data the HDMI output also provides 4 channels of embedded audio NOTE Default
20. MENU BUTTONS 4 8 To the right of the LCD are five 5 Soft Menu buttons 4 8 H These are pages displaying camera settings For complete information refer to OPERATION gt REDMOTE MENUS gt SOFT MENU BUTTONS 4 8 POWER LOCK SWITCH Below the ambient light sensor is the Power Lock switch 1 Sliding and holding in the switch in the POWER direction for longer than 2 seconds will Power UP or Power DOWN the REDmote Moving the switch to the LOCK position will lockout all REDmote buttons to prevent unintentional operation When in the LOCK position a padlock icon will be displayed in the REDmote LCD display USB POWER PORT On the lower right side is a USB port that may be used to charge the REDmote internal battery Refer to CHARGING BATTERY LIFE gt CHARGING USING USB CONNECTOR for complete information OPERATION REDMOTE MENUS SOFT MENU BUTTONS 1 3 Located below the main screen are Soft Menu Buttons 1 3 Directly above those buttons are menu options controlled by the corresponding button 1 CONNECT Used when wireless function is used Pressing Soft Menu Button 1 Connect will display a list of cached cameras if previously connected RESCAN and CANCEL or DISCONNECT Version 2 0 2 167 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE When the RESCAN is displayed press the ENTER button to search for paired cameras If previously connected you will get a list of paired cameras Aperture
21. NOTE Once firmware is upgraded on REDmote or camera the REDmote must be paired to the camera again IMPORTANT After upgrading your REDmote firmware to v1 0 13 you CANNOT roll back the firmware to lower than v771 Version 2 0 2 185 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE SETUP CONFIGURING REDMOTE CONNECTION WITH COMPUTER The first step in upgrading REDmote firmware is to establish communication between the MAC and the REDmote 1 Connect a USB to mini USB cable between the computer and the USB connector on the REDmote 2 Go to System Preferences and choose Network This may open automatically when the REDmote is connected 3 Look for a device called RNDIS Gadget 6 Network a Location Automatic B Ethernet onnected Status Connected RNDIS Ethernet Gadget is currently active RNDIS Gadget ay and has the IP address 192 168 0 1 Connected aa ave saad oe Configure IPv4 Manually HA e FireWire IP Address 192 168 0 1 Subnet Mask AirPort No IP Addres Router DNS Server Search Domains 802 1X WPA RED Connect WY Advanced amp 1 sss rr Click the lock to prevent further changes Assist me Revert Apply 4 Change Configure IPv4 setting to Manually as shown 5 Inthe IP Address field enter 192 168 0 1 as shown 6 The Status should change to Connected afte
22. Output In this image the camera is appropriately exposed for this scene The monitor is neither very dark nor very bright and the histogram is spread evenly given that there are bright highlights on the coin we wish not to blow out Note that there is no red bar on either the left or the right edges of the histogram and the vertical color stack to the right of the histogram is at yellow These indicators suggest that there is no significant amount of the sensor s RAW data in the noise or at clip and that the peak level of the sensor s RAW data is about 2 3 stop below clipping Version 2 0 2 201 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE 0800 vuCLR VE 48 5600 Digital ColorChecker SG Drop Temp Media Power j SO 800 False Color Exposure Select False Color Exposure note they E icon in the GUI when active This mode allows us to visualize where there is under exposure purple or over exposure red in the image In this case there is a very small area of purple under the cracker box and just a suggestion of red on the highlight on the coin which suggested that the sensor is appropriately exposed for this scene Version 2 0 2 202 l 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE 5000 C a V V 48 sec 5600 Drop Temp Media Power 3 SO 800 False Color Video Select False Color Video note the y V icon in the GUI wh
23. REDmote Connections The Mini USB connector A may be used to charge the REDmote from a 3 party USB power source The REDmote interface connector B allows communication between the REDmote and SCARLET X Brain or any expansion module when installed Make sure these contacts are kept clean and free of any grease that may interfere with electrical contact Version 2 0 2 163 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE APPENDIX E REDMOTE OPERATION CONTROL CONNECTORS AND DISPLAY This section describes powering of the REDmote physical controls connectors and displays CONTROLS This section describes the physical controls on the REDmote T Pr In an BSR iC IR A 4 4 gt KN Figure 28 REDmote Controls SuMotonSwten F User Funcion KeysAD K Son Menu Bunons 42 H Soft Menu Buttons 1 3 M ReleaseButon R i l Navigation Group N USB PowerPor Record Status LED Power Status LED Zoom Rocker Switch Focus Record Button STILL MOTION TOGGLE SWITCH On the upper left edge of the REDmote is the STILLS MOVIE toggle switch A used to switch between STILLS operation DOWN and MOVIE operation UP The toggle switch is set to the MOVIE position Version 2 0 2 164 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE the camera settings and defaults become movie specific When the toggle switch is set to the STILLS position
24. Selects GUI display of Shutter Exposure on Main screen as Time 1 xx sec or Angle Degrees Default is Time Angle is shown below C4 rps iso800 28 180 0 5600x 4K HD SHUTTER Enables one of two shutter timing duration modes Absolute or Relative Default selection is Absolute Version 2 0 2 md ag LLL NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE Absolute Shutter Speed is defined exclusively by the Shutter Speed setting NOTE When operating in Absolute mode the shutter speed is reported in White text Relative Shutter Speed is defined by the requested Shutter Speed divided by the ratio of the current capture fps to the Project TIME BASE fps NOTE When operating in Relative mode the shutter speed is reported in Yellow text CAFps iso8U0 x 600k AK HU NOTE If the operator requests a shutter speed that is outside the capability of the camera the camera will automatically limit them when a limiting parameter changes APERTURE Selects GUI display of f stop as 1 4 f Stop or 1 3 f Stop Default is 1 8 FOCAL DISTANCE Allows you to set the Lens Info to display in Metric or Imperial measurements Default is Imperial CAFPs isoBU0 2B YABsEc 5600k 4K HD FRAME GUIDE This sub menu provides a selection of frame guides and safe action and safe title guides User definable safe action and safe title guides may be saved as a USER PREFERENCE thereby permitting the camera guid
25. Soft Menu Button 1 under CONNECT The REDmote will display Searching b If the Camera RESCAN is displayed press the ENTER button The REDmote will display Searching 2 When a camera is found the REDmote will display Camera RESCAN and below that the name and MAC address in parenthesis of the camera NOTE If more than one camera has been connected wirelessly to this REDmote multiple cameras may be listed Sensitivity Exposure Color Temp x RESCAN CANCEL DEFAULT Version 2 0 2 180 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE 3 Select the desired camera and press the Enter button The REDmote will display Connecting Aperture Focus m Zoom Sensitivity Exposure Color Temp RESCAN CANCEL DEFAULT 4 The REDmote will connect to the camera and display the cameras current settings and status The wireless connection will be shown in the lower Right corner of the REDmote screen Aperture Focus m Zoom Sensitivity Exposure Color Temp S6n0Y Format Redcode Sensor FP5 oc sar el 47 58 54 POWER UP DOWN Located on the upper right side of the REDmote is the Power Lock Switch refer to CONTROLS POWER UP CONNECTED TO CAMERA If the REDmote is physically attached to a camera when the camera is powered UP the REDmote will automatically power UP along with the camera NOT CONNECTED TO CAMERA To manually power
26. Successfully will appear REDmote will also display this message MEDIA MENU The Media Menu is used to format media SSD prior to use on the camera as well as to Eject unmount the media prior to removal from the camera Available options when selected are SELECT MEDIA SET MEDIA FORMAT MEDIA EJECT MEDIA and UTILITIES IMPORTANT Media MUST be ejected from the camera before removal to prevent corruption and or loss of data on media Presets Media Settings Power SELECT MEDIA Allows you to select the Media location to be used by the camera Default is the Side SSD Module SET MEDIA When selected a new dialog box will appear allowing you to add properties to the media highlighted in the Current Media box when formatting Available options are REEL NO CAM ID CAM POS and SET to set the values entered Presets Media Settings Power m im cover Ja Version 2 0 2 76 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE REEL NO When selected a keypad will appear allowing you to enter a value between 1 and 999 CAMERA ID SLATE Identifies the camera with a letter A through Z Default is A CAMERA POS POSITION Identifies the camera position as Right Left or Center Default is Center FORMAT MEDIA When selected a new dialog box will appear allowing you to add properties to the media highlighted in the Current Media box when formatting Available op
27. TIME BASE has been selected the FPS text will turn Yellow and VARISPEED will be shown where the Audio Meter is normally displayed at the lower right of the display yso800 v2 48sec 5600k 4KHD RC8 1 A001_C007 1 6 0 521 5 0 2 Varispeed Version 2 0 2 54 2011 RED COM INC NOVEMBER 18 2011 ET X OPERATION GUIDE If you press record with a frame rate set too high for the selected record quality you will be prompted to allow the camera to change the REDCODE setting to the maximum quality that enables that frame rate REDmote will also display this message BASIC SETTINGS Provides quick selection of the most common Varispeed frame rates CA rps iso800 728 48sec 5600k 4K HD Bres 12Fes 2d Fes 25res 3DFPs ADVANCED SETTINGS CAFPs isoB00 2B 74BsEC 5600k AK HD When selected a numerical keypad will appear allowing the desired Varispeed Framerate to be entered in 1 fps increments Maximum frame rate is a function of RECORD RESOLUTION and REDCODE settings Granularity is 0 5 FPS CArps yso800 i ABsec 560DK 4K HD 22 97 FPS On Touchscreen systems a Keypad is available for direct numeric entry of the Varispeed FPS value Touch the value bounded by the and labels to bring up press outside the keypad to confirm the value Version 2 0 2 y T J ff L NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATI
28. a clip is compressed using proprietary wavelet based REDCODE RAW compression then stored to digital media such as a REDMAG 1 8 SSD The RAW data recorded is independent of any RGB domain signal processing choices such as ISO White Balance or other RGB color space adjustments made by the camera operator These parameters are saved with the RAW data as reference METADATA they are not burned into the recorded RAW data This recording technique permits RGB color processing choices to be deferred to post production and or to be adjusted in the field to visualize alternative color treatments without affecting the recorded image Version 2 0 2 11 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE The camera s monitoring path converts RAW sensor data to a white balanced 12 bit depth 2048 x 1080 pixel RGB 4 4 4 video signal This signal may be modified using ISO White Balance or other RGB color space adjustments as desired by the operator and is then scaled and gamma corrected to provide VIEWFINDER HD SDI and HDMI monitor outputs at 10 bit depth in 4 2 2 Y Cb Cr or at 8 bit depth in 4 4 4 RGB Frame guides and other camera data may be added as desired by the user to one or more of the outputs NOTE If a specific set of RGB image processing values are desired to be repeatable on set a RMD look file may be created by supplied REDCINE X PRO application software The camera can generate preset files
29. ask the camera if it is paired or not so it only displays paired cameras in the connection list 1 On the REDmote press Soft Menu Button 1 under CONNECT Version 2 0 2 n NOVEMBER 18 2011 2011 RED COM INC OPERATION GUIDE 2 REDmote will display the name DEFAULT in this case and MAC address in parenthesis of the camera This can take 20 30 seconds if RESCAN is selected otherwise a cached list of cameras found during the last search will be displayed NOTE The MAC address after the name will ONLY be displayed if multiple cameras have the same name Aperture Focus m Zoom 3 0 u8cm Omm Sema ity Exposure Color temp r iy A COND RESCAN DISCONNECT DEFAULT A00 1_ C006 T DEFAULT 20 47 13 NOTE If more than one camera has been PAIRED with a REDmote multiple cameras will be listed NOTE The camera name can be setup on the camera under SETINGS gt SETUP gt COMMUNICATION Select NAME and a keyboard will appear allowing you to select the camera name This can also be performed after pairing the REDmote Presets Media Settings Power 3 Select the desired camera and press the Enter button Version 2 0 2 z 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE 4 The REDmote will connect to the camera and display the cameras current settings and status The wireless connection will be shown in the lower Right corner of the REDmote scree
30. display this message EXPORT IMPORT PRESET When selected you will be able to export presets from the camera to external memory 1 8 SSD import presets from the external memory 1 8 SSD to the camera or apply available RMD presets NOTE Exported presets will be located in a folder labeled Presets on the CF or 1 8 SSD This is also the location to place any presets for importing CAMERA PRESETS When EXPORT PRESET is selected this will export the CAMERA PRESTS from the camera to the external memory 1 8 SSD Once a preset is exported it will appear as a selection in the DISK PRESETS field Version 2 0 2 13 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE NOTE If external memory is not connected the Export Preset function cannot be performed Presets Media Settings Power When successfully completed Preset Exported Successfully will appear REDmote will also display this message DISK PRESETS When IMPORT is selected the selected preset will import from external media 1 8 SSD to the camera Once imported the preset will be listed under CAMERA PRESETS NOTE If no media is connected or no presets are saved to the media this selection will remain Grayed out until a preset is exported of course Presets Media Settings Power Version 2 0 2 74 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE You w
31. is recording Power down the camera verify the media is inserted properly inspect connectors for damage power up and resume recording sion _ PRESET COULD NOT BE APPLIED If the preset could not be applied Preset Could Not Be Applied will appear to inform you Power down camera power back up and attempt to apply the preset that failed CAMERA CANNOT BE PAIRED TO REDMOTE e Ensure REDmote display indicates IDLE before attempting to pair the camera to the REDmote e Ensure the REDmote is detached from the rear of the camera body and powered on e Ensure the REDmote wireless in turned on e Ensure camera does not display REDLINK Upgrade Required Version 2 0 2 212 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE APPENDIX K TECHNICAL DATA TECHNICAL SPECIFICATIONS SEN ee crrec wsTERIUM 27 7mm h x 14 6mm v x 31 4 mm d MAX DEPTH OF FIELD Equivalent to S85mm Motion APS H Still lenses PROJECT FRAME RATES 23 98 24 25 29 97 47 96 48 50 59 97 4K DPX TIFF OpenEXR RED RAY via optional encoder DELIVERY FORMATS 2K DPX TIFF OpenEXR RED RAY via optional encoder FROM REDCINE X 1080p RGB or 4 2 2 720p 4 2 2 Quicktime JPEG Avid AAF MXF 1080p 4 2 0 720p 4 2 0 H 264 MP4 HD SDI and HDMI with Frame Guides and Look Around or Clean MONITOR PROGRAM OUTPUT Feed 1080p 4 2 2 720p 4 2 2 SMPTE Timecode HANC Metadata 24 bit 48Khz Audio DIGITAL MED
32. is securely attached 3 The REDmote will confirm by displaying DOCKED momentarily if REDmote is ON when docked NOTE If the camera is ON and the REDmote is OFF the REDmote will automatically power UP when connected Version 2 0 2 174 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE REMOVING UNDOCKING 1 Depress the two 2 release buttons located on the sides of the REDmote 2 Slide the REDmote upward to release from the V Mount of the camera module 3 Remove the REDmote REDBDMOTE 4 If the REDmote is on when undocked Reconnecting will be displayed and the Green LED will flash The REDmote will connect with the camera wirelessly if the REDmote has been paired with the camera previously WIRELESS CONNECTION PAIR CAMERA WITH REDMOTE When the REDmote is wirelessly connected to the camera the camera ID will be stored in the REDmote until the REDmote firmware is upgraded After setting up the wireless connection the REDmote will automatically locate and connect to the camera whenever both are powered on The camera can be paired with one and only one REDmote The REDmote has no knowledge of what cameras are paired with it until it searches for cameras To communicate to a desired camera wirelessly using the REDmote perform the following procedure 1 Ensure the REDmote and camera is both powered up 2 Ensure REDmote is NOT physically connected to the camera Versio
33. not respond to commands when in Playback mode C 10800 5600k View Presets Media Settings Meta ISO Allows you to change the ISO in the clip during playback 1s0800 5600x View Presets Media Settings Meta 20 s0400 Is05 D s0640 10800 1s0 1000 1so 1280 iso 1600 ISOC Version 2 0 2 130 2011 RED COM INC NOVEMBER 18 2011 WHITE BALANCE Allows you to change the White Balance in the clip during playback io800 5600k View Presets Media Settings Meta 5200x 5300x 5400x 5500x 5600x 5700x 5800x 5900x 6000x Advanced Menu Opens the advanced White Balance settings without the ability to Calculate iso800 5600xk View Presets Media Settings Meta VIEW Allows you to select the items to be displayed in the playback window Available options are Center File Name Time Code Frame Guide Action Guide and Title Guide isoB00 5600x Presets Media Settings Meta Version 2 0 2 _ s Q U P O T lt 14 L NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE PRESETS Allows you to apply presets to the clip during playback isoBUU N6U0k View MEDIA When selected will list all available clips on the attached media s0800 5600k View Presets Media Settings Meta A004 _CO001_0118XG A004_CO02_01180Y A001_
34. of sustaining damage due to crushing or other forms physical damage Version 2 0 2 9 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE CAUTION The power cord plug for the AC Power Adapter is used as the power disconnect To disconnect all power from the AC Power Adapter unplug the power cord plug from the wall outlet During use the power cord plug should remain easily accessible at all times R Lithium lon batteries may be subject to special handling requirements pursuant to federal and local laws Please refer to specific shipping instructions included with your battery regarding proper transport of your battery Do not handle your battery if it is damaged or leaking Disposal of batteries must be in accordance with local environmental regulations For example California law requires that all rechargeable batteries must be recycled by an authorized recycle center Storing batteries fully charged or in high temperature conditions may permanently reduce the life of the battery Available battery capacity may also be temporarily lessened after storage in low temperature conditions WARNING Do not expose the battery to excessive heat WARNING Danger of explosion if an incorrect battery is charged with the RED Charger or is used to power the camera and accessories Replace only with the same or equivalent type battery CAUTION Refer all service and repair to qualified RED service personnel To reduce the ris
35. or impact Shock Be careful not to drop your camera Internal mechanisms may be damaged by severe shock Mechanical alignment of optical elements may be affected by excessive vibration ELECTROMAGNETIC INTERFERENCE The use of devices using radio or other communication waves may result in the malfunction or interference with the unit and or with audio and video signals Clean only using a dry cloth When cleaning your camera remember that it is not waterproof and moisture can damage electronic circuitry DO NOT rinse or immerse any element of the camera lens or other accessory keep them dry at all times DO NOT use soaps detergents ammonia alkaline cleaners and abrasive cleaning compounds or solvents These substances may damage lens coatings and electronic circuitry Maintain sufficient ventilation DO NOT block any ventilation openings or obstruct cooling fan airflow CAUTION Proper camera ventilation requires a minimum 5 1 25cm clearance between the camera ventilation openings and external surfaces Verify airflow is not impeded by objects that block or cover the ventilation openings Failure to permit adequate airflow may result in overheating of the camera degraded operation and in extreme situations damage to the camera N DO NOT operate or store near any heat sources such as radiators heat registers stoves or any other apparatus that produce heat Store in a protected level and ventilated place Avoid exposure to t
36. pages of information showing camera settings and parameters The available parameters can be customized Refer to SOFT MENU BUTTONS 1 3 gt 2 REMOTE verture Focus m Zoom BBB FLUT Gamma Curve nsitivi OE de HDR Facto ne a ss rama a amam Page 7 button 4 Page 2 button 5 Page 3 button 6 Page 4 and 5 button 7 amp 8 CHARGING BATTERY LIFE INDICATORS CHARGE STATUS Charge status is shown by a Battery indicator at the lower Right corner of the screen When battery charge is good indicator is Green When battery charge is marginal indicator will be Yellow When battery charge is low the indicator turns Red Ensure the battery is fully charged to Green before operating camera in a wireless configuration HOR 1 1 OFF LAN RIG SYNC GEN TC Aperture Focus m Focus ft Filter Zoom Sensitivity pee tie ae rs Ae BART 21 43 18 L When disconnected from camera and ON the indicator will reflect the current charge level Green Yellow or Red When connected to camera or connected to computer using USB cable the indicator will flash at the current charge level to indicate the battery is charging BATTERY STATUS CURRENT CHARGE LEVEL Battery life is shown by an indicator at the lower Right corner of the screen same indicator as charge When battery life is good indicator is Green when battery life is marginal indicator will be Yellow When battery life becomes low and requires recharging th
37. provided by the field production sound mixer or other external line level source The sound mixer operator should choose a mixer output level that aligns a reference tone signal to the OdBu 0 775 volts RMS 20dBFS reference mark drawn through the camera s Peak Meter or if using 4dB as reference level a mixer output level that aligns a reference tone signal to the 4dBu 1 23 Volts RMS 16dBFS reference mark The OdBu setting provides up to 24dB of input signal headroom above reference level before clipping 20dB for 4dBu reference level and the maximum signal to noise ratio for the 24 bit digital recording VIDEO MONITORING OUTPUTS In its default configuration the RED SCARLET X camera can simultaneously support one VIEWFINDER output Suitable for use by a BOMB EVF or RED LCD plus one HD SDI based PROGRAM output and one HDMI based PREVIEW output Each output can support a set of overlay graphics including camera GUI timecode clip name and framing guides the specific overlay graphics for each type of output is user configurable The default VIEWFINDER output is the EVF LCD connector located on the front face of the Side SSD Module If neither of these is connected VIEWFINDER output will be automatically transferred to the HDMI output or it may be selected by the operator to appear on the HD SDI output of the camera Brain BOMB EVF A 1280 x 784 pixel resolution progressive scan color image equivalent to viewing a 17 refe
38. selected the right 25 of the screen can be double tapped to start and double tapped again to stop recording Double Click Left 25 to Start AF When selected the left 25 of the screen can be double tapped to start the Auto focus when RED SCARLET X Canon EOS mount and compatible lens are installed Sensor Flip Vertical When selected will flip the image vertically on the sensor not just through the monitors this is the actual image being recorded NOTE Sensor Flip Vertical is NOT available while recording Presets Media Settings Power Presets Media Settings Power A004_C025 A004_C025 LOOK The LOOK menu permits adjustment of COLOR GAIN FLUT and CURVE metadata values These parameters will affect the look of the monitor path but do not affect the actual REDCODE RAW data being recorded Presets Media Settings Power Version 2 0 2 94 2011 RED COM INC NOVEMBER 18 2011 COLOR The Color sub menu permits adjustment of SATURATION CONTRAST and BRIGHTNESS Presets Media Settings Power SATURATION Adjusts color saturation Range is 0 0 monochrome to 3 8 Super color Default is 1 0 CONTRAST Adjusts the overall contrast of the image Range is 1 0 flat to 1 0 max contrast Default is 0 0 BRIGHTNESS Adjusts brightness without crushing highlights Available range is 10 0 to 10 0 Default is 0 0 GAIN The GAIN sub menu permits adjustment of
39. setting is PREVIEW NOTE HDMI video output is Progressive Scan it does not support 1080i or 1080PsF modes Version 2 0 2 161 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE SIDE SSD MODULE REAR lt oO lt O e Oo ex lu Oo lt lt A SSD Slot B VIEWFINDER LCD EVF Figure 26 Side SSD Module An optional Side SSD Module may be mounted on the left side of the camera Brain On the rear face of this module is a slot for inserting REDMAG 1 8 SSD media Do not attempt to insert any other media type or any foreign objects into this slot or damage to the Side SSD Module and or the camera Brain may occur The VIEWFINDER output Module to the front face of the Side SSD provides digital video communications and power interconnection between the camera and a RED EVF or RED LCD digital display Due to the requirement for absolute data integrity this requires a custom cable manufactured by RED the pin out of this interface is not published NOTE Pre fabricated EVF LCD cables are available from RED Digital Cinema e P N 790 0157 EVF LCD Cable Right Angle to Right Angle 6 in 0 15m e P N 790 0153 EVF LCD Cable Right Angle to Straight 18 in 0 5m Version 2 0 2 162 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE REDMOTE This section describes the physical connectors on the REDmote A Mini USB ee Camera Interface Figure 27
40. suitable for monitoring via a PC monitor or most HDTV displays When an HD SDI or HDMI monitor is connected WITHOUT an LCD or EVF and in PREVIEW mode the HD SDI or HDMI monitor will display the menus as if it were the LCD or EVF as shown below displaying setting changes in real rime CA rps ysoB800 i ABsec 5600k 4K HD RC8 1 A001_C006 13 53 1 02 23 Figure 2 Example of Video Monitor Output WITHOUT LCD or EVF Connected RED LCD BOMB EVF The optional RED LCD and BOMB EVF are specialized video monitors that provide the user with a variety of tools to assist framing focus and exposure including Surround View which is an additional look around area visible outside of the recorded image Frame Guides showing common film presentation and television aspects such as 2 40 1 and 16 9 Focus aided by high display resolution 1 1 Focus Check function and False Color overlay Exposure aided by dual Zebras False Color overlay RAW Traffic Lights and RGB histogram System information including current frame rate ISO rating shutter speed color temperature record resolution record quality clip name timecode value and the remaining battery and media capacity For applications where use of an attached RED EVF or RED LCD is not desired for example when working on a crane the VIEWFINDER output can be transferred to the HD SDI or HDMI outputs supporting remote camera monitoring up to 200 f
41. the camera settings and defaults become still photography specific LEDS UPPER The upper LED is used to signal power and record status e Red Startup Recording LOWER The lower LED is used to signal connection status e Green Connected e Blinking Green Searching ZOOM ROCKER SWITCH The pressure sensitive ZOOM rocker switch E may be assigned by the operator to one of a number of operational controls Refer to SECONDARY MENUS gt SETTINGS gt SETUP gt KEYS SHORTCUTS USER FUNCTION KEYS Below the Menu buttons are four 4 User Function Keys A D F The specific function of these keys may be programmed by the user Refer to SECONDARY MENUS gt SETTINGS gt SETUP gt KEYS SHORTCUTS Default settings for User Function Keys A D are as follow e User Key A Press to execute user defined function Default Toggles AF Indicator e User Key B Press to execute user defined function Default Toggles False Color gt RAW Check e User Key C Press to execute user defined function Default Toggles False Color gt 1 1 Focus Check e User Key D Press to execute user defined function Default Toggles False Color gt Exposure Check MENU BUTTON Below and to the left of the User Keys is the MENU button G press once enter the menus at the top level press twice in quick succession to re enter menus at the last location from which you exited them SOFT MENU BUTTONS 1 3 Below the LCD are three 3 Soft Me
42. time Presets Media Settings Power HDR MENU Available options are HDR OFF HDRx and STOPS NOTE HDR mode cannot be modified when in Magnify 1 1 mode Presets Media Settings Power HDR ON OFF By default HDRx is OFF HDR button is illuminated Blue In the Lower Status Group of the Viewfinder screen the HDR text is Gray indicating HDRx is inactive To turn HDRx on navigate to the HDRx button using the Nav Group and press ENTER or from the touchscreen directly touch the HDRx button In the Lower Status Group of the Viewfinder screen the HDR text will turn White indicating HDRx is active Varispeed Version 2 0 2 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE STOPS To adjust the STOPS parameter select the Stops box and use the UP DOWN arrows to adjust Presets Media Settings Power ont HDR Range is 1 to 6 Default Is 2 FOCUS MENU The Focus Menu is used to enable and select Focus parameters including MODE and ZONES Presets Media Settings Power a MODE MANUAL FOCUS To adjust the MODE parameter select the Menu box and use the UP DOWN arrows to adjust Available options are MANUAL and CONFIRM Default is MANUAL MANUAL When selected all focus operations are manual CONFIRM Enables the Center or Spot focus square for use with manual focus This mode provides additional focus assistance to the photographer using RE
43. to DC IN power status displays BRICK and reports the of remaining battery capacity and the displayed text is color coded as follows e Green 99 11 e Yellow 10 6 e Red 5 0 RAW CLIP METER The RAW Clip meter looks a traffic light style meter and indicates if either of the Red Blue or Green channels of the RAW sensor data are clipping This meter is unaffected by White Balance ISO VIEW or LOOK settings and therefore represents a true measurement of the exposure levels of the sensor at all times Version 2 0 2 39 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE RAW NOISE LEVEL BAR The RAW noise level bar displays the amount of pixels in the image that are in noise For example if the bar is about 1 8 of the total height this would indicate approximately 1 8 of the total pixels in the image are at an exposure level at risk of displaying noise when pushed at higher ISO or FLUT values in postproduction RAW CLIP LEVEL BAR The RAW clip level bar displays the amount of pixels in the image that are clipping For example if the bar is about 1 4 of the total height this would indicate approximately 1 8 of the total pixels in the image are at an exposure level at risk of clipping and may not be recoverable by lowering ISO or FLUT values in postproduction SIDE HANDLE As you navigate and adjust settings on the camera main menu settings only they will be reflected on the
44. 0 u8cm Omm 3 0 u8cm Omm Sensitivity Exposure Color Temp Sensitivity Exposure Color Temp e800 wafan YAQ cerr Benne DEFAULT If there is a confirmation available such as when performing a Black Shading Calibration the REDmote will allow you to respond to the same prompts displayed on the camera 18 04 17 amp When the REDmote is docked to the camera the messages and prompts will no longer display Version 2 0 2 184 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE RECORDING IMPORTANT Before recording from a REDmote ensure the camera is properly powered set up and media is connected Refer to BASIC OPERATION To record press the Red REC record button on the REDmote or any of the other available record buttons e f media is connected and properly formatted the upper LED will illuminate Red and the Timecode text will change to Red Aperture Focus m Zoom mm Sensitivity Exposure Color Temp S600 Format Redcode Sensor FPS ak HE A001 Co03 uqg DEFAULT e If media is NOT connected the REDmote and camera LCD will indicate NO MEDIA ATTACHED HOR 1 1 OFF LAN RIG SYNC GEN TC Aperture Focus m Zoom 3 0 u8cm Omm Sensitivity Exposure Color Temp 0800 aoe TT H4 To stop recording press the record button a second time MAINTENANCE UPGRADING REDMOTE FIRMWARE The REDmote Update program allows you to upgrade the firmware on your REDmote
45. 03Y zewwegagy t dO rt L33HS OL OD t dO L33HS OL OD v dO L LAAHS OL OD t dO L LAAHS OL OD SONILLLAS JdNSOdXJ X LATHWIS k u NNJN ONI NOO dq3ati 11020 Z 0 Z NOISHAA r EL l ci kE dJa BA ERMEE Atala ZHt6 6S 1H9 lu q ZHOS ZH8b cS6 Lv 1431 de AV1eaAO ZH9L6 6c ZHS Y NV31O9 MalAddd NIT ZHPZ 9L6 EZ olny dogot doz oOnv SNNIN 440 ano OJ NT 1H9I4 Ge 8 SAV O I Oud Pasu asa g SAV o l Otd dogo 14371 Ge AVTYHSAO V SAV O I Otd V Sav O I OHd Y NV319 N3IA3tid SOTVNV O I Otd JINON G39ONVIVaNn YNY O I Otid _VWNV WVO dogot dozz OLNV SNNAIN 33O 19 JJ 842 0 s Bueu o 104 LHSIY Ge 1331 Ge p ue1s 1 aq ISNIN eweg AV1YdSA0 NV319 uun DUS y 1ep lqeu N3IIA3tid SNNSIN q 1ouueo GS GH PuE INAH x yaun O ynna yaun O yna G318VN3 dl N3389S NNIWN NSISSV ATIVOLLVNOLNV LI juewysnipy unioA yndul s pnijoul dol qaqIAOud u3sn gDp9 L HO TVNt31X3 3aoqa qo NO 4dO uonng NNJN Sss 4d TWNDIS 1S31 TIVN9IS 1S31 tI31N3 SS 1d SAV1dSIG SAV1dSIG 1u unsnf pVv uunioA u sy no del yndi1no s pni5oul iLIXa OL gP 6S NO ALN NO t dO LAAHS OL OD t dO rt LAAHS OL OD t dO L LAAHS OL OD t dO L LAAHS OL OD SONILLLAS aYNSOdx4 v dO L33HS gy ON NOO dati LLOZO xX LADHWV3OS AMATSEUOS dJa pino uoneJz do 0 1949H GVW Nain 60 NOISHJA NO LLNG H31N3 SS3tid pin uoneJ do 0 JAJOY pino uonei do o
46. 1 19494 N3JY9S LN3INNS I TV dOSN3S 318VSIq 318VN3 VH3INVO9 40 LOOdsY SSYINOAY 3YVMdYVH TV SH3AOOSIdq3q YO G10H ANY dV 11X3 OL 1s31 NSSYOSHONOL S318VN3 VuH3INVO dO 100834 Satulnoaqd SONILLAS AHYOLOVA OL AYOLS3AY OL SLdINOYd NYS LLVd LSJL YOSNAS alavsid 318VN3 NNAW SONILAS OL SNUNLaY A3 NNAW A NOILVYSITVS SNIGVHS MOV1d IWdOdtidd OL SLdINOYd TIVLSNI tdO4 SLdINOWd ALVddN SAYVMLIOS YO4 VIGAN IWNYALXA S3O3HO NOI 1VtI8I1VO SNIGVHS MOV1d WHOJH3d OL SLdINOtid VIAN IWNYALX3 OL J714 907 WALSAS SJAVS NOISYSA AYVMLIOS 8 Nid Vd3INVO SAV1dSIG JO O9E yey SH Y3SN AdOLOVA N3JH9S NOILVYN9IJANOO WALSAS SAVTdSIG HO 33JO SAV1S AXOUd Y Y Y TWNYSLNI YALLNHS 1N0 4SOddNd TVtI3N3S NI 3SOduNd TVd3N3S 000Z dS ALITVE OLNY TVANVIN MSO 1INAD 34O LNO DNAS NI DNAS OOLZ OdS ALIVE VIOINHO31 LN3IA3 13 3NON 001 OL SZ 001 OL SZ LH9DIT ATIVL dA3 L Aemeyey ysewz N sseippy dl da3 Na SL 0 ixa ozo dona v 199 9 S I uuEguo IE EnuElA T AYOMLIN JLOWGJY YIiYdNN ALLOY HlYd evon 19611 dnog owen S W H ANIL SEPTYISEE GIS SALOWGSY HOS NVOS A Q W 31vq STIVLAG IVWNOILVYsadO tOd AGINS NOILVasadO OL 4343H YANHOO 1431 Y3ddN AHL NI 379919 AHL LOATAS MOVEAV 1d LIXS OL NAYS Q97 JHL 40 Y3NY09 1437 Y3ddN JHL NI MOWHV JHL SNI L9313S Ad G3SS39OSV 34 OSTV NVO VIG3IN G3HOVLLIV NO Sdl19 3O MOVEAV Id SMOTIV t dO LAAHS OL OD t dO LAAHS OL OD t dO L LAAHS OL O
47. 3 Zoom Out Speed 4 109 2011 RED COM INC RED SCARLET X OPERATION GUIDE REDmote Tele Level 0 REDmote Menu Key Down REDmote North Key Down REDmote South Key Down REDmote East Key Down REDmote West Key Down REDmote Center Key Down REDmote Rotary CW REDmote Rotary CCW LCD LCD Function 1 Button Down LCD Function 2 Button Down LCD Arrow Up Button Down LCD Arrow Down Button Down EVF EVF Function 1 Button Down EVF Function 2 Button Down KEY ACTION Zoom Stop Menu Toggle Menu Up Menu Down Menu Right Menu Left Menu Select Rotary Next Value Rotary Previous Value Toggle Magnify Exposure Check Brain LCD Br Up Brain LCD Br Down Brain LCD Br Up Brain LCD Br Down When the desired User Key is selected this setting allows the desired action for that User Key to be defined by the user Available actions are as follow Activate ISO Activate WB Activate Shutter Active Aperture Toggle Record Toggle Magnify WB Calc Menu Select Eject Media HALF press request Menu Left Menu Right Menu Toggle No Action Shutter Sync False Color Next Value Previous Value Shutdown No Action Toggle AF Mode Exposure Check Toggle REDCode Zoom Stop Zoom In Speed 1 Zoom In Speed 2 Zoom In Speed 3 Zoom In Speed 4 Zoom Out Speed 1 Zoom Out Speed 2 Zoom Out Speed 3 Zoom Out Speed 4 Brain LCD Br Up Brain LCD Br Down Toggle ND Filter Open FPS List Open ISO List Open Apert
48. 4 fps NOTE A project can only support one Time Base as this defines the frame count to be used for time code and as the clip playback and editing frame rate It is also the primary frame rate for acquisition but variable speed over crank and under crank recordings can be made above and below this base frame rate using the VARISPEED menu Version 2 0 2 4 l 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE RECORD RESOLUTION CAFPs isoB00 2 6 ABsec 5600k 4K HD 5K 4K 4KHD 3K PK To adjust Record Resolution navigate the Cursor to the RESOLUTION icon in the Upper Status Row and press the Navigation Group ENTER key Adjust to the desired value using the Scroll Wheel and press ENTER a second time to confirm If using a Touch Screen press the RESOLUTION ICON adjust RESOLUTION by sliding your finger left right or tap on the desired resolution and then press anywhere else on the touch screen to confirm The following Recording Resolutions are currently available e 5K e 4K e 4K HD e 3K e 2K RECORD QUALITY REDCODE re D YABSEC u600k AK HD 3 1 4 1 5 1 6 41 7 1 RB 8 1 10 1 11 1 12 1 13 1 To adjust Record Quality navigate the Cursor to the QUALITY RC icon using the Navigation Group Scroll Wheel then press the ENTER key Adjust to the desired value using the Scroll Wheel and then press ENTER to confirm Available REDCODE compression options are RC 3 1 through RC 18 1
49. A iat k S G E ma N BA EFA EENS ae AEREI EE Add lL AJINDVIN 3195O1 0 0 0 00L 0 0 0 00L 0 00L OL 0 0 X 00 0L OL 00 L 00 0 OL 00 L jeueduy 4 L 1nlosqv TIVIH3dNWI SIHI3NW 4 L 3t L 3HAlHV1dd 3alnlosgv 33O STOOL 0 00L OL 0 0 A 0 0 0 001 00 0 00L 0 00t OL 0 0 A 0 00 OL 0 0 X 4 v8 O10 L 1 L 80L Y Y Y 66 OL L 101 OL SL 601 OL 6 HO Y Vv gay MOTISA AVYHD Y 3asn Fb 6 9L s a3 MOTIJA AVYD yasn o s 6 91 13ySVug qaHsvq qi10S 00 S 0S SZ 0 ania 3adu nd auHM L s L eb 440 001 SL 0S S 0 ania aldund 3LIHM 198 ev 3dO E C A Linvaad Ad q3a18Vsiq Linv4ad Ads q318VSiq suonrsu uuidq IeO IN A dij4 4osu s LIG I et dV PIS 0 SZ 49 3olIO olqnoq L au momaa avas u3asn iser ina p10994 0 SZ 14814 391IO lqnoq 00l S 0S S 0 ania 3l1du nd 3LIHA Lv 69 33JO JiuBeN o youtd saunisaS HONOL SS3NLH9IH8 dA3 G91 poo uL L ojuj suey A owen als A H0709 AONVYVdISNVYL punojy 4007 pu9 13 u39 7 s uoz dV F 00 1 S2 0 0S 0 S2 0 00 0F 00 L SZ 0 0S 0 Sc 0 00 0 o z OL 0z 0 Z OL 0 2 0 8 OL 0 8 00 OL 0 0 o t OLO L o r OL 00 0 00 L OL 00 0 A 00 L OL 00 0 X 0 0L OL 0 0 00 OL 0 0 0 OL OL 0 0 mn9 J sn lqeu3 cewwegqay w 4607
50. AND e E EE EE E 196 Underexposure 2 stops 196 Overexposure 2 stops 198 Appropriate Exposure 201 RED SCARLET X Operation Guide Version 2 0 2 November 18 2011 2011 RED COM INC Adjusting the ISO Rating 204 APPENDIX H POST PRODUCTION 206 Software Tools 206 REDCINE X PRO 207 APPENDIX I MAINTENANCGE 208 Cleaning 208 Camera and Accessory Exterior Surfaces 208 Brain 208 LCD Screen 208 F V eee ee 208 REDmote Screen 209 Lenses 209 Side Handle LCD 209 Back Focus Adjustmert 209 APPENDIX J TROUBLESHOOTING 212 No Media Attached 212 Recording Halted Record Error Shutdown 212 Preset Could Not Be Applied 212 Camera Cannot Be Paired to REDmote 212 APPENDIX K TECHNICAL DAI1A nee eee Z L 213 Technical Specifications 213 APPENDIX L MENU MAPS 214 Version 2 0 2 NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE DISCLAIMER RED has made every effort to provide clear and accurate information in this Operation Guide which is provided solely for the user s information While t
51. ARLET X OPERATION GUIDE REDCODE Allows adjustment of REDCODE settings cC 4FPS so800 Ye D AB sec 600x 4K HD 3 1 41 5 1 B 1 7 1 B 1 B 1 10 1 11 1 12 1 13 1 Sn c mamaaaaaaaaaaaaaaaaaaamanan Range is 3 1 to 18 1 Default is 8 1 REDCODE OPTIONS FOR VARIOUS FRAME RATES Min frame rate is 1s per frame max frame rate is a function of REDCODE setting and record resolution SCARLET X REDcode at FPS Max DataRate Max Max REDcode I 55MB s 440Mbits FPS HDRx max FPS Width Height Aspect 8 12 24 25 30 46 50 60 120 5K 12 6 RC5 1 5120 2700 1 90 RC3 1 RC 5 1 4K 25 12 RC 4096 2160 1 90 RC3 1 RO3 1 RC6 1 RC6 1 4K QHD 30 15 RC7 1 3840 2160 1 78 RC3 1 RC3 1 RC6 1 RC 6 1 RC 7 1 3K 48 25 RC 7 1 3072 1620 1 90 RC3 1 RC3 1 RC 4 1 RC 4 1 RC 4 1 RC 7 1 IK 60 30 RC 4 1 2048 1080 1 90 RC 3 1 RC3 1 RC 3 1 RC 3 1 RC 3 1 RC 3 1 RC 3 1 RC 4 1 1K 120 60 RC 3 1 1024 540 1 90 RC3 1 RC 3 1 RC3 1 RC 3 1 RC 3 1 RC 3 1 RC 3 1 RC 3 1 RC 3 1 Version 2 0 2 65 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE SECONDARY MENUS Press the Menu button on the REDmote Side Handle or touch the MENU icon on the LCD to access the Secondary Menus Available options in this menu screen are HDR FOCUS PRESETS MEDIA SETTINGS and POWER EXPOSURE is not implemented at this
52. CO03_0119RY A001_C004_0119LY A001_C005_0119FX A001_CO06_0120XB A001_C006 wd gt D w gt Touchscreen 1 Double Tap the desired clip to open in the playpack window 2 Load will also highlight You can also select LOAD to load the clip in the player and allow playback iso800 5600k View Presets Media Settings Meta A004 _CO001_0118XG A004_CO02_01180Y A001_C003_011SRY A001_C004_0119LY A001_CO05_0119FX A001_CO06_0120XB A001_C006 xa ka d gt Ail Els gt Version 2 0 2 132 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE Side Handle REDmote 1 Select the desired clip to playback and press the ENTER button 2 Load will highlight Select LOAD to load the clip in the player and allow playback 1so800 5600k View Presets Media Settings Meta A004 _CO001_0118XG A004_CO02_01180Y JE KEAL SITIO A001_C006 SETTINGS Available options are DISPLAY LOOK and RECORD iso800 View Presets Media Settings Meta lt Record Display Available options under Display are TOOLS and ZEBRA s0800 5600k View Presets Media Settings Meta a Version 2 0 2 133 NOVEMBER 18 2011 2011 RED COM INC OPERATION GUIDE Tools Allows you to toggle ON OFF Exposure Focus Video Edge and RAW Refer to SETTINGS MENU gt DISPLAY gt TOOLS for complete details about these options View Pr
53. D YELLOW and GREEN color changes to the focus spot window Inadequate subject illumination and or contrast may interfere with normal Focus Confirm operation Version 2 0 2 NOVEMBER 18 2011 2011 RED COM INC RED SAFI LET 2X OPERATION GUIDE For best results with Focus Confirm operators should rock the focus ring focusing through the point of optimum focusing and back again in decreasing amplitude as when zeroing in for precision manual focus Presets Media Settings Power ZONES Available options are CENTER and SPOT Default is CENTER This control allows selection of the boxes used to indicate objects in out of focus Focus Presets Media Settings Power Manual Y s CENTER Provides a large square target for focus When objects located in the circle are in focus the square will be Yellow or Green When objects located in the square are out of focus the square will be Red Presets Media Settings Power A001_C006 13 39 04 14 Version 2 0 2 68 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE SPOT Provides a small square target for precise focus similar to Center focus only smaller When objects located in the square are in focus the square will be Yellow or Green When objects located in the square are out of focus the square will be Red Presets Media Settings Power A001_C006 13 38 50 02 SPOT FOCUS INDICATOR Moving
54. D t dO L LAAHS OL OD SONILLLAS JHdNSOdXJ RED DIGITAL CINEMA 2011 RED COM INC All trademarks trade names logos icons images written material code and product names used in association with the accompanying product are the copyrights trademarks or other intellectual property owned and controlled exclusively by Red com Inc
55. D Focus Displayed Image on Camera EPIC Shown Scarlet X Similar Version 2 0 2 210 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE 7 Insert a T 10 Torx screwdriver into the back focus adjustment screw The screw is oriented at approximately 80 as shown Performing Back Focus Adjustment EPIC M Shown Scarlet X Similar 8 Carefully and slowly rotate the back focus adjustment screw to achieve optimum focus Turning CLOCKWISE moves the sensor forward Turning COUNTER CLOCKWISE moves the sensor rearward NOTE The center of the image will never be in perfect focus as the lines are less than 1 3 of a pixel in size 9 The back focus adjustment mechanism Is self locking and does not require a supplementary locking screw 10 Install the screw in plug in the back focus adjustment opening using a T 10 Torx driver 11 This completes the RED SCARLET X back focus adjustment Version 2 0 2 211 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE APPENDIX J TROUBLESHOOTING NO MEDIA ATTACHED Displayed if media is not present or not formatted when pressing the record button Connect media to camera if necessary If media is already connected format media and attempt to record again Refer to APPENDIX B MANAGING DIGITAL MEDIA for detailed information RECORDING HALTED RECORD ERROR SHUTDOWN Displayed if media removed while recording DO NOT remove media while camera
56. ED SCARLET X OPERATION GUIDE RAW RAW displays the image without any ISO correction When selected OFF will be highlighted in the Lower Status Group A003_C003 07 42 45 16 Version 2 0 2 85 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE ZEBRA Zebras enable and adjust the upper and lower values for two independent Zebra indicators One zebra may be used for highlight exposure and the other for mid tone or shadows Zebras will be visible when in 1 1 zoom By default Zebra 1 and 2 are disabled Focus Presets Media Settings Power ZEBRA 1 To enable select ZEBRA 1 check box Areas of the image exposed within these ranges will be indicated by crosshatched overlays at 45 degrees relative to vertical Zebra 1 is shown in the image below A003_ C001 05 01 44 23 High IRE Change the desired setting between 93 and 109 default is 108 Low IRE Change the desired setting between 75 and 107 default is 99 Version 2 0 2 86 l 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE ZEBRA 2 To enable select ZEBRA 2 check box Areas of the image exposed within these ranges will be indicated by crosshatched overlays at 45 degrees relative to vertical Zebra 2 is shown in the image below A003_C001 5 05 0 2 06 22 High IRE Change the desired setting between 1 and 99 default is 1 Low IRE Change the desired setting between 0 and 84 default is 48
57. EOS Mount is installed and a Canon EF or EF S Lens or equivalent is attached a Non Canon EF or EF S Lens may not function as smoothly or accurately Adjusts the aperture F stop of the attached lens The attached lens for the example shown is a Canon EF 24 70mm Version 2 0 2 56 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE BASIC SETTINGS Allows adjustment of the aperture F stop of the attached lens The range will vary depending on the attached lens TED 74BsEC ou600k AK HU en 32 35 740 45 5D ADVANCED SETTINGS When selected the advanced settings menu allows fine control over the f stop value under APERTURE and focal distance under FOCUS CAFPs isoB00 eB YABsEc 5600k AK HD E o APERTURE F STOP Provides the ability to enter the F stop value directly Range depends on attached lens Default depends on attached lens CArps 1s0800 Ve ABsee 55DDK 4K HD E s E onh E A001_C006 Version 2 0 2 5 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE FOCUS Provides the ability to enter the focal distance directly Range depends on attached lens Default depends on attached lens CA rps Iso8DD ve ABsec 5600k 4K HD A001_C006 1 SEC EXPOSURE BASIC SETTINGS Adjusts the exposure of each frame captured by the MYSTERIUM X sensor Shutter speed presets are provided for all common speeds and shutt
58. ERA BRAIN THAT IS NOT COVERED BY WARRANTY To install the side handle 1 Power down the camera if necessary 2 Remove the brain side plate if installed by removing the single screw located at the bottom 3 Rotate upwards to disengage lip at top of side plate trom camera brain ua y SE Ya Remove screw and rotate side plate upwards to remove Insert lip into top of camera brain Press side handle flush against camera brain Rotate thumbscrew g upwards until tight ti Rotate side handle down flush along side of camera brain Rotate thumbscrew upwards until tight Ensure side handle is secure to camera brain You may have to apply steady pressure to get the screw started Version 2 0 2 26 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE To remove the side handle 1 Power down the camera if necessary 2 Rotate the thumbscrew downwards until detached from camera body Disengage lip from top of camera brain Rotate side handle upwards to remove Rotate thumbscrew downwards until loose 3 Rotate upwards and pull down to disengage lip at top of side handle from camera brain 4 Remove side handle from camera Version 2 0 2 27 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE REDMOTE This section describes the physical controls on the REDmote For complete details on REDmote control refer to APPENDIX E REDMOTE OPERATION IMPORTANT Fo
59. False Color Mode Displays false color overlay mode e Magnify Tallies 1 1 if magnify is selected e TC Indicates presence of valid SMPTE timecode signal e Gen Indicates presence of valid Genlock signal e Sync Timecode Jam Sync status e RIG Indicates 3D rig metadata is present e LAN Indicates communication via Ethernet connection e Media Status Media location and remaining media capacity in 41 2011 RED COM INC RED SCARLET X OPERATION GUIDE e Power Indicates D C supply voltage or of e Timecode Current timecode value remaining battery capacity Including current supply voltage e Histogram Displays histogram e Audio Meter Audio input selection and levels NAVIGATING MENUS The primary method to navigate Menus is via the Scroll Wheel on the REDmote or Side Handle Rotate clockwise to move right counter clockwise to move left However the Left and Right direction Navigation Keys REDmote or Side Handle or Adjustment Ring Side Handle may also be used for this purpose The Up and Down direction Navigation Keys provide additional navigation functions when pressed UP Selects Advanced Settings menu DOWN Selects standard Settings menu CAFPs iso8U0 eu YABSEC 9600x AK HU SEY 180 000 Deg As an example position the Cursor under the Shutter Speed 24FPS icon and press the UP Direction Key to access advanced adjustment values for Shutter Speed USING TOUCHSCREEN LCD If operating a Touc
60. Focus m Zoom Sensitivity Exposure Color Temp ESCA The REDmote will ping for cameras it has been paired to When a paired camera or cameras is are found the available cameras will be displayed on the screen DEFAULT in this case Sensitivity Exposure Color Temp GANA CANCEL DEFAULT Select the desired camera to connect to for wireless operation and press the Enter button The REDmote will connect to the selected paired camera Aperture Focus m Zoom Sensitivity Exposure Color Temp RESCAN CANCEL DEFAULT Version 2 0 2 168 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE Select CANCEL to cancel out of the menu if you choose not to connect Sensitivity Exposure Color Temp RESCAN CANCEL Disconnect To stop communicating wirelessly with the camera select Soft Menu Button 1 Connect the select DISCONNECT HOR 1 1 OFF LAN RIG SYNC GEN TC Aperture Focus m Zoom Sensitivity Exposure Color Temp RESCAN DISCONNECT DEFAULT A00 1_ C006 DEFAULT 20 42 19 PON E z z CH4 2 REMOTE When selected will toggle between REMOTE and LOCAL in Red text HOR 1 1 OFF LAN RIG SYNC GEN TC Aperture Focus m Zoom Sensitivity Exposure Color Temp B60 Format Redcode Sensor FPS SKP 7 R 5 55D mi C ool 15 55 00 IN Remote Allows you to control the camera settings however to see these settings you must be able to see the LCD or external moni
61. IA REDMAG 1 8 SSD Module 64 128 256GB Media 16 bit RAW Processing Compression choices of 18 1 to 3 1 1 12 fps 5K FF 1 30 fos 4K HD 1 48 fps 3K HD 1 60 fps 1080p HD 1 120 fps 1K 2 channel uncompressed 24 bit 48KHz Optional 4 channel and AES EBU digital audio RED LCD 5 Touchscreen Display CONTON CE MON BOMB EVF High Definition Viewfinder REMOTE CONTROL REDLINK Wireless Ethernet RS232 GPI Trigger WEIGHT 5lbs Body only CONSTRUCTION Aluminum Alloy COLOR Battleship Gray Brain Body Black Canon Mount and Side SSD All DSMC Modules Black Operating Range 0 C to 40 C 32 F to 104 F TEMPERATURE RANGE Storage Range 20 C to 50 C 4 F to 122 F REDCODE Version 2 0 2 213 NOVEMBER 18 2011 2011 RED COM INC ONI NOO d3ati LOZO Z 0 Z NOISH3A m eg AA al P BA t 3O L L33HS ssa rE XINIHY S Add AlddV L19313S GNV VIGAN TVNua31X3 WOudd AWH L9313S IESE tefe dl VUYAINVS OL LHOdINI lt 13s34d VIGAIN TVNY31X3 LOATAS SLAS3dd ASIA VIG3W IVNY31X3 OL LdOdX3 lt LASAYd vV4JWVY NO LO9313S SLAS3dd V4JWVO rt dO r LAAHS OL OD rt dO L33HS OL OD 31V3H9O skoay uu ls S yndinoO 15 oid Beuu SSNTVA LO313S lt JWYN L3S3td LNdNI gt t dO LAAHS OL OD Vd3INV9 IAOtid4 L3S3tid CQ3AVTdSIqQ sala31aq 4145740 LdOdX3 LYOdWI FEAE te fo A 49 U9 enue lt p ljioc dsun gt y so even VaAINVO OL Slasaud LOdS WYIA
62. ILITIES Options are SECURE FORMAT Presets Media Settings Power mr SECURE FORMAT Secure Format is a low level format the rebuilds the SSD file system It should only be used if the performance of the SSD is in question Presets Media Settings Power mo a center a Format will erase 5 clips NOTE If clips are present on the media you will be informed of how many clips will be erased when you secure format the media Version 2 0 2 O N ox lt s gt L NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE SETTINGS MENU This section describes the various secondary controls available to configure the camera Menu options are DISPLAY LOOK SENSOR PROJECT MODES AUDIO VIDEO SETUP MAINTENANCE and PLAYBACK Presets Media Settings Power ope DISPLAY Available options are TOOLS ZEBRA OVERLAY MODES FRAME GUIDE AREA GUIDES and MONITOR Presets Media Settings Power e o TOOLS The Tools menu permits the operator to adjust the GUI elements displayed on the Viewfinder output s Available options are OFF EXPOSURE FOCUS VIDEO EDGE MAGNIFY and RAW The Dialog is available by either going to SETTINGS gt DISPLAY gt TOOLS or simply clicking on the histogram in the lower left Presets Media Settings Power Eposre Focus veo Eve uso RAW OFF Turns off any of the display modes in the firs
63. INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE GRAPHICAL USER INTERFACE AND NAVIGATION RED LCD TOUCHSCREEN LCD BOMB EVF EXTERNAL MONITORS The following is a general description of the structure of the camera s Graphical User Interface GUI which overlays the video monitor signal on the Viewfinder output s of the camera SHUTTER SPEED TAB sec lt WHITE BALANCE 5600k RESOLUTION 4KHD QUALITY RC 8 1 ISO RATING is0800 F STOP 2 8 FRAME RATE CAFps TITLE GUIDE LENS INFO FRAME GUIDE ACTION GUIDE PICTURE CENTER OVERLAY GRID HDRx MODE CAMERA NEXT CLIP gt FILENAME A001_C007 ERN HISTOGRAM F 0 FALSE COLOR MODE perigee J E GENLOCK RAWNOISE RAW CLIP RESOLUTION PROJECT LEVEL BAR LEVEL BAR FAN FRAME RATE RAW CLIP SPEED MAGNIFY QUALITY METER MEDIA SOURCE STATUS TIMECODE a 02 2 1 23 S SSD erates AUDIO METER POWER JAMSYNC SOURCE STATUS Figure 17 GUI Display Elements The display elements include e Frame Rate Current frame capture rate e ISO Rating Camera sensitivity e F Stop Functional when optional mount and lens are installed e Shutter Speed Exposure Time or Degrees e White Balance Color Temp Version 2 0 2 gt O T lt 35 L 2011 RED COM INC NOVEMBER 18 2011 Resolution Record Resolution Quality REDCODE setting Lens Info Lens information when using s
64. INSTALL THEM WHILE THE CAMERA IS POWERED ON BEFORE INSTALLING OR REMOVING ANY OF THESE ACCESSORIES YOU MUST POWER DOWN THE CAMERA FAILURE TO DO SO MAY RESULT IN DAMAGE TO THE ACCESSORY AND OR CAMERA BRAIN THAT WILL NOT BE COVERED UNDER WARRANTY POWER SOURCES SIDE HANDLE The optional Side Handle accepts one 30Wh REDVOLT battery which can power the camera and typical accessories for approximately 30 minutes when recording in 24 fos RAW 5K MOVIE mode Figure 15 Side Handle Battery Compartment EXTERNAL DC POWER SCARLET X accepts input voltages between 11 5V 17V D C and can draw a maximum current of 12 Amps e An appropriate 150W supply with DC output rated at 15V 10A such as AC Power Adapter P N 740 0019 available from RED DIGITAL CINEMA e RED Charger For RED Charger you must use 2B to 1B Power Adapter Cable P N 790 0138 Version 2 0 2 32 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE e RED BRICK 140Wh batteries may be used with Backpack Quickplate RED Quickplate Battery Belt Clip or RED Cradle via 2B to 1B Power Adapter Cable P N 790 0138 e 4 pin XLR DC power sources may be used with the camera via adaptor cable P N 790 0164 POWER UP Locate the camera s Power Record button on the right face of the Brain NOTE This button also serves as a Record Start Stop button once the camera is powered up Figure 16 Power Record Button Status LEDs When an appropriate pow
65. If using a Touch Screen press the QUALITY icon adjust the REDCODE value by sliding your finger left right or tap on the desired value and then press anywhere else on the touch screen to confirm Default value for REDCODE is 8 1 CAMERA ID SLATE If operating on a multi camera production enter a different Camera ID for each camera otherwise skip this step the camera is ready to shoot The Camera ID is set when the media is formatted Refer to ADVANCED MENU gt MEDIA for details 4 RECORDING Ensure a formatted REDMAG 1 8 SSD is inserted in the camera s Side SSD Module then fully depress any one of the RECORD buttons located on the Brain Side SSD Module Side Handle or REDmote Fully depress again to stop recording The camera will automatically create a unique and sequential file name for each clip recorded on the SSD based on the Camera s I D set in the MEDIA menu REDCODE RAW data recordings store the Color Temperature and Exposure ISO and any RGB color processing values you use in the monitor path as metadata This metadata is used in REDCINE X or Version 2 0 2 49 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE other postproduction software as initial white balance exposure and color correction points however you are free to change these values at any time when you process the RAW footage Time Code and Edge Code values used by the camera are Non Drop Frame NDF Drop Frame DF is not
66. Installed 56 1 SEC EXPOSURE 58 Basic Settings 58 Advanced Settingos 59 White Balance 61 Basic Settings 61 Advanced Settingos 62 Resolution 64 REDcodeg 65 2011 RED COM INC REDcode Options for Various Frame Rates 65 SECONDARY MENUS 66 HDR Menu 66 HDR ON OFF 66 OLODE ssegar rennin 67 Focus Menu 67 MOOG screens 67 ZONOS anni 68 RED SCARLET X DSMC Ti PL Mount Lens 71 RED SCARLET X Canon EOS Mount Lens 71 Exposure Menu 71 Presets Menu 71 Create Preset 72 Export Import Preset 73 Delete Preset 75 Media Menu 76 Select Media 76 Set media 76 Format Media 77 Eject Media 78 UTS ic u usu as susu 19 Settings Menu 80 Display 80 LOOR u u uukasakaatapiasawkiiqaqkamaqiasa 94 PPO 80U uuu uuu ua asas 97 Audio Video 99 SelLuD a asssssusssusasus 107 Maintenance 121 Pla
67. LCHARGER The RED Travelcharger has been designed to charge REDVOLT Li ion batteries or equivalent A completely discharged battery can be fully charged in approximately 90 minutes The battery can also be partially charged to approximately 80 capacity in approximately 60 minutes RED Travelcharger with REDvolt Installed OPERATION INDICATOR e Red Solid Charger ON no battery connected e Yellow Flashing Charger ON battery connected and charging e Green Solid Charger ON battery fully charged e Red Green Alternate Flashing Charger ON fail condition PRE CHARGE The battery can be partially charged to 80 of capacity in approximately 60 minutes Version 2 0 2 149 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE FULL CHARGE The battery is fully charged when voltage reaches 16 4V 0 2V in approximately 90 minutes CHARGER TIME OUT The charger automatically times out after 105 minutes if battery does not reach full charge OVERCHARGE PROTECTION Charging will automatically stop if battery voltage reaches higher than 17 0V 0 12V CHARGING BATTERIES Plug the supplied AC power cord into the charger s AC input and then into the AC power source Verify that the charger s LED status bar is solid Red indicating ready to receive battery for charging Insert a REDVOLT battery into the charger Charger status LED flashes Yellow while charging P O 19 Leave the batt
68. NOO LAS4uYd SAliddV G3NId33q Y 3asn Y3LNJ9 TWANVIN TESE tef sod We9 dAI WeD ON 1994 ew10 4 eino s VIAN LN3AYYNO S3ILIMILN VIAJN Loara S3ILIMLA sod uueO ql WeD ON 1994 VIGAW LN3dtuno sod uueO ql WeD ON 1294 SalLd3dOtid VIAJN LVINdO4 1N3YYN O LAS LVINdOS LAS 919 Od HoAxqat saounos s mod peyoeye 10 BelloA snje s Juan pue oye e pueH apis ulesg uolje90 sAejdsiq VusINVD NMOG SH3AAOd NMOQGLNHS AT NOILLVOO1T VIGAIN qatiiS3aq 19314S VIGSW 19313S INL SIHL LV GQ31N3IN31dWI LON i SAE EE tafal DA 31 n0SOdX3 SONILLLAS SN31 GAHOVLLV BL O L o OAS 0008 L 0 t L OSI 0082 0 0S2 Sd O 0 000 L L 8L 91 LE Me ME GHP Yr MS gt 000 OF 91002 L AG AUYA TIM G3SNVAGV J G3SNVAGQV SN31 GSHOVLLV SN31 GSHOVLLV 5 Sd3 O 0 000 L Ad AYVA TIIM A AYVA TIIM 3nTVA H31N3 ATIVONVIN ALITWNO 3GO0G3HY gt NOILN1OS3d lt q JONVIVE ALIHM p dOLS 4 4 daadSIYVA E A yybi Aeq 3009S Y memea LN3OS3GNVONI X 000 00L 0 00Z L NALSONNL LHSMAVG AONV1VE ALIHM ANTVA d3 N3 1N3os3YN074 AGNOTD LAS4uYd SAliddV SALVIND VS i ATIVANVIN HSV 14 AqQVHS SLASAYd AlddV Pend gM 91V9 P 4 dINALYO1OD P lt Si3S3tid Y 93d 000081 SW 8 0Z OAS 87 1 53d 000 09E 0 000 L SIN 80Z Lt 0 00L 0 OAS L08SZ L O 72 1 ATONV SEV JWIL LNI 31 0SOdX3 ONI NOO dati LOZO r NOISHA
69. ON GUIDE ISO SENSITIVITY Adjusts the camera s ISO rating The sensitivity value is adjustable in 1 3rd stop increments When the ISO rating is adjusted the camera logs the change as metadata and the monitor path reacts accordingly Higher ISO values lead to brighter images in the monitor path and vice versa CAFPs isoB00 2 8 4BsEC 5600k 4K HD 20 10400 is0500 150640 1s0B00 1801000 1801280 1s01600 re Range is ISO 250 12800 Default is ISO 800 F STOP Aperture controls the depth of field of the subject imaged by the camera and in combination with the shutter speed angle setting controls the amount of light falling on the sensor i e exposure Increasing the F stop to a higher number reduces exposure as well as increases the depth of field decreasing the F stop to a lower number increases the exposure and decreases the depth of field You can chose either 1 3 or 1 4 stops CAFps isoB00 2 8 YAB sec 5600k 4K HD Yea v3p 35 40 45 50 RED SCARLET X DSMC TI PL MOUNT INSTALLED When a lens equipped with Cooke s S4 i system is attached to the DSMC Ti PL Mount the camera will display the current aperture F stop of the attached lens This is for information only and on camera adjustment is NOT available manual adjustment only as indicated by being Grayed out ABSEC S6 K 4K HD RED SCARLET X CANON EOS MOUNT INSTALLED This menu will appear when a RED SCARLET X Canon
70. RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE HEADPHONE A 3 5mm stereo jack provides two channels of adjustable level analog audio for monitor headphones Figure 21 Headphone Output Connector PN SIGNAL DESCRIPTION DIRECTION A TIP LEFT Left channel audio Out B RING RIGHT Right channel audio Out ceea eno _ Cameragound The camera s four audio channels may be monitored in pairs either 1L 2R or 3L 4 R or as a quad mix of 1 3L 2 4R based on the MIX parameter Default is 1L 2R Output volume may be adjusted as follows Volume master volume Adjusts headphone volume equally for left and right outputs Range is 18dB to 0dB in 1dB steps Default is 9dB NOTE for maximum output signal quality only use high impedance headphones Version 2 0 2 155 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE SYNC VIDEO SYNC A 4 pin LEMO connector supports shutter synchronization input GPI timecode and genlock signals The shutter Sync Input signal acts as an immediate response hardware trigger to commence a scan This is useful for motion control and other applications where the camera is driven by a master timing device When using SYNC as the camera shutter timing reference fine shutter start time timing SHUTTER PHASE is disabled make any timing adjustments at the external SYNC generator itself Alternatively this input pin may be used as a GPI General Purp
71. RED GAIN BLUE GAIN and GREEN GAIN Presets Media Settings Power RED Adjusts the gain of the RED channel only Range is 0 0 no Red to 10 0 Default is 1 0 Version 2 0 2 F sO v T j lt j O R P o gt L NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE BLUE Adjusts the gain of the BLUE channel only Range is 0 0 no Blue to 10 0 Default is 1 0 GREEN Adjusts the gain of the GREEN channel only Range is 0 0 no Green to 10 0 Default is 1 0 FLUT The FLUT sub menu permits adjustment of FLUT EXPOSURE COMPENSATION and SHADOW Presets Media Settings Power FLUT FLUT Floating Point Lookup Table adjusts mid range tone values Range 8 0 to 8 0 Default is 0 0 EXPOSURE Adjusts exposure compensation Available exposure range is 0 to 0 Default is 0 0 SHADOW Shadow adjusts the toe value of the FLUT or in other words the tone near Black Range is 2 0 to 2 0 Default is 0 0 Increasing the Shadow value raises the video level of near Blacks Lowering the Shadow value crushes the video level of near Blacks Version 2 0 2 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE CURVE The CURVE sub menu permits adjustment of the monitor output Color Space and Gamma curve Available options are REDGamma2 and REDLogFilm Presets Media Settings Power REOGammaz REDLogFilm ENABLE USER CURVE When chec
72. SECONDARY MENUS gt SETTINGS gt PLAYBACK or by touching the Playback arrow icon in the upper Left corner of the GUI b e4res 150800 28 48sec S600k 4KHD ACB The Playback function will display w800 5600k View Presets Media Settings Meta i W E z i A001_CO06 14 19 41 02 TE Ik SIII For complete details go to SECONDARY MENUS gt SETTINGS gt PLAYBACK Version 2 0 2 51 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE MENU CONTROLS Displayed in the Upper Display Group of the VIEWFINDER output s are FRAMERATE FPS EXPOSURE ISO _ _ F Stop WHITE BALANCE RESOLUTION and QUALITY REDcode These parameters are adjustable directly through this screen When using the touchscreen directly to the right of these parameters is the MENU icon which when pressed will take you to the secondary camera set up menus b 24res 180800 28 ABs 5600k 4KHD ACBI ADJUSTMENTS BASIC SETTING ADJUSTMENTS SIDE HANDLE REDMOTE e The MENU button can be used to ENTER the secondary menus as well as CANCEL inside lists and for navigating back up menus e Navigate to the desired setting using the NAVIGATION GROUP direction keys and press ENTER e Use the Scroll Wheel or Adjustment Ring to increase or decrease the parameter value e When the desired value has been selected press ENTER to set BASIC ADJUSTMENTS USING SIDE HANDLE ONLY Although not recommended the
73. Select OK to complete Black Shading calibration Presets Media Settings Power A001_C007 SELF TEST When selected allows you to perform a self test for the sensor and LCD Touchscreen Presets Media Settings Power Touchscreen ENABLE DISABLE SENSOR TEST PATTERN When selected enables disables the sensor test pattern White Screen To turn on select ENABLE SENSOR TEST PATTERN Presets Media Settings Power Version 2 0 2 127 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE To turn off select DISABLE SENSOR TEST PATTERN Presets Media Settings Power Touchscreen TOUCHSCREEN When selected allows you to perform a touchscreen self test When the touchscreen self test is on you can verify all areas of the touch screen respond to touch Simply touch each box using your finger The touchscreen responds to the touch and the Green box turns Blue Version 2 0 2 128 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE To exit the Touchscreen Self Test e Place your finger on the touchscreen and hold it there until the main screen appears e Press the Enter or Menu button on the Side Handle or REDmote RESTORE SYSTEM Restore System permits ALL camera configuration and setup data to be reset to factory default values When selected you will be asked to confirm if you want to delete all settings and restore the factory default s
74. Side Handle can be used stand alone to make basic adjustments to FPS ISO Shutter Speed Resolution and REDcode located on the Main Menu screen Use the Navigation Group to make these adjustments while watching the cursor placement under the desired setting on the side handle LCD When desired setting is selected press the Enter button to access then use the Scroll Wheel Directional Pad or Adjustment Ring to make changes When done press the Enter button again to set the changed parameter The MENU button can be used to ENTER the secondary menus as well as CANCEL inside lists and for navigating back up menus TOUCHSCREEN e The MENU ICON can be used to ENTER the secondary menus as well as CANCEL inside lists and for navigating back up menus e Touch the desired parameter for adjustment e Slide your finger across the screen to scroll through the available parameter values e When desired the parameter value has been selected touch anywhere in the screen area to set Version 2 0 2 52 l 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE e To close an alpha numeric keypad when entering information directly tap anywhere on the screen outside the keypad ADVANCED SETTING MENUS At this time only FRAMERATE F STOP SHUTTER SPEED and WHITE BALANCE on the MAIN MENU have advanced settings and SIDE HANDLE REDMOTE 1 Navigate to the desired setting using the NAVIGATION GROUP direction keys and then press the UP dir
75. Slave camera a unique IP address different from the Master CLIP NAMING CONVENTIONS REEL NO SLATE CAMERA ID CAMERA POSITION Before shooting in Master Slave or Master Master configuration for a Stereo 3D production make sure the Camera Slate Reel No and Cam ID are set to the same value for both Master and Slave cameras Then change the Cam Pos value from the system default of CENTER to either LEFT or RIGHT to identify the left eye and right eye camera in the stereo pair The Reel No Cam ID and Cam Pos can be set when formatting the media or after formatting by using the SET option Refer to SECONDARY MENUS gt MEDIA Version 2 0 2 192 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE Presets Media Settings Power Eo a a Ea NOTE are month xx day xx wildcard xx When Master is set to LEFT Slave is set to RIGHT and both Cam IDs are A the first clip recorded is Master AO01_L001_ R3D Slave A001_R001_ R3D If Master and Slave are both accidentally set to CENTER and both Cam IDs are different Master A Slave B the first clip recorded is IMPORTANT This position is NOT recommended when recording in Master Slave configuration Master A001_C001_ R3D Slave BOO1_CO01_ R3D If Master and Slave cameras are both accidentally set to CENTER and still share the same CAM ID the first clip recorded on each camera will have the s
76. TENANCE gt RESTORE SYSTEM however the factory calibration map will be reselected CURRENT CALMAP Calibration maps are stored in the camera Due to the nature of the camera different calibration maps are needed for different situations Presets Media Settings Power Black Shading Default Black Shading Current FPS Exposure Factory This the calibration map generated during production This map is always present and selected as default on first use after performing a system restore under SETTINGS gt MAINTENANCE gt RESTORE SYSTEM User The user can select the CURRENT CALMAP The dialog only show the calmaps stored in memory FACTORY and USER in this case BLACK SHADING DEFAULT This option uses fixed settings which are the same used for the factory calibration around 23 Deg C BLACK SHADING CURRENT FPS EXPOSURE SETTINGS This option generates a calibration with the currently set frame rate exposure This can be used to generate a calibration for long exposures After calibration Which takes about 10 min the new map is automatically selected BLACK SHADING PROCEDURE The calibration procedures are the same for both BLACK SHADING options Version 2 0 2 124 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE The calibration procedures are the same for both Black Shading 24 FPS 1 48 SEC and Black Shading Current FPS Exposure options When selected a screen will ap
77. UP the REDmote depress and hold the Power Lock Switch in the Down direction for 2 seconds then release Version 2 0 2 181 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE POWER DOWN USING CAMERA When the REDmote is connected to the camera and the camera is powered down the REDmote will also power down When disconnected from the camera the REDmote will not power down with the camera USING REDMOTE 1 To power DOWN the REDmote depress and hold the Power Lock Switch in the Down direction momentarily then release 2 A screen will display with options to power down the REDmote the camera or both the REDmote AND the camera together Aperture Focus m Sd Shutdown REDmote Shutdown Camera NOTE Wireless connection shown above when docked to camera SHUTDOWN CAMERA will not display Aperture Focus m Zoom 3 0 u8cm Omm Sensitivity Exposure Color Temp 1s 00 F Shutdown Cam REDmote 4 Shutdown REDmote 3 Select the desired power down function NOTE When not using the REDmote for maximum battery storage life use the Power Lock Switch to power down the REDmote completely by pressing down in the power off position and using the displayed menu to shut down the REDmote and or the REDmote and camera Refer to POWER UP DOWN gt POWER DOWN If the Power Lock Switch is pressed down in the power off position and held until the REDmote powers down the battery storage life wi
78. YSTERIUM X sensor two 2 different ways Default at 24 FPS 1 48 SEC or using your current FPS Exposure settings Presets Media Settings Power Black Shading Default Black Shading Current FPS Exposure To calibrate the sensor the image needs to be as dark as possible e Ataminimum put a lens cap on the lens WARNING Not all lens caps completely block IR They are made to protect the lens not necessarily to block light e Preferably take of the lens and use the lens mount cap provided by RED e f possible use a dark room e Just closing the Iris is NOT sufficient Additionally a SSD needs to be inserted in the camera to store the raw images during calibration Calibration is required e If the temperature deviates significantly from the currently used calibration it is recommended to recalibrate the sensor Version 2 0 2 123 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE e If very long exposure longer then 1 24 Sec is used it is recommended to recalibrate After Calibration with a lens cap on and ISO set to maximum the sensor should show a uniform noise profile over the whole area without any falloffs on any side You can check at which temperature exposure time the currently used calibration was taken on under SETTINGS gt MAINTENANCE gt SYSTEM STATUS under Calibration Calibration maps will still be available after performing a system restore under SETTINGS gt MAIN
79. a will power down 9 Remove the SSD from the camera wait 10 seconds 10 Power up the camera The green lights will flash for about a minute IMPORTANT THE CAMERA MUST NOT BE SHUTDOWN OR LOSE POWER AT THIS POINT OR THE CAMERA WILL NOT COME BACK UP 11 Go to SECONDARY MENUS gt SETTINGS gt MAINTENANCE gt SYSTEM INFO and verify that the camera monitor output s report back Version 2 0 2 and PIN value specific to camera 12 Installation is now complete NOTE After the firmware upgrade it is mandatory that you re format the REDMAG SSDs before use Refer to APPENDIX B MANAGING DIGITAL MEDIA gt FORMATTING MEDIA NOTE Once firmware is upgraded on REDmote or camera the REDmote must be paired to the camera again IMPORTANT Before formatting your media be sure to copy any clips presets or log files you want to keep to your computer to prevent unwanted loss of your files Refer to APPENDIX B MANAGING DIGITAL MEDIA gt COPYING MEDIA MULTIPLE CAMERAS If multiple cameras are to be upgraded unmount the external media from the camera and perform STEPS 3 through 12 of the previous procedure for each camera Version 2 0 2 142 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE APPENDIX B MANAGING DIGITAL MEDIA MEDIA REDMAG 1 8 SSD is available with capacities of 64GB 128GB or 256GB Record duration is dependent on resolution quality and frame rate but a 64GB SSD will typically provid
80. ame general file structure with the exception of the two wildcard characters which provide full protection against file name duplication IMPORTANT This position is NOT recommended when recording in Master Slave configuration Master A001_C001_ R3D Slave A001_C001_ R3D Version 2 0 2 193 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE CONNECTING CAMERAS 1 While still powered up connect both cameras together using a Master Slave GIG E Cable P N 790 I Tatu lt MOTE Vv lt oO lt O Ww O oz L u A 2 Power down both cameras then power back up When properly connected LAN will illuminate Green on the Ul 3 Connect a SYNC cable P N 790 0154 to each camera and connect as desired to your 3 party device e Yellow connector is for Timecode e Green connector is for Genlock e White connector is multi purpose example for remote trigger for start stop recording Go to SETTINGS gt SETUP gt GPIO SYNC gt SYNC MODE and select GENLOCK 5 Adjust camera project frame rate to match the attached 3 party device When properly connected and synchronized TC GEN and SYNC will illuminate Green on the UI OPERATION CHANGING SETTINGS When changes are made to the Master camera settings the Slave camera setting will also change but not in real time For example when you change the Frame Rate on the Master camera you will not see the change on the S
81. d away from camera body SSD firmly into its slot but without using excessive force to prevent damage 2 When SSD media is inserted into the camera the camera will recognize if the media is unformatted On LCD EVF and external monitors in the media section of the GUI NONE will be displayed twice as opposed to when no media is inserted the GUI displays NONE with three dashes below On REDmote NONE will be displayed twice as opposed to when no media is inserted the GUI displays NONE with three dashes below On the Side Handle NA will be displayed same as if no media is present Version 2 0 2 hO 143 NOVEMBER 18 2011 2011 RED COM INC OPERATION GUIDE Presets Media Settings Power 4 You will be prompted to set the media and select FORMAT Presets Media Settings Power es Sy cener a Format will erase 5 clips Viewfinder output s will display FORMATTING NOTE If when selecting FORMAT the display indicates FORMAT FAILED refer to MEDIA ERRORS 5 Once formatting is completed the Viewfinder output s will display THE MAGAZINE WAS SUCCESSFULLY FORMATTED THE DIGTAL MAGAZINE IS READY FOR IMMEDIATE USE a MEDIA CAPACITY REMAINING STATUS The Viewfinder output s will display the remaining media capacity in the MEDIA indicator 100 is shown Version 2 0 2 14 2011 RED COM INC NOVEMBER 18 2011
82. d seconds in that order Use RTC Time When selected the camera uses the cameras Real Time Clock as the timecode counter source snapshot of the RTC Set Manually When selected allows the user to define a custom value as the timecode counter seed AUDIO VIDEO Menu adjusts AUDIO INPUT AUDIO OUTPUT AUDIO CHANNELS MONITOR CONTROL and TEST SIGNALS Presets Media Settings Power Audio Input Test Signals Version 2 0 2 99 NOVEMBER 18 2011 2011 RED COM INC OPERATION GUIDE AUDIO INPUT Allows you to enable disable and adjust levels for audio inputs CAM ANALOG Available options for each input are ON and OFF Default is OFF Presets Media Settings Power Audio channel level inputs are displayed in the lower section of the UI When audio is enabled and an audio jack is plugged in detected by the camera the circle next to CH1 CH2 etc will be Green and the box around the signal will be highlighted When audio is enabled and an audio jack is not plugged in not detected by the camera the circle will be Red Also when audio is disabled and an audio jack is plugged in the circle will remain Gray but the box around the signal will be highlighted jack is detected by the camera Version 2 0 2 100 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE AUDIO OUTPUT Allows adjustment of audio output levels fed to the outputs Available o
83. dia of 64GB 128GB or 256GB capacity Each MOVIE clip is recorded with a unique name and with all the appropriate elements of the clip including one or more REDCODE RAW R3D files and associated metadata placed in a clip folder with the file extension RDC Refer to CLIP NAMING CONVENTIONS All Clips are placed in a master folder i e root directory for the Magazine with the file extension RDM This folder contains all clips recorded on that digital magazine therefore copying these clips from the digital magazine to backup media may be performed by a single drag and drop operation Version 2 0 2 16 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE For additional information about digital magazines refer to APPENDIX B MANAGING DIGITAL MEDIA A015 03097P oO A AA aje Y DEVICES Macintosh HD Name F A015_03097P KJEM Y E A015_03097P RDM Date Modified Today 1 14 PM Kind Folder Ei iDisk Y A015_C001_0309EJ RDC woe A015_C001_0309EJ_001 R3D T Y A015_C002_030989 RDC WE massa A015_C002_030989_001 R3D IE upstairs G5 Y A015_C003_0309S5 RDC Y PLACES A015_C003_0309S5_001 R3D F Desktop A015_C003_0309S5_002 R3D OS stuart gt A015_C004_0309UL RDC N Applications 1 digital_magazine bin 3 Documents 1 digital_magdynamic bin Today 1 14 PM Folder Today 1 15 PM 2 17 GB RED RAW R3D Today 1 15 PM Folder Today 1 15 PM 907 1 MB RED RAW R3D Today 1 15 PM Fo
84. e e Side Handle Function 3 Key Down Activate Shutter e Side Handle Function 4 Key Down Activate WB e Side Handle Function 5 Key Down Exposure Check e Side Handle Function 6 Key Down Toggle REDCode e Side Handle Function 7 Key Down Eject Media e Side Handle Still Select Set focus mode for still e Side Handle Movie Select Set focus mode for movie e Side Handle Record Half Button Down HALF Press Request e Side Handle Record Full Button Down Toggle Record e Side Handle Tele Level 1 Zoom In Speed 1 e Side Handle Tele Level 2 Zoom In Speed 2 e Side Handle Tele Level 3 Zoom In Speed 3 e Side Handle Tele Level 4 Zoom In Speed 4 e Side Handle Tele Level 1 Zoom Out Speed 1 Version 2 0 2 108 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE Side Handle Tele Level 2 Side Handle Tele Level 3 Side Handle Tele Level 4 Side Handle Tele Level 0 Side Handle Backlight Key Down Side Handle Menu Key Down Side Handle North Key Down Side Handle South Key Down Side Handle West Key Down Side Handle East Key Down Side Handle Center Key Down Side Handle Rotary Front CCW Side Handle Rotary Jog CW Side Handle Rotary Front CW Side Handle Rotary Jog CCW Bottom Handle Bottom Handle Record Half Button Down Bottom Handle Record Full Button Down Bottom Handle Tele Level 1 Bottom Handle Tele Level 2 Bottom Handle Tele Level 3 Bottom Handle Tele Level 4 Bottom Handle Tele Level 1 Bottom Handle Tele Leve
85. e Secondary Menus Playback ICON P In the upper Left corner on the touchscreen LCD Accesses the Playback Function Version 2 0 2 NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE The GUI is broken down into the following three main sections the Upper Status Row the Live Action Area and the Lower Status Row On VIEWFINDER output s all three sections are visible on PREVIEW outputs only the Live Action Area and associated graphic overlays are visible On PROGRAM outputs none of the graphic overlays are visible i e a PROGRAM output is defined to be a CLEAN FEED output UPPER STATUS ROW isoBUU 2 8 48sec 5600k 4KHD RC81 Provides immediate feedback on the most critical image composition parameter settings including from Left to Right e Playback Access Touchscreen e White Balance e Current frame capture rate e Record Resolution e ISO Rating e Record Quality e Shutter Speed or Shutter Angle e Secondary Menus Access Touchscreen Whichever parameter is underlined with a red bar may be immediately adjusted by pressing ENTER in the Navigation Group of the Side Handle or REDmote then using the Scroll Wheel to change the value of that parameter To confirm the parameter change press ENTER a second time NOTE Shutter angle is displayed in Relative mode by default as indicated by Yellow text If the red bar is not on the parameter you wish to change first use the Scroll Wheel to position the red bar
86. e 24 minutes of 24fps 5K RAW recording IMPORTANT After connecting REDMAG 1 8 SSD to the camera and BEFORE recording you should format the media using the camera even if formatting was previously performed on a computer Go to ADANCED MENU gt MEDIA gt FORMAT to properly format media before recording FORMATTING MEDIA Media must be formatted prior to using it for recording Formatting is performed on camera although media may be erased on a Macintosh OS X personal computer allowing the camera to just add the necessary project profile and clip log data NOTE Media formatted on camera will use a name and root volume in the format Camera Letter Reel Number Month Day where is a two digit alphanumeric random number generated by the camera for each file e g A001_0512A6 RDM Clips recorded to the media follow similar naming conventions A001_C001_0512A6_001 RDC and A001_C001_0512A6_H mov etc IMPORTANT Media must always be un mounted prior to removal or disconnection from the camera This ensures power is removed from the digital media and any open data files are closed Failure to do so may result in lost data or corrupted files Refer to REMOVE MEDIA FROM CAMERA UNMOUNT This procedure outlines the formatting of REDMAG 1 8 SSD media using the RED SCARLET X camera Formatting the SSD media will take about 10 seconds 1 Insert SSD into camera Insert the REDMAG 1 8 SSD with the RED logo facing outwar
87. e indicator turns Red Version 2 0 2 172 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE BATTERY LIFE When using the REDmote in wireless configuration the battery will last approximately 8 hours before charging is necessary NOTE When not using the REDmote for maximum battery storage life use the Power Lock Switch to power down the REDmote completely by pressing down in the power off position and using the displayed menu to shut down the REDmote and or the REDmote and camera Refer to POWER UP DOWN gt POWER DOWN If the Power Lock Switch is pressed down in the power off position and held until the REDmote powers down the battery storage life will be reduced greatly as there will be a slight power draw on the REDmote when shut down using this procedure CHARGING CHARGE TIME A fully discharged REDmote battery will be fully charged in approximately 7 hours USING CAMERA While connected to the camera the REDmote will automatically recharge its internal battery Charge status is indicated by the Green Battery Icon at the top right of the REDmote LCD display screen A fully discharged REDmote battery will be re charged in approximately 8 hours if connected to a powered camera A much faster charge time may be achieved with a USB based power source such as laptop P C USING USB CONNECTOR The REDmote can be charged by connecting a Mini USB to USB cable between REDmote and a computer or a cell pho
88. e specific function of keys A and B may be programmed by the user Version 2 0 2 30 l 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE TOUCHSCREEN LCD Figure 14 RED Touchscreen LCD A Backlight Adjust B LCD User Key C LCD User Key D e Backlight Adjust Adjusts LCD backlight intensity Upper button Lower button e LCD User Key C B Press to execute user defined function Default Toggles False Color gt 1 1 Magnify e LCD User Key D C Press to execute user defined function Default Toggles False Color gt Exposure NOTE The specific function of keys C and D may be programmed by the user NOTE The touchscreen LCD also allows navigation of camera menus and selection and adjustment of camera parameters by directly touching icons on the screen Gestures supported include e Tap Tap on an icon to bring up a quick adjustment display e Hold Touch and hold on an icon to bring up an advanced interface display e Slide Touch and slide on an icon to increment a value e Pinch Touch with two fingers then open or close to magnify or normalize the video image Version 2 0 2 31 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE BASIC OPERATION This section describes basic operation starting from power up Viewfinder layout and Menu navigation WARNING THE SIDE HANDLE SIDE SSD MODULE REAR MODULES AND LENS MOUNT ARE NOT HOT SWAPPABLE MEANING YOU CANNOT REMOVE OR
89. e you wish to erase files from 4 Select all the files on the drive you wish to erase IMPORTANT Before performing the next step double check that this is the correct SSD that you wish to erase DATA FROM 5 Press the DELETE key on the keyboard select FILE gt DELETE or right click on selected file and choose DELETE When the pop up window appears click YES 6 The media will need to be formatting by the camera before use Refer to FORMATTING MEDIA Version 2 0 2 147 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE APPENDIX C CHARGING BATTERIES REDVOLT BATTERY LED ARRAY The REDVOLT battery LED array consists of three 8 LED s and a button REDvolt LED Array When button is pressed LEDs will illuminate in relation to battery life available in 33 3 steps If single LED blinks or no LEDs illuminate when pressed battery requires charging BATTERY PERFORMANCE When fully charged to 16 4V 0 2V the REDVOLT battery is designed to provide approximately 30 45 minutes of operational time when powering in the RED SCARLET X camera this may vary depending on installed accessories and loads DISCHARGE PROTECTION The battery is equipped with discharge protection When battery voltage reaches lower than 10V 0 12V the battery stops supplying output voltage discharging Version 2 0 2 148 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE RED TRAVE
90. ecognizable clips A001_C001_0502 RDC BOO1_C001_0502 RDC C001_C001_0502 RDC 3D FOOTAGE Refer to APPENDIX F 3D SETUP OPERATION gt CLIP NAMING CONVENTIONS SMPTE TIMECODE Edge Code is a SMPTE timecode track that always starts at 1 00 00 00 on the first frame recorded to the digital media It is a sequential code that is continuous from frame to frame and also continuous from clip to clip Edge Code is equivalent to RUN RECORD commonly found on broadcast cameras Time Code is a SMPTE timecode track that synchronizes to the camera s clock or if operated in Jam Sync mode to an externally supplied SMPTE master timecode signal It is a sequential code that is continuous from frame to frame but is discontinuous from clip to clip The timecode counter always updates at the same frame rate as the recording irrespective of whether the camera is operating in normal or Vari Speed recording mode This ensures that a valid SMPTE timecode is created without count jumps that would affect clip playback during editing If operating in Jam Sync mode referenced to an external timecode source the clip s master time reference point is the first frame of the recorded clip NOTE When in Loop Record mode Edge Code will also become discontinuous from clip to clip because frames copied into the cache memory are discarded This may lead to editing difficulties with postproduction applications that assume continuous timecode POWER CONSUMPTION T
91. ectional key 2 Use the direction keys to navigate to the desired parameter adjustment field and press ENTER to confirm 3 Use the Scroll Wheel to adjust the selected parameter value 4 When desired selection is made press the MENU button to set TOUCHSCREEN 1 Press and hold the desired parameter to gain access to advanced setting adjustments 2 Press the field a keypad type menu may appear to allow adjustments 3 Press the desired parameter settings to adjust 4 When desired selection is made press anywhere in the screen area to set and exit the advanced settings submenu Version 2 0 2 53 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE MAIN MENU Available options under the MAIN MENU are FRAMERATE FPS ISO SENSATIVITY F STOP 1 SEC EXPOSURE WHITE BALANCE RESOLUTION and QUALITY REDcode CAFPS iso800 2 6 ABsec O600k AK HO RC 8 1 FPS Used to select an image capture frame rate that differs from the Project s TIME BASE frame rate Ranges are as follows e 0 5 to 60 fps at 2K e 0 5 to 30 fps at 4K 4K HD e 0 5 to 48 fps at 3K e 0 5 to 12 fps at 5K Default is 24 fps or the selected Project TIME BASE frame rate if not 23 98 or 24 00 fps 1 sec translates to 1 second per frame Available frame rate is dependent on Resolution and REDcode settings Refer to RECODE gt REDCODE OPTIONS FOR VARIOUS FRAME RATES table VARISPEED When a frame rate other than the current
92. emperature extremes damp severe vibration strong magnetic fields direct sunlight or local heat sources during storage Remove any batteries from the camera before storage Recommended storage and usage temperatures for your camera lenses and other accessories are a Operating range O C to 40 C 32 F to 104 F o Storage range 20 C to 50 C 4 F to 122 F If there are any performance issues with your camera or accessories when operating within this temperature range please file a support ticket on www RED com support The Side Handle Side SSD Module rear modules and Lens Mount are NOT HOT SWAPPABLE meaning you cannot remove or install them while the camera is powered on Before installing or removing any of these accessories you MUST power down the camera Failure to do so may result in damage to the accessory and or camera brain that will not be covered under warranty Do not bypass the third prong of the grounding type plug on the power cord of the AC Power Adapter A grounding type plug has two blades and a third grounding prong The third prong is provided for your safety A grounding type plug shall be connected to an outlet with a protective earthen connection If the grounding type plug does not fit into your outlet do not attempt to modify the plug or outlet consult a qualified electrician Protect all power cords from being pinched walked on or driven over by a vehicle Replace any power cords suspected
93. en active This mode allows us to check the RGB video levels of the scene The two green squares in the upper right corner of the color chart and green in the background indicate that the scene s mid grey and skin tone elements plus peak white and blacks are all at appropriate levels Because the scene was well exposed when the recorded clip is color corrected in post production sufficient headroom exists for the scene s highlight information to be displayed without clipping and the shadow information can be displayed without significant noise even if the brightness of the shadow Information is pulled up Version 2 0 2 203 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE ADJUSTING THE ISO RATING In the following two examples the image exposed at ISO 800 rating have had the ISO rating adjusted first to ISO 6400 and then to ISO 100 NOTE Although the image and Histogram both adjust to changes in the ISO rating the sensor RAW meters do not change they always indicate what is happening at the sensor level and hence where the image is truly in noise or at clipping 24 is 6400 ET 48 5600 n Te Mediz owe Internal Drop emp Media Power 1 RC36 3 SO 6400 No Exposure Adjustment Version 2 0 2 204 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE 24 FPS ISO 100 pry vMCLR 48 sec 5600 Drop Temp Media Power ISO 100 No Exposure Adjustment I
94. ent firmware Version installed and camera P I N Presets Media Settings Power SAVE LOG Select to write camera s LOG file to the REDMAG 1 8 SSD The LOG file is a diagnostic tool that can assist RED with camera troubleshooting After capture upload the LOG file to the RED customer service team contactable at After successfully writing the log file to media viewfinder output s will display LOG SAVE COMPLETED REDmote will also display this message If media is not attached to the camera when attempting to perform a write log request external monitors will display NO MEDIA ATTACHED Version 2 0 2 12 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE NOTE Log files will be stored as txt files in the 1 8 SSD root directory SW UPDATE NOTE Firmware upgrade currently uses a force upgrade procedure as outlined in APPENDIX A UPGRADING CAMERA FIRMWARE Update SW initiates a camera software firmware update If a software update is on the attached media you will be given the option to upgrade the camera earlier firmware version shown for reference ONLY For complete detailed procedure go to APPENDIX A UPDATING CAMERA FIRMWARE CALIBRATION Sensor calibration is a process where the camera generates a calibration map to correct for pixel defects and offsets based on current system and environmental settings This allows you to perform a Black Shading calibration of the M
95. equipment without the approval of manufacturer could void the users authority to operate this equipment Note This device complies with Part 15 of the FCC Rules Version 2 0 2 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE Operations subjected to the following two conditions 1 this device may not cause harmful interference and 2 this device must accept any interference received including that may cause undesirable interference CAUTION Exposure to Radio Frequency Radiation The device shall be used in such a manner that the potential for human contact is minimized This equipment complies with FCC radiation exposure limits set forth for an uncontrolled environment This equipment should be installed and operated with a minimum distance of 20cm between the radiator and your body Caution Regulations of the FCC and FAA prohibit airborne operation of radio frequency wireless devices because there signals could interfere with critical aircraft instruments Caution If the device is changes or modified without permission from RED the user may void his or her authority to operate the equipment AUSTRAILIA AND NEW ZELAND COMPLIANCE STATEMENTS RED declares that the radio equipment described in this document comply with the following international standards e IEC 60065 Product Safety e ETSI EN 300 328 Technical requirement for radio equipment RED declares digital devices described in this document compl
96. equivalent is attached the Focal Length and Focal Distance is displayed on the LCD EVF and external monitors CAFPs 1s0800 2B 74BsEC 5600k 4K HD The focal length and focal distance values and range will vary depending on the attached lens When the focal length or focal distance of the lens is manipulated the current values are displayed RED SCARLET X CANON EOS MOUNT LENS When a RED SCARLET X Canon EOS Mount is installed and a Canon EF or EF S Lens or equivalent is attached the Focal Length and Focal Distance is displayed on the LCD EVF and external monitors When AF is set to Manual or Confirm mode the focus distance displays as a pair of Near Far distances When it is in AF mode a single estimated Focus distance is displayed VABSEC S5 K 4K HD The focal lenoth and focal distance values and range will vary depending on the attached lens When the focal length of the lens is manipulated the current value is displayed under Focal Length The Focal Distance can be changed under MAIN MENU gt F STOP gt ADVANCED SETTINGS EXPOSURE MENU Not implemented at this time PRESETS MENU Presets are stored inside the camera They can be imported exported to the SSD The Presets menu is used to create save and import presets Available options are APPLY CREATE IMPORT EXPORT and DELETE Presets Media Settings Power If presets are available they will be accessible by using the arrow keys in the P
97. er angles for 24 25 fos and 50 60 fps project frame rates CAFPs isoB00 2B 74BsEC 5600k AK HD 30 32 36 40 48 50 60 72 96 maawaawawawaaawaawawaawaawawawaaaaaumamananmumamamaaawaananaumawaamawamawauamaumamamaaaamaan Decreasing Shutter Speed shortens the amount of time over which light falls on the sensor increasing exposure and motion blur on any objects moving within the frame Increasing Shutter Speed increases the amount of time over which light falls on the sensor decreasing exposure and motion blur on objects moving within the frame Range is 1 24 sec 1 8000 sec Slowest available speed is 1 second per frame frame rate so for 24 fps it is 1 24 sec Default is 1 48 Sec Version 2 0 2 58 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE ADVANCED SETTINGS When selected the advanced settings menu allows fine control over the Exposure value and permits entry in any of the three following common units EXPOSURE Shutter Speed INTEGRATION TIME or ABSOLUTE ANGLE Shutter Angle CAFps iso800 2 8 AB sec 5600x 4K HD E 20833m AEI 180 000 Deg I EXPOSURE SPEED Provides the ability to enter the Exposure value as a Shutter Speed 1 xx sec Range is 1 24 1 75301 Sec Slowest available speed is 1 frame rate so for 24 fps it is 1 24 Sec Default is 1 48 Sec CArPs yso800 s Y4Bsec 5600x 4K HD asse
98. er source is connected to the Brain the Power Status LED will illuminate Red If it is illuminated depress and then release the Power Record button The Power Status LED will initially go out and within 5 seconds illuminate Orange to confirm the camera is powering up then it will illuminate Green confirming the camera is powered up and ready to use Version 2 0 2 33 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE If a formatted REDMAG 1 8 SSD is attached to the Brain once powered up the Media Status LED will illuminate Green If this LED is not illuminated verify a formatted REDMAG 1 8 SSD is inserted into the Side SSD Module and or format the SSD if it has not previously been formatted on the camera NOTE Once powered up if the Power Status LED illuminates Red it indicates low remaining battery capacity and a battery exchange or switch over to external DC power is recommended POWER DOWN The camera can be powered down in two ways 1 Using REDmote or Side Handle Menu controls or via Touch Screen LCD icons Refer to SECONDARY MENUS gt POWER 2 Depress and continue to hold the Power Record button in its fully depressed position for a minimum of 5 seconds When the button is released INITIATING CAMERA SHUTDOWN will display and camera will power down After Power Down the Power Status LED will illuminate Red if an appropriate power source is available Version 2 0 2 34 2011 RED COM
99. eras It is important to note that with the exception of the NONE setting all filtering is happening on the receiver side When selected a keyboard will appear Presets Media Settings Power SERIAL PROTOCOL SCARLET X can communicate to the outside world either via the Serial Port RS 232 if RCP is selected as the SERIAL PROTOCOL or the Ethernet Port Gigabit Ethernet This menu allows the user to select the CTRL RS232 Serial Port PROTOCOL Available options are NONE ELEMENT TECHNICA SALITY SPC 7100 and 3ALITY SPC 7000 Default is NONE Presets Media Settings Power DEFAULT Version 2 0 2 473 L NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE NETWORK If the Ethernet connection is used additional settings are required Each Device requires a unique IP ADDRESS Technically with the camera to camera cable using UDP this is not required but good practice For simple camera to camera communication via UDP all devices need to be in the same sub net Need the same NETMASK and GATEWAY and the first 3 parts of the IP address need to be the same DHCP If a DHCP server is available in the network the DHCP option can be checked and the camera will obtain the IP address Netmask and gateway automatically from the DHCP server C2C If the camera to camera C2C check box is checked changes to the settings on this camera will be sent out via the network as UDP packets as a SET com
100. ery to charge for the appropriate time as shown in the table assuming battery is discharged completely Charging REDVOLT using RED TRAVELCHARGER CHARGE AMOUNT MINUTES 80 60 100 90 5 The battery is completely charged when the charger status LED turns solid Green Remove the battery from the charger and repeat operation as necessary for additional batteries Version 2 0 2 150 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE APPENDIX D INPUT OUTPUT CONNECTORS BRAIN FRONT Shown with PL Mount installed MYSTERIUM X A MIC 1 3 5mm Audio Jack B MIC 2 3 5mm Audio Jack Figure18 Brain Connectors Front Version 2 0 2 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE MIC 1 MIC 2 MICROPHONE AUDIO Two 3 5mm phone jacks on the front of the brain support two independent channels of balanced or unbalanced analog microphone level audio inputs pn s nat_ _bescrprion O onon Mic Input 48V Phantom Power B RING Mic Input 48V Phantom Power ceea and maoa Microphone Level analog audio input signals are routed via a high quality A D and pre amplifier whose Gain may be controlled using the Input Level control to achieve the desired audio reference recording level Each microphone input supports 48V 10mA Phantom Power as a user selectable option To assist with reference level setup the camera provides a color coded Peak Level Meter in t
101. es to be fully customized for any application Available options are Size Color and Transparency Full is enabled by default Presets Media Settings Power Version 2 0 2 90 2011 RED COM INC NOVEMBER 18 2011 SIZE Available options are Off Full 4 3 16 9 1 85 1 1 9 1 2 4 1 or User User Frame guides can be set to your own preferences through the User Settings Available options are Aspect Ratio Scale X Y and Offsets X Y Note that the selected size will be displayed in the bottom of the Frame Guide box Presets Media Settings Power Ha o E 10 00 BE 100 00 EE COLOR Sets the frame guideline color to White Gray Teal Purple Yellow Green Blue Red or Black Select the color that provides maximum color contrast with the scene you are shooting Default is White TRANSPARANCY Sets the frame guide transparency Available options are 0 25 50 75 and 100 AREA GUIDES Area Guides displays Title Guides and Action Guides Presets Media Settings Power Version 2 0 2 aaa Gi L NOVEMBER 18 2011 2011 RED COM INC OPERATION GUIDE Solid Line Style shown below Presets Media Settings Power A001_C006 1 3 53 2123 ASPECT RATIO For both Title Guide and Action Guide available options are OFF 16 9 14 9 4 3 2 4 1 1 85 1 and User Default is OFF User Title Guide and Action Guide can be set to y
102. esets Media Settings Meta Zebra Allows you to toggle ON OFF Zebras Refer to SETTINGS MENU gt DISPLAY gt ZEBRA for complete details about these options iso800 5600x View Presets Media Settings Meta Look Allows you to adjust the Color Gain FUT and Curve of the image during playback Refer to SETTTINGS MENU gt DISPLAY gt LOOK for complete details about these options isoB800 5600xk View Presets Media Settings Meta F Version 2 0 2 l 134 l 2011 RED COM INC NOVEMBER 18 2011 OPERATION GUIDE Record Exit When selected will exit playback to the main menu iso800 5600x View Presets Media Settings Meta gl META Displays current clip META information 1iso800 5600k View Presets Media Settings Meta A001_C006 SSD K IS pm aS CLIP PLAYBACK STATUS BAR Displays the progress of the clip during playback isoB800 5600x View Presets Media Settings Meta EESE Touchscreen When using the touchscreen you can swipe your finger Left or Right to open and allow playback of the previous or next clip on the media Version 2 0 2 CF n To Wxu n R lt v 5 _ 0UV nWIL i j L NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE Side Handle REDmote When using the Side Handle or REDmote you can use the navigation group to highlight the cl
103. ettings After settings are restored DEFAULT SETTINGS RESTORED INITIALIZING RESTART Camera will automatically power down and will require you to manually power it up NOTE User key settings will be reset as well as any other changes from the cameras default settings The REDmote will also require paring to communicate wirelessly with the camera REDISCOVER Rediscovers all hardware and caches the data for future boot cycles When selected you will be asked to confirm if you want to reset all hardware discovery settings After settings are reset RESET HARDWARE DISCOVERY SUCCESSFUL INITIALIZING RESTART Camera will automatically power down and will require you to manually power it up Version 2 0 2 129 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE PLAYBACK Playback allows you to view clips on media currently attached to the camera It also allows you to change the look of the playback clips be changing settings available when in playback mode 150800 5600x View Presets Media Settings Meta E gt N A001_C006 14 19 41 02 iad IL SITI UPPER CONTROLS From Left to Right are ISO WHITE BALANCE VIEW PRESETS MEDIA SEETINGS and META Below the settings is the clip playback status bar isoB00 5600x Vi Presets Media Settings Meta Exit Playback ICON Touchscreen Select the O on the Left to exit Playback mode NOTE The Menu ICON on the Right does
104. eveloped in post production The following reference scene includes highlight and shadow elements and was shot at ISO 800 UNDEREXPOSURE 2 STOPS 24 s0 00 t vM CLR GB coc 5600 ISO 800 Monitor Output In the image above it is obvious the camera is under exposed The initial clues are the monitor is very dark and the histogram is justified to the left Also note that red bar at the left edge of the histogram and the vertical color stack to the right of the histogram is only at grey These indicators are saying a significant amount of the senor s RAW data is in the noise and that the peak level of the sensor s RAW data is at a very low level in fact less than halfway Version 2 0 2 496 2011 RED COM INC NOVEMBER 18 2011 ET X OPERATION GUIDE p wa 0 U0 s gt vM CLR VE 48 sec 5600 Internal 4K R A A Drop Temp Media Power WAV SO 800 False Color Exposure Select False Color Exposure note they E icon in the GUI when active This mode allows us to visualize where in the image underexposure is taking place These areas are indicated in purple It is clear those areas are under the matchbox and coin and between the bottle and cigar holder 24 30 000 s gt vM CLR VV 48 sec 5600 Drop Temp Media Power SO 800 False Color Video Version 2 0 2 T 9 s rr ae NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE
105. g Camera RESCAN and going into IDLE mode Version 2 0 2 189 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE 17 REDmote upgrade is complete You can now reconnect to the camera NOTE Pairing of the REDmote may not be necessary after upgrading the REDmote firmware however after upgrading the camera firmware you must pair the REDmote again OPERATING MULTIPLE CAMERAS USING A SINGLE REDMOTE To operate multiple cameras using a single REDmote first the REDmote must be paired to multiple cameras Refer to OPERATION gt WIRELESS CONNECTION for pairing instructions After pairing REDmote to the desired cameras press Soft Menu Button 1 for CONNECT Available cameras will be listed to connect with wirelessly Aperture Focus Zoom Exposure Sensitivity Color Temp CAM A 00124B800014A037A CAM B 00124B000134B0D7 Select the camera you wish to control and press the ENTER button When you want to switch to a different camera press Soft Menu Button 1 again to list available cameras and re select The above image is shown for reference only The MAC address will only display if two or more cameras have the same name Version 2 0 2 190 2011 RED COM INC NOVEMBER 18 2011 OPERATION GUIDE APPENDIX F 3D SETUP OPERATION OVERVIEW The following information outlines basic procedures to connect two 2 RED SCARLET X cameras together in a Master Slave configuration for 3D opera
106. hase of an equivalent new product Disposing of this product correctly will help save valuable resources and prevent any potential negative effects on human health and the environment which could otherwise arise from inappropriate waste handling Please contact your local authority for further details of your nearest designated collection point Penalties may be applicable for incorrect disposal of this waste in accordance with you national legislation For business users in the European Union if you wish to discard electrical and electronic equipment please contact your dealer or supplier for further information Responsible party Red Digital Cinema 34 Parker Irvine CA 92618 USA Version 2 0 2 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE BEFORE YOU START Congratulations on your purchase of a RED SCARLET X camera Please read the attached safety instructions and only then unpack the camera body and any accessories If there is any physical damage or missing components for either your camera body or any accessories please file a Support ticket at www RED com support m g oO m gt Figure 1 RED SCARLET X Camera IMPORTANT SAFETY INSTRUCTIONS READ BEFORE USING YOUR CAMERA Heed all cautions and warnings in these instructions Read these instructions before operating the camera and accessories Follow these instructions while operating the camera and accessories Keep these instructions wi
107. he Graphical User Interface with a solid vertical witness mark that indicates 0dBu 0 775 v RMS 20dbFS Peak Level Meter range is 36dBu to 20dBu 54dBFS to OdBFS and provides input clip indication Version 2 0 2 152 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE BRAIN REAR Headphone SYNC Video Sync CTRL RS232 Control GIG E Ethernet DC IN Power Input G om Figure 20 Brain Connectors Rear Version 2 0 2 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE HD SDI A standard size BNC connector provides a high definition video output PN SIGNAL DESCRIPTION DIRECTION HD SDI SMPTE 292M HD SDI Out HD SDI Output The HD SDI output provides a 720p or 1080p 10 bit 4 2 2 progressive scan video feed at 23 98 24 00 25 00 or 29 97 Hz when in 1 5GHz HD SDI mode and 50 00 or 59 94 Hz when in 3GHz HD SDI mode The HD SDI output may be specified as a PROGRAM output clean feed video or as a PREVIEW output with SurroundView look around Clip Name Timecode and Safe Action Safe Title frame guides In addition to video data the HD SDI output also provides two 2 channels of embedded audio Time of Day timecode record tally flag and Clip Name information as SMPTE RP 188 VITC2 HANC metadata NOTE Default setting is PROGRAM NOTE HD SDI video output is Progressive Scan it does not support 1080i or 1080PsF modes Version 2 0 2 154 2011
108. he GPO tally presents 3 3V 0 04 Amps maximum between pins 1 and 3 When used as Sync Out the signal is rising edge pulse at start of exposure As a Tally it is rising edge at start of record falling edge at end of record NOTE A pre fabricated CTRL interface cable is available from RED Digital Cinema e P N 790 0152 RS232 Camera to DB 9 3 ft 1m e DB 9Pin1 Shutter Sync GPO e DB 9Pin2 RS232 Tx e DB 9Pin3 RS232 Rx e DB 9Pin4 Ground Version 2 0 2 158 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE GIG E ETHERNET A 9 pin LEMO connector supports a Gigabit Ethernet port for remote camera setup master slave camera to camera control and external metadata ingest Figure 24 View into Ethernet Interface connector Mating connector FGG 0B 309 CLAD32Z CPN SIGNAL DESCRIPTION DIRECTION a f p Dare 2 moo papac O Ce p papapa a p papap Ps ero daarara Te pa Daanan 7 D detarares e p papap o donot connect _ NOTE Two pre fabricated Ethernet interface cables are available from RED Digital Cinema e P N 790 0163 Ethernet Camera to Camera 3 ft 1m e P N 790 0159 Ethernet Camera to RJ45 3 ft 1m Version 2 0 2 159 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE DC IN POWER INPUT The 6 pin
109. he camera draws approximately 60 watts when recording in 4K resolution 24fos MOVIE mode The camera is cooled by convection from the camera body assisted by a fan contained in a sealed air duct Under typical operating conditions a REDVOLT XL 90Wh battery will run the camera and accessories for about 90 minutes A REDVOLT 30Wh battery will run the camera and accessories for about 30 minutes Version 2 0 2 18 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE CAMERA OPERATIONAL CONTROLS This section describes the available operational controls on the SCARLET X camera Brain Side SSD Module Side Handle and REDmote accessories BRAIN Figure 4 Power Record Button Status LEDs e Power Record Button Powers camera Up Down and initiates Record Stop Start e Power Status LED Indicates Status of Power O O O O O LED Red Power Present LED Yellow Low Level Code Booting LED Green Running on AC LED Green Blinking Running on Battery LED Yellow Blinking Running on Battery below 10 Version 2 0 2 19 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE O LED Red Blinking Running on Battery Below 5 Record Status LED Indicates status of camera for recording O O O O O O LED Off No Media LED Green Ready to Record LED Red Constant Recording LED Red Slow Blink Recording 25 Media Left LED Red Fast Blink Recordi
110. hought to be accurate the information in this document is provided strictly as is and RED will not be held responsible for issues arising from typographical errors or user s interpretation of the language used herein that is different from that intended by RED All safety and general information is subject to change as a result of changes in local federal or other applicable laws RED reserves the right to revise this Operation Guide and make changes from time to time in the content hereof without obligation to notify any person of such revisions or changes In no event shall RED its employees or authorized agents be liable to you for any damages or losses direct or indirect arising from the use of any technical or operational information contained in this document For comments or questions specifically about the Operations Guide content please send a detailed message to OpsGuides red com COPYRIGHT NOTICE 2011 Red com Inc All trademarks trade names logos icons images written material code and product names used in association with the accompanying product are the copyrights trademarks or other intellectual property owned and controlled exclusively by Red com Inc TRADEMARK DISCLAIMER All other company brand and product names are trademarks or registered trademarks of their respective holders RED has no affiliation to is not associated or sponsored with and has no express rights in third party trademarks MAC
111. hscreen LCD camera menu navigation may be made through finger gestures PA 180800 28 ABs 5600k 4KHD RCB e To adjust a parameter value simply touch it and then swipe the finger left right to adjust its value e To access an advanced parameter settings display press and hold down on the parameter icon e Touch anywhere outside the overlay windows to enter the value changes and to hide the sub menus e To enter the Secondary Menus touch the MENU icon Focus Presets Media Settings Power e To return to the Main Menus touch the MENU icon again e To access the Playback function touch the arrow b 24ers 150800 28 48sec 5600k 4KHD ACB Version 2 0 2 42 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE e To exit the Playback function touch the circle C s0800 55DDK View Presets Media Settings Meta SHORTCUTS Along the lower status row menu items can be accessed by simply touching that section of the screen NOTE The upper menu options do not change when you select the below items You are taken directly inside of that menu item e Touching Clip Settings at the lower Left corner of the LCD will display the System Status screen Refer to SECONDARY MENUS gt SETTINGS gt MAINTENANCE gt SYSTEM STATUS for complete information e Touching the RGB Histogram will bring up the False Color overlay menu Refer to SECONDARY MENUS gt SETTINGS gt
112. i ry w ia SHO PE L A LTL LOE L G i 3 K c agmacbeth Internal Drop Temp Media Power RC36 SO 800 False Color Exposure Select False Color Exposure note they E icon in the GUI when ac tive This mode allows us to visualize where in the image over exposure is taking place These areas are indicated in red It is clear those areas are on the highlight on coin and at the top right edge of the color chip test chart Version 2 0 2 199 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE 24 000 vM CLR NAV 48 sec 5600 EL BE rA I 4 E E Internal Drop Temp Media Power RC36 SO 800 False Color Video Select False Color Video note the y V icon in the GUI when active This mode allows us to check the RGB video levels of the scene As all the white chips on the test chart are Yellow this suggests that a significant portion of the monitor path video is at the maximum legal 100 IRE value Because the scene is over exposed when the recorded R3D file is color corrected in post production the scene s highlight information will almost certainly be clipped however the shadow information will probably display cleanly once pulled back down to an acceptable brightness Version 2 0 2 200 l 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE APPROPRIATE EXPOSURE 24 FPS 0 000 s gt vM CLR 48 sec 5600 ISO 800 Monitor
113. ill then be asked if you want to apply the imported preset If No is selected the preset will be imported and listed in the available Camera Presets If Yes is selected Preset Applied Successfully will appear when successfully completed The preset will be listed in the available Camera Presets s If the preset could not be applied Preset Could Not Be Applied will appear to inform you Try to set again RMD PRESETS If an RMD file exported from REDCINE X or REDCINE X PRO is on the SSD it can be imported from the SSD to the camera When APPLY is selected the RMD file is transferred to active system memory DELETE PRESET When selected will delete the selected preset from the camera It will not delete the selected preset from the external media 1 8 SSD Presets Media Settings Power IMPORTANT You will not be warned of the deletion nor asked to confirm this deletion Be sure to save your preset to the external media 1 8 SSD for later use before deleting the preset from the camera Once you have deleted the preset you will either need to create a new one or import and existing one from external media You will be asked to confirm if you want to delete the preset REDmote will also display this message allowing you to respond Version 2 0 2 19 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE When successfully completed Preset Deleted
114. ing allows you to set a fixed fan speed to be used during Record and Standby modes Record Speed Sets a fixed fan speed to be used during Record Range 25 100 Default is 50 Standby Speed Sets a fixed fan speed to be used during Standby Range 25 100 Default is 75 Version 2 0 2 120 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE INDICATORS Beep Speaker Available options are OFF and RECORD STOP When RECORD STOP is selected an audible beep will be heard when record is started and another when record is stopped Presets Media Settings Power Record Stop EVF Tally Light When checked enables the Record Tally Red LED on the front of the EVF MAINTENANCE The maintenance menu allows the user to check system status and information save the camera diagnostic LOG to attached media perform a software update calibrate the sensor perform a camera self test and reset system settings to factory defaults Media Settings Power System Status System Info SW Update Version 2 0 2 121 NOVEMBER 18 2011 2011 RED COM INC SYSTEM STATUS When selected the Viewfinder output s will display the System Status screen This screen provides a summary of all operational settings currently applied to the camera Presets Media Settings Power A001_C006 SYSTEM INFO When selected the Viewfinder output s will display the camera Model curr
115. ion at www RED com support and if appropriate upgrade the camera firmware Refer to APPENDIX A UPGRADING CAMERA FIRMWARE Version 2 0 2 46 l 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE Insert a blank or previously used but erasable REDMAG 1 8 SSD and format it Perform a BLACK SHADING CALIBRATION of the Sensor Check your PROJECT SETTINGS Time Base Record Resolution Record Quality etc Frame focus and record CONNECT AND FORMAT MEDIA Identify a REDMAG 1 8 64GB 128GB or 256GB SSD that has not previously been recorded to or is not a Camera master and may therefore be erased and re used Aligned the RED logo of the SSD to the outside and then push the SSD firmly but without excessive force into the slot in the Side SSD Module NOTE When fully inserted the SSD media protrudes slightly from the SSD slot as indicated above When SSD media is inserted into the camera the camera will recognize if the media is unformatted On LCD EVF and external monitors in the media section of the GUI NONE will be displayed twice as opposed to when no media is inserted the GUI displays NONE with three dashes below On REDmote NONE will be displayed twice as opposed to when no media is inserted the GUI displays NONE with three dashes below On the Side Handle NA will be displayed same as if no media is present To format the media select SECONDARY MENUS gt MEDIA g
116. ip playback status bar Presets Media Settings Meta A Scroll Wheel BI Directional Pad Enter Button e Scroll Wheel Rotating Clockwise or Counter Clockwise will move through the clip on frame at a time forwards or backwards e Directional Pad Pressing Left or Right to open and allow playback of the previous or next clip on the media e ENTER Button Pressing the ENTER button controls Play Pause of playback LOWER CONTROLS From Left to Right PLAYBACK SPEED IN POINT MARKER FRAME BY FRAME REVERSE PLAY PAUSE FRAME BY FRAME FORWARD OUT POINT MARKER PLAY ONCE LOOP and PLAYBACK DIRECTION A001_C006 RESOLUTION PROJECT FRAMERATE QUALITY Display clip Resolution Framerate and Quality REDcode When using the touchscreen touch the Resolution Framerate and Quality REDcode to display the METADATA for the clip Version 2 0 2 136 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE 4001 _CO06 14 19 58 03 HISTOGRAM Displays the clip histogram The histogram will change based on any changes made in the Upper Controls When using the touchscreen touch the histogram to display the TOOLS menu 14 19 58 03 PLAYBACK SPEED Allows you to select x1 x2 x4 x8 or x16 playback speed A001_C006 14 19 41 02 bom dd gt De nS IN OUT POINT MARKER Allows you to set In and Out Points during clip playback This allows you to playbac
117. is 0 000 When selected a secondary keypad will appear allowing you to enter the desired Tint value directly NOTE Selecting Calc White Balance calculates a new Tint value This is maintained if the Color Temp is adjusted via the Color Temp parameter If you select ANY presets Tint will be reset to zero which is the default value CArps 150800 ve d8sc 5600k 4K HD 5600 Jae 0 000 A001_C006 Version 2 0 2 63 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE CALC WHITE BALANCE The Calc White Balance function analyzes the central 25 of the image visible in the monitor to calculate a Color Temperature that will render a white object as white CAFps isoBUU0 eB YABSEC N6U0k OK c 1 HC 8 1 Daylight 5600k To use Calc White Balance function place a White or Gray object under the ambient light select the Calc White Balance function and then press the Calc White Balance function box Calc White Balance is also assigned to a User Key on the REDmote and Side Handle as a factory default setting RESOLUTION Allows adjustment of resolution CA rps 150800 2B ABsec 5600k 4K HD 4K HO Default is 4K HD The following Resolution options are available e 5K e 4K e 4KHD e 3K e 2K Current RED SCARLET X resolutions listed below with their respective size in pixels RESOLUTION X WIDTH Y HEIGHT Version 2 0 2 64 2011 RED COM INC NOVEMBER 18 2011 RED SC
118. k of electric shock and damage to the camera or accessories DO NOT attempt to perform any servicing other than any procedures that are recommended in the operating instructions Version 2 0 2 10 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE THEORY OF OPERATION The RED SCARLET X digital cinema camera provides high performance digital imaging over a wide range of frame rates and optical formats including Super 35mm 35mm and Super 16mm The camera is available with a Ti PL mount and may be configured with mounts and 19 mm rods to accommodate most cinematography lenses matte boxes and follow focus systems Adaptors for 15mm offset studio and 15mm lightweight rods are also available In addition to compatibility with existing PL mount cinematography lenses a select range of S85mm APS H PL mount prime and zoom lenses are available from RED Other lens mounts including Canon EOS are available permitting the use of Canon photographic lenses Lens mounts can report lens iris focus and zoom data when mated to an appropriate lens In addition the iris and focus settings for select Canon lenses may be driven from the camera Lenses with small image circles may have restricted sensor coverage at wide angle Lens mounts may be exchanged in the field however it is highly recommended that this be performed in a dust free environment as the optical path will be exposed to the elements during this process A B4 mount
119. k only a certain portion of the clip as desired Helps when the clip is rather long and you want to focus on a particular segment The In Red and Out Green points will be displayed in the Clip Playback Status Bar You can use the navigation group to select the exact location of the In and Out Points if desired iso800 jew Prese Media Settings Meta A001_C006 14 19 58 03 CEE Version 2 0 2 n i NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE FRAME BY FRAME REVERSE FORWARD Allows you to move through the clip frame by frame in the reverse direction A001_C006 14 19 58 03 d a Fo Ent A oo k q a k O PLAY PAUSE Allows you to play and pause the clip A001_C006 14 19 58 03 PLAY ONCE LOOP Allows you to choose to play the clip one time or to loop the clip in the player Loop is shown below PLAYBACK DIRECTION Allows you to play the clip forward or backwards Reverse playback is shown A001_C 006 aif 14 19 58 0 3 ADDITIONAL CLIP CAMERA INFORMATION Will indicate if clip was recorded in HDRx and current camera power status as well as audio input signals A001_C006 14 19 58 03 _ lt e 4 h Pe 1 Version 2 0 2 43g 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE POWER The power menu displays the current power status of all attached power sources as well as allows you to shutdo
120. ked will open more options allowing you to adjust the X and Y values for Black Toe Center Knee and White of the curve Presets Media Settings Power REUDGammae v _ 0250 0 250 I osoo L oso I orso E oz I o 1 000 EE PROJECT The project menu sets the operating parameters the camera will use for a given project Options available are TIME BASE and TIME CODE Presets Media Settings Power Time Code Version 2 0 2 97 NOVEMBER 18 2011 2011 RED COM INC RED ET X OPERATION GUIDE TIME BASE Sets the TIME BASE fps to be used for the project the primary acquisition frame rate time code count and playback amp editing frame rate Setting is displayed in the lower left corner of VIEWFINDER output s Available options are 23 98 24 00 25 00 29 97 47 96 48 00 50 00 and 59 94 Default is 23 98 Presets Media Settings Power TIME CODE Selects the TIME CODE source to be used Options are EXTERNAL TC and INTERNAL USER PROVIDED TC Power Ss fie gt ie E TIME CODE DISPLAY Allows you to choose between TOD and Edge display Version 2 0 2 oog 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE TIME CODE SOURCE Available options are EXTERNAL and USER PROVIDED Presets Media Settings P ao Ha ET le User Provided The three numerical boxes below allow you to set hours minutes an
121. l 2 Bottom Handle Tele Level 3 Bottom Handle Tele Level 4 Bottom Handle Rotary CW Bottom Handle Rotary CCW Side CF SSD Side CF Function 3 Button Down press 1 and 2 together Side CF Record Full Button Down REDmote REDmote User Key A Down REDmote User Key B Down REDmote User Key C Down REDmote User Key D Down REDmote Function 1 Key Down REDmote Function 2 Key Down REDmote Function 3 Key Down REDmote Record Half Button Down REDmote Record Full Button Down REDmote Tele Level 1 REDmote Tele Level 2 REDmote Tele Level 3 REDmote Tele Level 4 REDmote Tele Level 1 REDmote Tele Level 2 REDmote Tele Level 3 REDmote Tele Level 4 Version 2 0 2 NOVEMBER 18 2011 Zoom Out Speed 2 Zoom Out Speed 3 Zoom Out Speed 4 Zoom Stop Toggle SH Backlight Menu Toggle Menu Up Menu Down Menu Right Menu Left Menu Select Rotary Next Value Rotary Next Value Rotary Previous Value Rotary Previous Value HALF Press Request Toggle Record Zoom In Speed 1 Zoom In Speed 2 Zoom In Speed 3 Zoom In Speed 4 Zoom Out Speed 1 Zoom Out Speed 2 Zoom Out Speed 3 Zoom Out Speed 4 Rotary Previous Value Rotary Next Value Eject Media Toggle Record Toggle AF Mode RAW Check Toggle Magnify Exposure Check Open ISO List Open Shutter Speed List Open Color Temp List HALF Press Request Toggle Record Zoom In Speed 1 Zoom In Speed 2 Zoom In Speed 3 Zoom In Speed 4 Zoom Out Speed 1 Zoom Out Speed 2 Zoom Out Speed
122. l clips J j m A 17 32 32 06 AY 0000000 CF w REDCINE X PRO is available for download at Included with the download is the REDCINE X PRO Operation Guide to assist with understanding the tools available in REDCINE X PRO Version 2 0 2 nmn Od NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE APPENDIX I MAINTENANCE WARNING DO NOT attempt to modify dismantle or open your camera lens or other accessory as doing so may expose you to electric shock and serious injury There are no user serviceable parts inside Alteration or repairs made to the camera lens or other accessory except by a RED authorized service facility will void the Limited Warranty CLEANING WARNING DO NOT rinse or immerse any element of the camera lens or other accessory keep them dry at all times WARNING DO NOT use soaps detergents ammonia acetone alkaline cleaners abrasive cleaning compounds or solvents These substances may damage lens coatings and electronic circuitry CAMERA AND ACCESSORY EXTERIOR SURFACES Clean ONLY using a dry cloth When cleaning your camera and accessories remember that it is not waterproof and moisture can damage electronic circuitry BRAIN SENSOR Use Delkin Devices Digital Duster Kit P N DDSS DUSTER2 or equivalent to clean sensor surface OPTICAL LOW PASS FILTER OLPF If equipped with an OLPF use Delkin Devices Digital Duster Kit P N DDSS DUSTER2 or equivalent to clea
123. lave camera until you set the Master camera at the new Frame Rate Version 2 0 2 194 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE Also when making changes to the Secondary menu settings the Slave camera will not display those changes unless it effects items displayed on the main screen example when HDRx is enabled on the Master camera HDR will change to HDRx on the Slave camera RECORDING When the power record button is pressed on the Master camera to start stop recording the Slave camera will also start stop recording POWER DOWN When the Master camera is powered down using the Secondary Menu gt Power the Slave camera will also power down Version 2 0 2 195 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE APPENDIX G EXPOSURE USING FALSE COLOR AND ISO NOTE The following section uses a RED ONE camera display to illustrate exposure tools however the same principles apply to SCARLET X camera systems RED SCARLET X provides several advanced exposure indication tools In the following examples we will show how these tools respond to a reference scene that is under exposed over exposed and then correctly exposed Each scene will have its unique characteristics so the correct exposure is a matter of judgment balancing the desire to avoid clipping any highlights and also avoiding underexpose of elements in deep shadow which may therefore be prone to noise when d
124. lder Today 1 15 PM 4 29 GB RED RAW R3D Today 1 16 PM 2 08 GB RED RAW R3D Today 1 16 PM Folder Today 1 14 PM 33 KB MacBi archive Today 1 16 PM 33 KB MacBi archive Y SEARCH FOR 11 items 118 1 GB available METADATA RED SCARLET X cameras record extensive Metadata which is data that describes the precise characteristics of the picture and sound signals in each frame of the recording This includes camera specific setup information project and clip management information Clip Name Time Code Date and GMT lens and shutter speed angle parameters audio settings and any video image processing information CLIP NAMING CONVENTIONS When you press RECORD the camera automatically creates a unique name for the CLIP being recorded to the REDMAG 1 8 SSD media The format of the clip name is Camera Letter Reel Number Month Day where is a random two digit alphanumeric number used to prevent accidental duplication of file names e g A001_C002_0502A6 RDC Where A camera A 001 reel 001 C002 clip 002 and 0502 May 02 and the digits A 6 are the random characters generated by the camera as described above Other examples are shown below A001_C001_0502X3 RDC A001_C001_0502G6 RDC A001_C001_0502AB RDC Version 2 0 2 17 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE MULTI CAMERA SHOOTS The naming scheme means that three cameras slated as A B C will generate easily r
125. ll be reduced Version 2 0 2 182 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE greatly as there will be a slight power draw on the REDmote when shut down using this procedure ACCESSING CAMERA CONTROLS SETTINGS The Navigation Group is used to navigate through the camera s menus Refer to CAMERA OPERATIONAL CONTROLS gt REDMOTE gt NAVIGATION GROUP The camera settings and status are displayed on the REDmote Color LED display Refer to BASIC OPERATION gt GRAPHICAL USER INTERFACE AND NAVIGATION gt REDMOTE The operations will be the same whether connected physically to the camera or wirelessly CHANGING CAMERA SETTINGS USING CAMERA LCD EXTERNAL MONITOR AS REFERENCE To adjust a parameter value displayed on the camera s Upper Status Group first note the red colored bar located under 24fps in this example indicating the currently active parameter for instant adjustment CAFps iso800 28 YABSEC 5600k AK HD Use the NAVIGATION GROUP directional pad to move the cursor to a different parameter if desired then press the ENTER key to select that parameter and use the Scroll Wheel to adjust that parameter s value To confirm the change in parameter value and to exit the adjustment menu press the ENTER button To access the camera s menus press the MENU button at the lower left The MENU displays on the EVF LCD or external monitors if the LCD and or EVF are not connected disconnected
126. mand Which then sets the property on other cameras SET commands send to this camera will not be propagated EXT If the EXT check box is checked this camera can be controlled via TCP IP from an external device IP Address Permits the user to adjust the camera s static IP address Netmask Permits the user to adjust the Subnet Mask address Gateway Permits the user to adjust the Gateway address Version 2 0 2 2011 RED COM INC NOVEMBER 18 2011 OPERATION GUIDE REDMOTE This function is used to pair the camera to a REDmote for wireless operation For paring procedures go to APPENDIX E REDMOTE OPERATION gt OPERATION gt WIRELESS CONNECTION Presets Media Settings Power Attached REDmote Y SCAN FOR REDMOTES When selected the camera will look for REDmotes that are turned on with wireless enabled Searching will display Presets Media Settings Power Version 2 0 2 T nsN TOT 75 LL NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE After scanning the recognized REDmote MAC address will be listed in the drop down menu Presets Media Settings Power 00124B000149FEA1 W Unpair REDmote PAIR REDMOTE Select the REDmote from the drop down and select PAIR REDMOTE to pair the REDmote to the camera Presets Media Settings Power Scan for REDmotes 00124B000149FEA1 Pair REDmote Unpair REDmote Prese
127. n HDR 1 1 OFF LAN RIG SYNC GEN TC Aperture Focus m Zoom Sensitivity Exposure Color Temp S6n0Y Format Redcode Sensor FPS AK HO DEFAULT cH ve ONNECT REMOTE SETUP wam 5 The camera LCD or external monitors will confirm the REDmote is connected by displaying RM in Green with a signal symbol next to it RECONNECT WHEN SIGNAL IS LOST The REDmote keeps track of which camera it was last paired with for quick re connect on next startup undocking or loss of wireless signal When the camera is turned off or the REDmote is turned on while the camera is off REDmote will display Searching and the Green LED will flash as the REDmote attempts to connect with the camera after losing the cameras wireless signal until the REDmote is turned off or the camera is turned back on and REDmote automatically connects Sensitivity Color Temp sa LI I i HU E g ee Version 2 0 2 179 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE If no camera is found REDmote will go into IDLE mode and display Camera RESCAN Sensitivity Color Temp ONNE REMOT E T When the camera is turned back on the REDmote will not automatically pair if the REDmote is left powered up or is powered up before the camera 1 To reconnect REDmote to the camera assuming the camera and REDmote have been paired before a If the Camera RESCAN is NOT displayed press
128. n 2 0 2 175 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE 3 On REDmote press Soft Menu Button 3 under SETUP ONNECT REMOTE SETUP r Ye 4 Ensure Wireless is On REDmote will display the option Turn Wireless Off If Turn Wireless On is displayed select it and press the Enter button In addition if Wireless is Off REDLINK OFF will be displayed Sensitivity Exposure Color Temp NOTE If wireless needed to be turned on you will need to press Soft Menu Button 3 again to get back into Setup options 5 Select Setup System to display the Setup System screen Note the 16 digit number near the bottom of the screen i ES omin IEE 6 On the camera go to SECONDARY MENUS gt SETTINGS gt SETUP gt REDMOTE IMPORTANT Ensure REDmote displays IDLE on the screen in the lower Left before continuing to the next step Version 2 0 2 176 2011 RED COM INC NOVEMBER 18 2011 on 7 Under SCAN FOR REDMOTES there is a drop down menu Locate the device with the same 16 digit number as displayed on the REDmote Setup System screen Presets Media Settings Power 00124B000149FEA1 I Unpair REDmote Presets Media Settings Power 9 Select PAIR REDMOTE on the camera CONNECT REDMOTE TO A PAIRED CAMERA The REDmote is not aware of which cameras are paired with it when you search for cameras to connect to it will
129. n OLPF surface LCD SCREEN Use Pancro Professional Lens Cleaner P N PANCROCLN and Photographic Solutions Pac Pads P N 05011 or equivalent to clean the screen on Touchscreen and Non Touchscreen LCDs EVF Use Pancro Professional Lens Cleaner P N PANCROCLN and Photographic Solutions Pac Pads P N 05011 or equivalent to clean the viewfinder lens Ensure your spray the solution onto the pad and not directly onto the lens surface Version 2 0 2 208 l 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE REDMOTE SCREEN Use Pancro Professional Lens Cleaner P N PANCROCLN and Photographic Solutions Pac Pads P N 05011 or equivalent to clean the screen on Touchscreen and Non Touchscreen LCDs LENSES Use Pancro Professional Lens Cleaner P N PANCROCLN and Photographic Solutions Pac Pads P N 05011 or equivalent to clean the viewfinder lens Ensure your spray the solution onto the pad and not directly onto the lens surface SIDE HANDLE LCD Use Pancro Professional Lens Cleaner P N PANCROCLN and Photographic Solutions Pac Pads P N 05011 or equivalent to clean the screen on the Side Handle LCD BACK FOCUS ADJUSTMENT WARNING THERE IS A SCREW IN METAL PLUG INSTALLED IN THE CAMERA BODY COVERING THE BACK FOCUS SCREW THIS PLUG MUST BE REMOVED BEFORE TO PERFORMING A BACK FOCUS ADJUSTMENT TO REMOVE THE PLUG USE A T 10 TORX DRIVER NOTE To be able to perform this procedure as written you must have a PL moun
130. n these extreme examples it is clear that the RGB domain images are respectively very bright and very dark The histogram data reflects that however you can also see that the sensor RAW meters are unchanged The exposure at the sensor at this point in time is the same If you choose to close the iris to reduce the brightness of the first image you will be reducing exposure at the sensor this biases exposure in favor of protecting the scene highlight Alternatively if you choose to open the iris to increase the brightness of the image of the second image you will be increasing exposure at the sensor this biases exposure in favor of minimizing noise in the scene shadows The technique is similar in principle to re rating a film stock With practice the ISO rating can be used as a tool to assist ideal exposure based on the dynamic range identified within the scene Version 2 0 2 995 L NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE APPENDIX H POST PRODUCTION RED workflow is quite easy to understand especially if you have experience with photographic RAW image processing or shoot 16mm or 35mm film followed by a Telecine transfer to a non linear video editor and on line conform RAW data has a wide dynamic range and color space so you can freely change the white balance of the footage adjust exposure and alter highlight and shadow tonality in post production The RED SCARLET X camera records RAW sensor data usi
131. ne charger NOTE The REDmote can be charged using the Mini USB connector while connected and controlling a camera wirelessly NOTE If the computer cable hub do not provide enough voltage the REDmote will not charge and show an Error Charging message 1 Connect the USB connector to any computer computer must be ON to charge REDmote 2 Connect the Mini USB end to the REDmote USB Port located on the lower right side under rubber protective cover 3 If the REDmote is powered down and paired camera is OFF the REDmote will power UP display STARTING UP display SEARCHING with flashing Green LED then settle into IDLE mode Green battery indicator will blink indicating REDmote is charging 5 A fully discharged REDmote battery will be fully charged in approximately 7 hours Version 2 0 2 173 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE CONNECTING REMOVING This section describes how to physically connect remove the REDmote to from an SCARLET X or SCARLET X Brain or to from the back on an expansion module On the lower left and right sides of the REDmote are V lock release buttons B M that must be depressed to release the REDmote from the camera or module PHYSICAL CONNECTING DOCKING 1 Place the female V Mount of the REDmote over the male V Mount of the camera module ee ee e 2 Press down until a click is heard which indicated the REDmote
132. ng 5 Media Left LED Yellow Finalizing Both LEDs Indicates status of camera for recording O Both LEDs Green Blink FW Update in Progress SIDE SSD MODULE 20 REAR FRONT lt o lt O e Oo lu Oo lt A ES SSD Slot B User Key 1 User Key 2 EJ Focus Record Button E Media Indicator Figure 5 Side CF SSD Controls Version 2 0 2 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE e SSD Slot Slot for REDMAG 1 8 SSD Media e User Key 1 Initiates user defined camera function Undefined by Default e User Key 2 Initiates user defined camera function Undefined by Default e User Key 1 User Key 2 Press both keys to Eject unmount REDMAG 1 8 SSD Media e Focus Record Button Touch for Auto Focus fully depress to Start or Stop Record e Media Indicator LED Indicates status of media O O LED Off No Media LED Green Ready to Record LED Red Constant Recording LED Red Slow Blink Recording 25 Media Left LED Red Fast Blink Recording 5 Media Left LED Yellow Finalizing LED Yellow Blinking Media Access Format etc Version 2 0 2 21 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE SIDE HANDLE TOP ee Focus Record Button REH LCD Display Adjustment Ring F LCD Backlight Button Figure 6 RED Side Handle Controls Top e Battery Door Release Button Releases Side Handle battery d
133. ng wavelet based REDCODE RAW compression to REDMAG 1 8 SSD The compressed RAW data is then transferred from the digital media to a Macintosh OSX or Windows XP workstation running REDCINE X PRO post production software These applications do not directly edit or conform the RAW data themselves but prepare the RAW data for editing and conforming by RGB domain post production software applications In film processing terms REDCINE X PRO act as an integrated film laboratory telecine and one light color corrector They convert recorded REDCODE RAW data to RGB video and provide basic one light image processing and color correction Using REDCINE X PRO footage can also be cropped resized or repositioned These functions lessen the amount of time required for color correction or re framing of shots after the final cut has been completed REDCINE X PRO can also encode 4K or 2K RAW footage into a variety of uncompressed RGB and compressed 4 2 2 video formats Provided the appropriate QuickTime codec s are available on the host computer workstation compressed video choices include ProRes DNxHD DV100 and M JPEG QuickTime movies at 1080p or 720p resolution For film out multi media or special effects applications REDCINE X PRO may export a sequence of 2K or 4K image files in TIFF Open EXR DPX JPEG or Photoshop PSD file formats Creating 4 2 2 at 1080p or 720p resolution QuickTime movies provides compatibility with the majority of non linear edi
134. ngs Power A001_C006 MODE Allows you to choose the output for the LCD EVF HDMI and HD SDI monitors LCD EVF Options are MENUS PREVIEW CLEAN OVERLAY 3D LEFT and 3D RIGHT If anything other than MENUS is selected on the LCD such as CLEAN to return to displaying the MENUS perform a double tap on the LCD screen HDMI Options are OFF MENUS PREVIEW CLEAN OVERLAY 3D LEFT and 3D RIGHT RES Allows you to choose the output resolution for HDMI monitors Available options are AUTO 720p and 1080p Version 2 0 2 io4 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE NOTE Some HDMI monitors may have trouble when AUTO is selected In these cases it is recommended to manually select the maximum monitor resolution provided HD SDI Options are OFF MENUS PREVIEW CLEAN OVERLAY 3D LEFT and 3D RIGHT RES Allows you to choose the output resolution for HD SDI monitors Available options are AUTO 720p and 1080p FREQ Allows you to choose the output frequency in Hertz Hz for HD SDI monitors Available options are AUTO 23 976 24 25 29 976 47 952 48 50 and 59 94 AUTOMATICALLY ASSIGN MENU SCREEN IF ENABLED When checked will assign an attached external monitor to display the menus if none are selected Version 2 0 2 105 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE TEST SIGNALS Permits the video monitor outputs to be replaced with a video te
135. nu Buttons1 3 H whose functions are defined on the LCD screen For complete information refer to OPERATION gt REDMOTE MENUS gt SOFT MENU BUTTONS 1 3 Version 2 0 2 165 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE NAVIGATION GROUP The Navigation Group I allows navigation through allowing navigation of camera menus and adjustment of selected parameters Figure 29 Side Handle Navigation Group A Scroll Wheel BI Directional Pad Enter Button The Navigation Group has three 3 separate operational capabilities SCROLL WHEEL The Scroll Wheel A allows the operator to select and adjust the values of selected camera parameters DIRECTIONAL PAD The Directional Pad B allows Left Right Up Down navigation thru camera menus to select a desired parameter for adjustment ENTER BUTTON The Enter button C located at the center allows confirmation of a parameter adjustment This may also be referred to as the Center Key FOCUS AND RECORD BUTTON Below the Navigation Group is the focus and record button J This is a dual throw action switch A half press initiates Auto Focus a full press initiates still capture or starts stops a movie recording When recording the upper LED will illuminate Red and a Red dot will appear to the immediate left of the Timecode on the REDmote LCD display Version 2 0 2 166 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE SOFT
136. o Sync 156 CTRL RS232 Control 158 GIG E Ethernet 159 DC IN Power Input 160 HDMI Out 161 Side SSD Module 162 REDmote 163 APPENDIX E REDMOTE OPERATION 164 Control Connectors and DIB Gy u uuu utu siauusaa 164 COnirols uu uu uu uu 164 OD Cl ALION sctassinsddaviekacoganchacbeateues 167 REDmote Menus 167 Charging Battery Life 172 Connecting Removing 174 Wireless Connection 175 Power Up DOWN 181 Accessing Camera Controls Settings 183 Recording 185 Maintenance 185 Upgrading REDmote Firmware 185 Operating Multiple Cameras Using a Single REDmote 190 APPENDIX F 3D SETUP OPERATION 191 Overview 191 Camera Setup 191 Master Camera 191 Slave Camera 192 Clip Naming Conventions 192 Reel No Slate Camera ID Camera Position 192 Connecting Cameras 194 Operation 194 Changing Settings 194 Recording 195 Power Down 195 APPENDIX G EXPOSURE USING FALSE COLOR
137. of the Class 2 identifier symbol exclamation mark in a circle accompanying the CE Mark on the products regulatory label example below FRANCE USAGE RESTRICTIONS GEOGRAPHIC AREA WHERE RESTRICTION APPLIES FRANCE For mainland France 2 400 2 4835 GHz Channels 1 16 authorized for indoor use 2 400 2 454 GHz Channels 1 10 authorized for outdoor use RESTRICTIONS D UTILISATION ZONE GEOGRAPHIQUE OU LES RESTRICTIONS S APPLIQUENT FRANCE Pour la France metropolitaine 2 400 2 4835 GHz Canaux 1 a 16 autorise en usage interieur 2 400 2 454 GHz canaux 1 a 10 autoris en usage ext rieur NORWAY This subsection does not apply for the geographical area within a radius of 20 km from the centre of Ny Alesund Dette gjelder ikke for det geografiske omradet innenfor en radius av 20 km fra sentrum av Ny Alesund Version 2 0 2 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE The Waste Electrical and Electronic Equipment WEEE mark applies only to countries within the European Union EU and Norway This symbol on the product and accompanying documents means that used electrical and electronic products should not be mixed with general household waste For proper treatment recovery and recycling please take this product to designated collection points where it will be accepted free of charge Alternatively in some countries you may be able to return your products to your WS ioca retailer upon purc
138. oor to permit battery exchange e Focus Record Button Touch for Auto Focus fully depress to Start or Stop Record e Adjustment Ring Selects and adjusts camera parameter values Similar to the scroll wheel on the navigation group e LCD Menus Keys Specific functions are defined by LCD screen 1 ISO 2 F Stop 3 Shutter Speed 4 White Balance e LCD Display Displays key camera parameter values e LCD Backlight Button Enables LCD backlight Version 2 0 2 2 l 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE FRONT E Stills Movie Slider Figure 7 Side Handle Controls Front e Stills Movie Slider Selects between STILLS and MOVIE modes of operation NOTE This switch is not active at this time Default camera operation is MOVIE Version 2 0 2 NOVEMBER 18 2011 2011 RED COM INC 23 RED SCARLET X OPERATION GUIDE REAR A MENU Button D User Keys A D men Rocker Switch REH System Keys 1 3 Navigation Group F Thumbwheel Lock Figure 8 RED Side Handle Controls Rear e Menu Button Press to access camera setup menus e Rocker Switch Increases or decreases selected value based on parameter selected in USER KEYs Version 2 0 2 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE e Navigation Group Allows navigation through camera menus selection of camera parameter for adjustment and adjustment of selected camera parameter Figure 9 Side
139. optional soft clip limiter in order to achieve the desired audio reference recording level and to maximize dynamic range To assist with audio reference level setup the camera provides a color coded Audio meter in the Graphical User Interface Meter range is 36dBu to 20dBu 56dBFS to OdBFS with audio input type and audio input clipping indication Audio monitor output options include a 2 channel headphone output on the camera Brain and 2 channel line level analog outputs from the optional PRO I O Module plus 2 channel and 4 channel 24 bit 48KHz uncompressed digital audio embedded in the HD SDI and HDMI outputs MICROPHONE LEVEL ANALOG INPUTS The recording level of Microphone inputs are affected by the sensitivity of the microphone and the Gain setting of the camera s pre amplifier Available pre amplifier range is 8dB to 62dB with a default value of 32dB The camera operator should choose a Gain value that aligns the input signal to the OdBu reference line drawn through the camera s peak meter or 4dBu line if referencing to that level This setting provides up to 30dB of input signal headroom above reference OdBu level before clipping 26dB for 4dBu reference level and maximizes the signal to noise ratio of the 24 bit digital recording Version 2 0 2 13 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE LINE LEVEL ANALOG INPUTS The recording level of Line inputs are affected only by the signal
140. ose Input trigger whose function is programmed in the USER KEYS menu Default is Record Start Stop A SMPTE timecode input signal provides a frame accurate time stamp for each frame of recorded video External TC must be chosen in the Project gt Timecode menu When SMPTE timecode is detected it will align the internal TC at every 00 frame crossing to the external time A Video Genlock input signal may be used as a vertical interval reference signal for applications that require precise synchronization between cameras such as 3D and live broadcasts When using GENLOCK as the camera shutter timing reference fine shutter start time timing SHUTTER PHASE may be adjusted The HD SDI monitor output will automatically be synced to the genlock when the signal is detected Figure 22 View into camera SYNC Video Sync Interface connector Mating Connector FGG 00 304 CLAD27Z PIN SIGNAL DESCRIPTION SS GPI Shutter Sync GPI Trigger Input TIMECODE SMPTE unbalanced timecode Input GENLOCK RS170A Tri Level Sync Input NOTE The Shutter Sync GPI Trigger uses a Schmitt trigger 5 volt tolerant 3 3v recommended Current must be supplied by trigger source Both edges of the input signal can be used as a trigger event Version 2 0 2 156 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE For example when GPI trigger is used as a Record Start Stop e Start Record Ground 3 3V Transition e During Record
141. our own preferences through User Settings Available options are Aspect Ratio and Scale Solid Line Style shown below Presets Media Settings Power co P sae Sbi a 80 00 F 80 00 F 90 00 0 00 H ooo 0 00 HS ooo _ Version 2 0 2 g 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE COLOR Sets Title Guide and Action Guide line color to White Blue Yellow Green Red or Black Select the color that provides maximum color contrast with the scene you are shooting TRANSPARENCY Sets Title Guide and Action Guide transparency Options are 0 25 50 75 and 100 LINE STYLE Sets Title Guide and Action Guide line style Options are Solid Dashed and Bracket MONITOR Allows you to modify brightness of the LCD and EVF parameters through Brightness Control Also allows options for the LCD touchscreen to be changed through Touch Gestures Presets Media Settings Power BRIGHTNESS CONTROL Slide to the right for a brighter display slide to the left for a dimmer display TOUCH GESTURES These options apply ONLY to the Touchscreen LCD Pinch to Magnify When selected allows you to use two fingers in a pinching motion on the screen to enable Focus Zoom To zoom out to normal view slide fingers apart Version 2 0 2 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE Double Click Right 25 to Record When
142. pear asking if you wish to proceed with Black Shading calibration REDmote will also display the following messages Presets Media Settings Power Arapaoa A001_C006 Black Shading calibration procedure 1 Ensure the sensor is NOT exposed to the calibration light source by installing the lens cap properly 2 Ensure a properly formatted SSD is attached to the camera and properly formatted 3 Select OK to perform the Black Shading calibration The calibration will make 2 passes 4 A status screen will show progress of the Capturing step Second pass shown HDR Focus Presets Media Settings Power de FO A001 COO Varispeed Version 2 0 2 125 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE 5 Once Capturing is complete a status screen will show progress of the Analyzing step HOR Focus Presets Media Settings Power A001_Co07 Varispeed 6 Once Analyzing is complete a status screen will show progress of the Erasing step Presets Media Settings Power A001 _COoOo7 Varispeed 7 Once Erasing is complete a status screen will show progress of the Programming step Presets Media Settings Power A001 o07 Varispeed 8 The camera will perform this procedure twice Version 2 0 2 406 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE 9 After Programming CALIBRATION SUCCESSFUL will be displayed
143. pecific Canon or Cooke lenses Cursors Reference cursors Safe Action Safe Title Picture Center Grid Overlay RED SCARLET X OPERATION GUIDE Frame Guide Record or Projection area Next Clip Filename Filename of the clip that will be shot next Project Frame Rate Current project TIME BASE Noise Level Bar Relative number of RAW pixels in noise Histogram RGB Histogram Clip Level Bar Relative number of RAW pixels near clip Clip Meter RGB sensor RAW clipping status Temperature Camera core temperature Drop Indicates if any frames were dropped during recording of the clip Fan Speed Displays fan speed in HDR Mode Displays HDRx mode status False Color Mode Displays false color overlay mode Magnify Tallies 1 1 if magnify is selected TC Indicates presence of valid SMPTE timecode signal 2011 RED COM INC Genlock Indicates presence of valid Genlock signal sensor sync to genlock Jam Sync Timecode Jam Sync status time code jam RM Indicates communication to REDmote LAN Indicates communication via Ethernet connection RIG Indicates 3D rig metadata is present Media Status Media location and remaining media capacity in Power Indicates D C supply voltage or of remaining battery capacity Including current supply voltage Audio Meter Audio input selection and levels Timecode Current timecode value Menu ICON In the upper Right corner on the touchscreen LCD Opens th
144. ploitation in postproduction e Blend the two tracks in post tools like REDCINE X Storm or any other application that supports the SDK to create Magic Motion This blending of the two tracks comes with a slider so you can decide just how much of each track you want to use A preview window shows you the combined result of your selection or you can view each track individually e Combine the two tracks using MNMB More Normal Motion Blur MNMB is designed to emulate the motion of a traditional camera with full motion blur This is a tool created by The Foundry that uses a new motion estimation algorithm designed specifically for HDRx The shorter exposure sharper image is blended to match the motion blur of the normal exposure Again a preview window shows the combined result of your selection or you can view each track individually e Use the X track data for motion tracking then combine the X track with the A track as in 1 or 2 above or just motion stabilize the A track using the motion analysis data extracted from the X track e Exporting to EXR file format will give you a multi view EXR with both exposures like a stereo EXR Version 2 0 2 12 SE 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE NOTE If you ignore the X track completely you will have a standard exposure with 13 5 stops of native dynamic range just as if you had not enabled HDRx For this reason we encourage the A track ex
145. posure to be normal as it provides the most options If you are tempted to shoot over under you are then fully committed to using HDRx and your postproduction options are reduced NOTE When recording in HDRx mode the camera records twice as many frames so the maximum frame rate minimum REDCODE ratio and maximum record time on your media will be cut in half MAGIC MOTION Shooting at 24fps and with an 180 degree 1 48th shutter on a film or digital camera may create an optical illusion we are familiar with however it is not really the way the eye sees motion To understand this ask someone to stand in front of you and swing their arm over their head from one side to the other What you would observe in the recording is a constant motion blur until the arm stopped What your eye sees though is both motion blur AND a sharper reference to the arm and hand all along the motion path Magic Motion provides such a combination of motion blur A track and a sharper reference X track with the bonus of extreme dynamic range not available with any other motion capture camera system AUDIO RECORDING The RED SCARLET X can record up to two discreet channels of microphone level uncompressed 24 bit 48 KHz audio four channels of microphone level or line level audio inputs when equipped with a PRO I O Module that are synchronized with video and timecode to REDMAG 1 8 SSD media Input signals are routed via a high quality pre amplifier and
146. ptions for each channel are ON and MUTE Default is ON Presets Media Settings Power 59 dB 59 dB 59 dB 59 dB AUDIO CHANNELS Allows selection of audio inputs and operational modes Presets Media Settings Power Version 2 0 2 101 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE INPUT Available inputs are CH 1 2 and CH 3 4 NOTE For cameras not equipped with a PRO I O module options are CH 1 2 Source Available options are NONE CAM ANALOG PRO I O ANALOG PRO I O AES A and PRO I O AES B NOTE For cameras not equipped with a PRO I O module options are NONE or CAM ANALOG Presets Media Settings NONE PRO 1 0 ANALOG PRO 1 0 AES B Mode Available options are UNBALANCED and BALANCED Version 2 0 2 102 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE Presets Media Settings Power CAM ANALOG w Link Enables linkage between Channel Gain controls Limiter Enables signal limiter circuit Limiter enabled adds 10dB of headroom for Microphone level inputs or 4dB for Line Level inputs OUTPUT Link Enables linkage between Output Channel Attenuation controls Version 2 0 2 103 NOVEMBER 18 2011 2011 RED COM INC MONITOR CONTROL This sub menu allows the monitor outputs settings to be modified For changes to take effect the camera MUST be restarted Presets Media Setti
147. r changes 7 Click Apply at the bottom of the Network window 8 Proceed to UPGRADING REDMOTE FIRMWARE Version 2 0 2 186 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE UPDATING REDMOTE FIRMWARE The following information will guide you through proper updating of your REDmote firmware MAC ONLY 1 Download the camera upgrade SCARLET X_vX X XX zip file located at http www red com support 2 The file will unzip automaticaly when downloaded The REDmote Upgrade is located in this download 3 Navigate to the downloads folder and open the newly created SCARLET X_vX X XX folder or open it directly from the downloads window 4 Open the REDmoteUpgrade_vXXX folder 5 Open the MAC folder 6 Double click the REDmoteUpgradeApp A Terminal window will open and the REDmote Software Wizard will open AOO REDmote Software Wizard File Transfer Status Press Connect button to establish a connection with REDMOTE Select File Remove File Start Upgrade Cancel Upgrade Version 2 0 2 187 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE 7 Click Connect When REDmote has been established Connection to REDMOTE has been achieved will be displayed File Transfer Status Connection to REDMOTE has been achieved Select File _ Remove File Start Upgrade Cancel Upgrade 8 Click Select File and navigate to the redmote 1 bin file loca
148. r your REDmote to operate with this camera build version ensure your REDmote has been upgraded to the latest firmware Refer to APPENDIX E REDMOTE OPERATION gt MAINTENANCE gt UPGRADING REDMOTE FIRMWARE REDMOTE C Figure 10 REDmote Controls A Still Motion Slider F UserKeysA D K Soft Menu Keys 4 8 B Release Button L G MENU Button Power Lock Slider Record LED H SoftMenuKeys1 3 M Release Button L D Power LED RIN Navigation Group N USB Connector a Rocker Switch Focus Record Button e Stills Motion Slider Allows selection of STILLS or MOVIE operational modes e Rocker Switch Provides continuous adjustment of parameter specified in USER KEYS menu e User Keys Press to initiate camera functions as defined in USER KEY menu Default settings for User Function Keys A D are as follow User Key A Press to execute user defined function Default Toggles Focus Assist Indicator User Key B Press to execute user defined function Default Toggles False Color gt RAW Check Version 2 0 2 28 l 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE User Key C Press to execute user defined function Default Toggles False Color gt 1 1 Magnify User Key D Press to execute user defined function Default Toggles False Color gt Exposure Check e Menu Button Press to access camera setup menus e Soft Menus Keys 1 3 Below the LCD are three 3 Soft Menu buttons 1 3 H whose func
149. rence monitor from a distance of about 3ft 1m with Surround View look around area frame guides and safe action title zebra and false color exposure overlays operational status and setup menus RED LCD An 800 x 480 resolution RGB 4 4 4 progressive scan touchscreen video display with Surround View look around area frame guides and safe action title zebra and false color exposure overlays operational status and setup menus HD SDI A 720p or 1080p output suitable for monitoring or recording to an external VIR or DDR device May be configured for 10 bit Gamma or 10 bit LOG encoded video data Three different viewing options are available Preview menus Guides frame guides only and Program clean feed Refer to SECONDARY MENUS gt SETTINGS MENU gt AUDIO VIDEO gt MONITOR CONTROL for complete details When an HD SDI monitor is connected along with an LCD or EVF only the main screen menu items will be displayed in Grayed out text The menu items will reflect any changes made to Frame Rate ISO Shutter Speed White Balance Resolution and REDcode settings and will not display the same information as the LCD EVF while making adjustments Example when the secondary menus are accessed using the touchscreen LCD the HD SDI output will not show the secondary menus only the main screen menus Version 2 0 2 14 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE HDMI A 720p or 1080p PREVIEW output
150. reset name field Version 2 0 2 11 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE CREATE PRESET When selected allows you to create your own preset and decide which information will be stored with that preset Presets Media Settings Power After Preset name is entered and Preset information is highlighted select CREATE to create your preset and will be taken back to the Preset Main Menu your new preset shown PRESET NAME Press the Enter button on the New Name field a keyboard will appear allowing you to enter the desired preset name Presets Media Settings Power EA SD izar Use the arrow keys and Enter button enter the desired name When finished press the Menu button to close the keyboard Version 2 0 2 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE PRESET INFORMATION Use the arrow keys and Enter button to select the information you want to be stored for your preset Available options are IMAGE SYSTEM PROJECT KEYS and or OUTPUT Presets Media Settings Power When creating a new preset successfully completed Preset Created Successfully will appear and the preset will be listed REDmote will also display this message You can then select APPLY to apply the preset to the camera Presets Media Settings Power When successfully completed Preset Applied Successfully will appear REDmote will also
151. rme a la norme NMB 003 du Canada FEDERAL COMMUNICATIONS COMMISSION FCC COMPLIANCE STATEMENTS This equipment has been tested and found to comply with the limits for a Class B digital device pursuant to part 15 of the FCC Rules These limits are designed to provide reasonable protection against harmful interference in a residential installation This equipment generates uses and can radiate radio frequency energy and if not installed and used in accordance with the instructions may cause harmful interference to radio communications However there is no guarantee that interference will not occur in a particular installation If this equipment does cause harmful interference to radio or television reception which can be determined by turning the equipment off and on the user is encouraged to try to correct the interference by one or more of the following measures 1 Reorient or relocate the receiving antenna 2 Increase the separation between the equipment and receiver 3 Connect the equipment into an outlet on a circuit different from that to which the receiver is connected 4 Consult the dealer or an experienced radio TV technician for help In order to maintain compliance with FCC regulations shielded cables must be used with this equipment Operation with non approved equipment or unshielded cables is likely to result in interference to radio and TV reception The user is cautioned that changes and modifications made to the
152. rsions of camera firmware Operations Guide updates and postproduction software Your REDmote also requires a firmware upgrade Go to APPENDIX E REDMOTE OPERATION gt MAINTENANCE gt UPGRADING REDMOTE FIRMWARE VERIFY CURRENT CAMERA FIRMWARE With the camera ON select SECONDARY MENUS gt SETTINGS gt MAINTENANCE gt SYSTEM INFO Presets Media Settings Power System Info Save Log SW Update The camera s P I N number and current firmware version will be displayed Presets Media Settings Power UPGRADE PROCEDURE 1 Download v2 0 2 firmware from Uncompress the v2 0 2 firmware zip file 3 Using RED STATION REDMAG 1 8 copy the force_upgrade folder and its contents to the top level of the REDMAG 1 8 SSD directory Eject or unmount the SSD then remove the SSD from RED STATION Ensure camera is powered down Version 2 0 2 Pur a NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE 6 Remove Side Handle and or REDmote if installed on the camera 7 Connect an AC power adapter to the camera IMPORTANT DO NOT USE BATTERIES TO POWER CAMERA DURING THIS PROCEDURE 8 Insert the SSD into your SCARLET X and power up Force upgrade will automatically run on power up only and will not display anything on the external monitors During upgrade the fans will run at hi speed and the PWR and REC LEDs will blink Green After about 45 seconds the LEDs will stop blinking and the camer
153. s AE 20833m 120 000 Deg F A001_C006 Version 2 0 2 59 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE INTEGRATION TIME Provides the ability to enter the Exposure value as a Shutter Integration Time xx milliseconds Range is 0 125 to 41 708 mS milliseconds Default is 20 833 MS CAFPs Iso8DD ve 48sec 5600k 4K HD ias sec 2533 ms AEE 160 000 Deg F A001_C006 ABSOLUTE ANGLE Provides the ability to enter the Exposure value as a Shutter Angle xx Degrees Range is 1 000 to 360 000 Degrees Default is 180 0 Degrees CArFPs yse800 vO ABsrc 5600k 4K HD RC8 1 44 sec 25330 I 120 000 Deg As you adjust any of these three parameters the camera will automatically calculate the equivalent value in the other units but as a quick reference here are some common Speeds and Angles Version 2 0 2 6o l 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE To Convert Shutter Speed to Angle Equivalent Equivalent Degrees Shutter Speed x Frame Rate x 360 E g 1 48 x 24 x 360 8640 48 180 Equivalent Shutter 1 Frame Rate x 360 Angle E g 1 24 x 360 180 1 8640 1 80 1 48 C oeorees SHUTTER DEGREES SHUTTER 9 4 5 CO WHITE BALANCE BASIC SETTINGS Allows you to manually set Color Temperature in the range from 1 700 to 100 000 degrees Kelvin CAFPps isoBU0 28B YABSEC N6U0k AK
154. s been locked out When locked the main menu will be displayed so800 e8 48sec 5600k 4KHO RC amp UNLOCK To unlock out the touchscreen and allow normal operation touch and hold the LOCK icon 2 until the MENU icon displays indicating the touchscreen has been unlocked Version 2 0 2 44 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE b 24rs 150800 28 48sec S600k 4KHD ACB FIRST TIME USE SETTING UP YOUR RED SCARLET X 1 ATTACH POWER SOURCE If a REDVOLT battery is installed in the Side Handle and DC power is connect through the DC IN connector the DC IN power supply has priority and will power the camera instead of the battery BATTERY Connect a RED battery to the camera in one of the following ways SIDE HANDLE Attach a Side Handle and insert a REDVOLT battery INSTALL Press the battery door release button A Open battery door B Press upwards on retainer C Insert a REDVOLT battery until it is fully seated and retainer C clicks into place oe SY Close battery door Version 2 0 2 45 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE REMOVE 1 Press the battery door release button A 2 Open battery door B 3 Press upwards on retainer C to release battery 4 Remove battery from side handle REAR BATTERY MODULE Attach a Rear Battery Module and insert one or more REDVOLT or REDVOLT
155. s menu to select and program the camera user keys buttons NOTE To reset keys to default settings go to RESTORE A reboot of the camera is necessary to restore defaults NOTE Multiple keys can be programmed to the same action Default settings by device are listed below Down indicates pressing of the key North South East West refers to the _ Side CF refers to the Side SSD Module Direction keys Up Down Left Right on the Navigation Group Brain LCD refers to the EVF LCD being plugged into the brain EVF LCD connector Rotary Jog refers to Scroll Wheel on the Navigation Group Tele Level refers to the rocker switch Rotary Front refers to Adjustment Ring on Side Handle near LCD WARNING IT IS NOT ADVISABLE TO REMAP THE NAVIGATION KEYS UP DOWN LEFT RIGHT SELECT ENTER OR MENU ON THE SIDE HANDLE AS IT IS THEORETICALLY POSSIBLE TO GET INTO A SITUATION WHERE IT IS NOT POSSIBLE TO RESTORE THE FACTORY KEY PRESET ANYMORE IF NO TOUCH SCREEN IS ATTACHED TO THE SYSTEM Brain e Brain GPI In High Record Start e Brain Record Full Button Down Toggle Record e Brain GPI In Low Record Stop Side Handle e Side Handle User Key A Down Toggle AF Mode e Side Handle User Key B Down WB Calc e Side Handle User Key C Down Toggle Magnify e Side Handle User Key D Down Exposure Check e Side Handle Function 1 Key Down Activate ISO e Side Handle Function 2 Key Down Activate Apertur
156. s will emphasize edges in the image without changing brightness image content so it is easier to judge if the image is in focus By adjusting your lens zoom and focus you can see which objects are coming into and falling out of focus When selected the icon Fy will be displayed in the Lower Status Group 30 456 S SSD DC EO Fw F 72 oe J ves Jes VIDEO VIDEO displays a multi color color overlay that allows you to check the video level of the RGB monitor path calibrated to the SMPTE test signal and any outputs driven from that path such as HD SDI and HDMI When selected the icon V y will be displayedin the Lower Status Group AK Hf 3 lA KC g c C D C CHI NE A HARAR gi CH 2 OTE l V F f 3 Purple represents Super Black Dark Blue represents Black Teal represents 3 stops under 18 Gray Green represents 18 Gray Pink represents Skin Tone Straw represents White and Yellow Orange and RED represent various degrees of signal clipping in RGB space By adjusting ISO FLUT and Shadow while looking at VIDEO check the operator can ensure that Black White and 18 Gray values conform to the desired levels on the HD SDI and or HDMI outputs The VIDEO bands provide the following information PURPLE Super Black IRE 1 0 BLUE Black IRE 1 3 TEAL Dark Gray IRE 9 12 GREN Typical Level for 18 Gray Card IRE 44 47 PINK Typical level for Caucasian Skin IRE 54 57 White RE 96 98 Ver
157. sion 2 0 2 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE At all other values the monochrome image displayed represents the luminance value of the ISO adjusted image PURPLE TEAL PINK YELLOW RED BLUE GREEN STRAW ORANGE es A003_C003 07 41 21 14 EDGE EDGE displays a color overlay that outlines the edges of objects in an outline mode By adjusting your lens zoom and focus you can pinpoint focus When selected the icon fy will be displayed in the Lower Status Group WARNING This will potentially interfere with recordings done via HDMI HD SDI in Clean Mode A004_C024 LO 2 23 15 03 Version 2 0 2 n Y C C S RAV 3 C A P s L_ NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE MAGNIFY Magnify displays the central region of the sensor in 1 1 pixel resolution When enabled the 1 1 text in the Lower Status Group will change to Green If in Magnify mode when the Record button is pressed the system will automatically exit this mode When using a touchscreen you can also perform this function by pinching your fingers together and apart NOTE HDR mode cannot be modified when in Magnify 1 1 mode Settings Power oS on EEE NOTE When in magnify mode you will not be able to adjust frame rate or resolution These options will be Grayed out 1s0800 28 VAB SEC 5600k Version 2 0 2 84 2011 RED COM INC NOVEMBER 18 2011 R
158. st pattern Available test patterns are CHIP CHART and SMPTE BARS Presets Media Settings Power To enable a desired test signal select the desired test signal box To exit the test signal tap the touchscreen one time or press the Enter or Menu button on the Side Handle or REDmote CHIP CHART SMPTE BARS NOTE RED SCARLET X test signals are not recordable they are provided to help align external video monitors connected via the HD SDI or HDMI outputs Version 2 0 2 106 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE SETUP This menu permits a variety of system setup tasks to be accomplished Options available are KEYS SHORTCUTS DATE TIME NETWORK SERIAL REMOTE GPIO and SYSTEM Presets Media Settings Power Communication KEYS SHORTCUTS Keys Shortcuts display the USER KEY and KEY ACTION sub menus These options allow selected menus or functions to be mapped to specific User Keys on the camera body and accessories User keys are also referred at as Soft Keys Buttons Presets Media Settings Power Record Start Brain GPI In High v KEY SOURCE Use this menu to select the device to program Options at this time are e Brain e Side SSD CF e LCD on Pro I O e Side Handle e LCD on Brain e EVF on Brain e Bottom Handle e Lens e EVF on Pro I O Version 2 0 2 107 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE USER KEY Use thi
159. supported Audio is captured uncompressed at 24 bit resolution 48KHz sample rate per channel Digital media such as REDMAG 1 8 SSDs are very robust but should be treated with equal care as exposed film or a videotape master We recommend storing digital media that contains your footage in a secure location and backing up the data to a digital archival media such as data tape or hard disk drive RECORD INDICATOR When recording the RED SCARLET X camera provides a variety of record indications tallies Timecode normally displayed in white colored text will be displayed in red colored text A small Red dot will appear in the top right corner of the VIEWFINDER outpui s ABsec I A001_C006 The REC LED on the right side of the camera Brain will illuminate Red REDmote upper LED will illuminate Red and the Timecode will turn Red Aperture Focus m Zoom 3 0 u8cm mm Sensitivity Exposure Color Temp SDD Format Redcode Sensor FPS AK HU 8 1 CAFPs AQ01_C003 DEFAULT If using a BOMB EVF the LED on the front will illuminate Red if Tally is enabled SMPTE RP188 timecode VITC 2 HANC metadata record flag will be enabled on HD SDI outputs If enabled in the USER KEYS menu the GPO trigger output in the CNTL connector will pulse Version 2 0 2 50 l 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE 5 PLAYBACK Playback is available on RED SCARLET X Playback is accessed by going to
160. t FORMAT MEDIA Presets Media Settings Power Format Media Eject Media When FORMAT is selected a SLATE dialog box will appear allowing you to add Camera Identity and 3D Position properties when formatting When desired options are set select FORMAT NOTE If any clips will be erased on the attached media you will be informed of the number Presets Media Settings Power E _ i oa a S cener a Version 2 0 2 47 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE PERFORM A BLACK SHADING CALIBRATION Refer to SECONDARY MENUS gt SETTINGS gt MAINTENANCE gt CALIBRATION for complete details for performing a Black Shading Calibration ADJUST PROJECT SETTINGS TIME BASE To adjust the project TIME BASE press the MENU button on the Side Handle or REDmote Then use the Scroll Wheel or Direction Keys to navigate to SETTINGS gt PROJECT gt TIME BASE and press ENTER Adjust to the desired value using the Scroll Wheel and press ENTER once more to confirm Presets Media Settings Power If using a Touch Screen select SECONDARY MENUS gt SETTINGS gt PROJECT gt TIME BASE Adjust by sliding your finger up down or tapping on the desired value and then press anywhere else on the touch screen to confirm The following TIME BASES are currently available e 23 98 fps e 25 00 fps e 47 96 fps e 50 00 fps e 24 00 fps e 29 97 fps e 48 00 fps e 59 9
161. t and RED Focus Back focus is adjusted by turning the back focus adjustment on the top of the camera s front plate using a T 10 Torx driver This screw is indicated by a Siemens Star with an arrow pointing to its location Back Focus Adjustment Location EPIC M Shown Scarlet X Similar 1 Remove the screw in plug located in the back focus adjustment opening using a T 10 Torx driver Version 2 0 2 209 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE Place the camera on a level stable surface or mount the camera on a tripod 3 Install RED Focus to the camera PL mount A Remove the camera lens or sensor cover if equipped B Install RED Focus onto the camera in the position shown C Ensure RED Focus is secured to the camera with the camera lock ring RED Focus Properly Installed on Camera EPIC M Shown Scarlet X Similar Power up the camera Power up RED Focus Refer to POWER UP DOWN NOTE Remember that RED Focus will AUTOMATICALLY power down after 3 minutes Press the Red button on the front to power back up 6 Set the camera to Magnify Go to SECONDARY MENUS gt SETTINGS gt DISPLAY gt FALSE COLOR gt MAGNIFY NOTE The Focus option located under SECONDARY MENUS gt SETTINGS gt DISPLAY gt FALSE COLOR gt FOCUS can serve as a good double check for proper focus during this procedure yso800 ABsec 5600x A001_C005 ong 08 47 48 08 RE
162. t away Version 2 0 2 15 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE REDMOTE REDmote is a proprietary camera control unit for RED SCARLET X cameras that attaches to the rear of the camera Brain or the back face of the rearmost expansion module The REDmote may also be detached from the camera and operate over a proprietary REDlink 2 4Ghz wireless connection Whether operating attached or via wireless REDmote supports all basic controls necessary to operate the camera including Record Start Stop Shutter Speed White Balance ISO and programmable User Keys An integrated color LCD displays camera parameters media and battery capacity and REDmote menus Aperture Focus m Focus ft Bain Filter Zoom Sensitivity Exposure Color Temp Format aw ass A001 C014 lal DEFAULT Figure 3 REDmote LCD display REDmote includes a rechargeable Li lon battery which automatically re charges when attached to the camera or rearmost module It may also be re charged by connecting to a USB 2 0 based power source such as a laptop PC or cell phone charger Under typical operating conditions REDmote should operate for up to 8 hours without requiring a re charge and support a wireless communication range of approximately 50 ft DIGITAL MAGAZINE MEDIA REDCODE RAW compressed MOVIE clips and STILLS images plus time code multi channel audio and metadata may be recorded to REDMAG 1 8 SSD solid state digital me
163. t line Version 2 0 2 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE EXPOSURE This will show areas of under exposure Purple or over exposure Red on top of a monochrome image The color is based on RAW data so over under exposure refers to data actually close to clipping in the sensor When selected the icon Ey will be displayed in the Lower Status Group The EXPOSURE meter s color bands provide the following information PURPLE Minimum Exposure Between minimum and maximum exposure values the image is displayed as a monochrome image PURPLE RED In the image Purple areas represent sensor exposure levels that are likely to be noisy if gained up in postproduction Red areas represent sensor exposure levels that are at clipping A003_C003 07 38 54 07 NOTE As EXPOSURE meters sensor RAW information it is not affected by any RGB domain adjustments such as ISO rating FLUT White Balance Video Gain or other LOOK information NOTE Because the RAW data represents a wider color space than RGB provided that the Red clip color is not present in EXPOSURE view even if Red clip color is present in VIDEO view the apparently clipped RGB highlights can be recovered in post production by adjustment of ISO FLUT or changing the KNEE and WHITE values of the CURVE box Version 2 0 2 81 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE FOCUS Thi
164. ted in the REDmote_firmware_vXXX folder 9 Select Start upgrade Name Size redmote 76 6205824 File Transfer Status ee f File Transfer is in Progress Select File _ Start Upgrade d Cancel Upgrade 10 File transfer status will be displayed as a Blue bar Version 2 0 2 188 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE 11 Updating Firmware will be displayed with a Green status bar showing upgrade progress REDmote will also display UPGRADE during this process Aperture Focus Zoo Exposure Sensitivity Color Temp UPGRADE _ 00 00 00 00 E 12 Once the File Transfer Status is completed the REDmote Software Wizard will display Please Wait and Don t Unplug Firmware Upgrade is in Progress on REDmote oo REDmote Software Wizard N Disconnect Quit File Transfer Status ME Please Wait and Dont Unplug Firmware Upgrade is in Progress on REDmote Select File Remove File Start Upgrade Cancel Upgrade 13 After a few more seconds the REDmote Software Wizard will display Firmware Upgrade Successfully Done Select OK Firmware Upgrade Successfully Done Gown 14 The REDmote Software Wizard will disconnect from the REDmote 15 REDmote will reboot 16 REDmote upgrade is complete REDmote will display POWER UP then SEARCHING once the upgrade has completed Finally displayin
165. th the camera and accessories at all times DO NOT attempt to modify dismantle or open your camera lens or other accessory as doing so may expose you to electric shock and serious injury There are no user serviceable parts inside Alteration or repairs made to the camera lens or other accessory except by a RED authorized service facility will void the Limited Warranty Users are not permitted to make design changes or otherwise modify the operation of the camera lenses or other accessories without the express written approval of RED DIGITAL CINEMA Only use attachments accessories specified by RED Install camera and accessories in accordance with the manufacturer s instructions Avoid imaging of laser beams as they may cause damage to the sensor DO NOT use the camera or accessories near water Avoid exposing your camera to moisture The unit is not waterproof so contact with water could cause permanent damage to the unit as well as electric Version 2 0 2 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE shock and serious injury to the user DO NOT use the camera in the rain or under other conditions with high moisture without appropriate protection and immediately remove power source if camera or accessories are exposed to moisture WARNING To reduce the risk of fire or electric shock do not expose the camera or accessories to rain or moisture J M DO NOT expose your camera to excessive vibration
166. ting systems Depending on the QuickTime movie resolution material may be taken directly to a broadcast delivery videotape format or after the editorial decisions have been made video can be conformed at full image resolution by replacing the lower resolution edit proxy e g 720p at 8 bit quality with a high resolution 4K 2K or 1080p image file SOFTWARE TOOLS RED Digital Cinema provides a variety of software tools to aid postproduction For proper color rendition using a Macintosh OSX computer your monitor should be set to Adobe 1998 or to SMPTE C display profile If you use the HD Cinema display profile adjust the gamma to 2 2 Version 2 0 2 206 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE REDCINE X PRO REDCINE X PRO is available for Intel based Mac OSX and Windows XP platforms In addition to performing white balance and one light color correction REDCINE X PRO provides image pan scan crop and scaling operations The application can export either a single clip or a sequence of clips as 4K or 2K resolution 10 bit DPX or 16 bit TIFF files REDCINE X PRO can also render clips into standalone QuickTime movies using specific HD video codecs As RED SCARLET X shoots progressive scan images all QuickTime movies created by REDCINE X PRO are also progressive scan ALA REDCINE X PROFESSIONAL Build 3 16493 Test 1 8 Fit Both v Default 2D A004_C003_0811N 4K 16 9 N None APN D Bin al
167. tion operation of cameras in Master Slave configuration and clip naming conventions for clips recorded on those cameras The MASTER camera will control only the METADAT parameters of both cameras On the SLAVE camera any other setting outside of these will need to be manually changed before recording CAMERA SETUP Select one camera to be designated as Master and a second to be designated as Slave NOTE Cameras can be set up in a MASTER MASTER and SLAVE SLAVE configuration To set as MASTER MASTER select ALL under TARGET for both cameras This will allow either camera to make changes and control record start stop of both cameras To set as SLAVE SLAVE select NONE under TARGET for both cameras MASTER CAMERA Perform the following steps on the Master camera 1 Go to SECONDARY MENUS gt SETTINGS gt SETUP gt COMMUNICATION gt NAME and give the camera a unique NAME CAM A LEFT etc Presets Media Settings Power 2 Under TARGET select ALL Version 2 0 2 F I 1 L NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE 3 Give the camera a unique IP address 4 Goto SLAVE CAMERA SLAVE CAMERA Perform the following steps on the Slave camera 1 Go to SECONDARY MENUS gt SETTINGS gt SETUP gt COMMUNICATION gt NAME and give the camera a unique NAME CAM B RIGHT etc Presets Media Settings Power DEFAULT 2 Under TARGET select NONE 3 Give the
168. tions are defined on the LCD screen For complete information refer to APPENDIX E REDMOTE OPERATION gt OPERATION gt REDMOTE MENUS gt SOFT MENU BUTTONS 1 3 e Navigation Group Allows navigation through camera menus selection of camera parameter and adjustment of selected camera parameter Figure 11 Side Handle Navigation Group A Scroll Wheel B Direction Keys Enter Button Scroll Wheel Selects and adjusts selected camera parameter value Direction Keys Navigates camera menus and may select parameter for adjustment Enter Button Confirms selected parameter value adjustment e Focus Record Button Touch for Auto Focus fully depress to Start or Stop Record e Soft Menus Keys 4 8 To the right of the LCD are five 5 Soft Menu buttons 4 8 H These are pages displaying camera settings For complete information refer to APPENDIX E REDMOTE OPERATION gt OPERATION gt REDMOTE MENUS gt SOFT MENU BUTTONS 4 8 e Power Lock Slider Slide and hold down to power up down REDmote and or camera Slide up to lock keys Version 2 0 2 29 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE BOMB EVF Figure 12 BOMB EVF a FocusRing B Brightness Control D EVE Tally Light e Focus Ring Adjusts optimal subject focus for your eye Available diopter range is 2 0 to 5 0 e EVF User Key B Increases EVF display brightness e EVF User Key C Decreases EVF display brightness NOTE Th
169. tions are REEL NO CAM ID CAM POS and FORMAT to format the media with the values entered Presets Media Settings Power gt a a Cener a NOTE If clips are present on the media you will be informed of how many clips will be erased when you format the media Version 2 0 2 ia NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE REEL NO When selected a keypad will appear allowing you to enter a value between 1 and 999 CAMERA ID SLATE Identifies the camera with a letter A through Z Default is A CAMERA POS POSITION Identifies the camera position as Right Left or Center Default is Center FORMAT When selected formats the media and adds the selected properties e During formatting the camera will display Formatting with a Green status bar REDmote will also display this message e When formatting is complete camera will display The magazine was successfully re formatted The digital magazine is ready for immediate use REDmote will also display this message KU ee R When selected will Eject unmount the media highlighted in the Select Media box EJECT MEDIA Presets Media Settings Power Earmat NAc Format NN oa When ejected camera will display Media Ejected Successfully REDmote will also display this message Eol Version 2 0 2 8 2011 RED COM INC NOVEMBER 18 2011 ET X OPERATION GUIDE UT
170. to PL mount adaptor is also available to permit use of 2 3 HD lenses on the RED SCARLET X camera The optical coverage it provides is approximately equivalent to 16mm hence the maximum recording resolution with a B4 lens is 2K RAW 2048 x 1152 pixel progressive scan MYSTERIUM X SENSOR The MYSTERIUM X sensor has been specifically designed for use with RED SCARLET X cameras and provides variable frame rate imaging over 0 5 to 60 fps at 2K 0 5 to 48 fps at 3K 0 5 to 30 fps at 4K and 0 5 to 12 fps at 5K Native color balance for the MYSTERIUM X sensor is 5 000 degrees Kelvin but it may be electronically compensated for any color temperature in the range 1 00 to 10 000 degrees Kelvin White balance preset values include Tungsten 3200K and Daylight 5600K light sources the camera may also calculate a color neutralizing White Balance value on demand by imaging on a standard white or 18 grey card The MYSTERIUM X sensor includes high precision analog to digital conversion capable of delivering up to 13 5 stops of dynamic range with daylight light sources over a camera sensitivity range of 320 800 ISO IMAGE PROCESSING The digital image received from the sensor is formatted as a pixel defect corrected but in all other aspects unprocessed 12 bit 14 bit or 16 bit per pixel RAW data frame When recording successive images FRAMES received from the sensor are collected together into a CLIP Each RAW frame or sequence of RAW frames in
171. tors Version 2 0 2 169 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE Local Allows you to control the camera setting directly on the REDmote as opposed to having to see the setting on the LCD or external monitors to adjust As the settings are changed they will be reflected on the camera LCD and external monitors however the menus will not open on the camera as changes are made NOTE You can also enter local mode while in the REDmote is IDLE Aperture Focus m Focus ft 9 1 u8cm edin Filter Zoom Sensitivity Exposure Color Temp Format AB SEC U6O00k OK 2 1 A001 C014 jell DEFAULT 0640 s0800 is0 1000 Customizing Available Adjustment Parameters Local also gives you the options to setup what parameters you would like to be able to adjust directly using the REDmote You can assign the parameters to one of the 5 pages of information available under Soft Menu Buttons 4 8 This feature allows you to put similar or frequently used setting together for ease of adjustment NOTE You do not need to be connected either wirelessly or wired to setup the slot assignments To customize parameters 1 Ensure camera is on and wirelessly connected to REDmote 2 Press Soft Menu Button 2 to display LOCAL above Soft Menu Button 2 3 Select the page you would like to set the parameter on Refer to SOFT MENU BUTTONS 4 8 4 Use the directional arrows on the Navigational Control to move the Red c
172. ts Media Settings Power Unpair REDmote Version 2 0 2 116 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE CURRENTLY PAIRED Displays the ID of the REDmote currently paired with the camera UNPAIR REDMOTE When selected will un pair the paired REDmote from the camera MANUAL CHANNEL SELECT The Manual Channel Select option is for the wireless connection to the REDmote You may choose the manually select the desired channel checked or leave as automatic unchecked Auto unchecked will pick the cleanest channel automatically on each camera boot Default is channel 0 GPIO GPIO selects the GPIO preferences sub menu Presets Media Settings Power sync Out CAMERA INPUT Permits the function of the SYNC IN GPI pin in the SYNC connector to be defined as Sync In Accepts an Input Sync signal to control Shutter Start timing Version 2 0 2 117 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE General Purpose In Accepts an Input Trigger signal to act as a General Purpose Input Presets Media Settings Power sme General Purpose In s 5 JEE CAMERA OUTPUT Permits the function of the SYNC OUT GPO pin in the CNTL connector to be defined as Sync Out Provides an Output Sync signal to act as a Shutter Start tally General Purpose Out Provides an Output Tally to act as a General Purpose Output tally signal Presets Media
173. under that parameter then press ENTER adjust with the Scroll Wheel and press ENTER a second time to confirm the value change CAFPs isoB00 2B VABsEc 5600k AK HD 30 32 36 40 48 50 60 72 9B SSS 00 SNe In the above GUI example the Scroll Wheel has been used to move the red cursor to the Shutter Speed parameter and the ENTER key has been pressed This reveals the Parameter Adjust Widow Adjust the value using the Scroll Wheel and then press ENTER to confirm the value change then close the sub menu Version 2 0 2 3 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE LIVE ACTION AREA Contains the recorded image area plus Surround View look around area plus overlays for Frame Guide Safe Action Safe Title and the current Clip Name and Timecode values Each overlay may be color coded in one of 5 colors to maximize the contrast between the guide s and scene being captured A001_C007 15 02 2 1 23 LOWER STATUS ROW The Lower Status Row provides feedback on key systems level camera values includino e Clip Settings e Temperature Power and Sync e Power Status e Exposure Histogram e Media Status e Audio Levels ICON BEHAVIOR TC e TC Gray No analog time code is currently detected e TC Red Analog time code is being detected but the use of it is not enabled e TC Green Analog time code is being used to jam the time of day time code TC will re
174. ure List Open Shutter Speed List Open Color Temp List Open AF AE Record Start Record Stop Toggle SH backlight Menu Up Menu Down Rotary Next Value Rotary Previous Value Set focus mode for still Set focus mode for movie RAW Check Toggle HDR Mode 2011 RED COM INC e Toggle Display Mode e Toggle Color Space e Toggle Zebra 1 Mode e Toggle Zebra 2 Mode e Toggle Zebra 1 2 Mode e Toggle Shutter Mode e Toggle Shutter Angle Abs Rel Mode e Toggle TC Display Mode e Toggle Lens Ring Mode e Toggle Fan Mode e One Shot AF Key Disabled Version 2 0 2 NOVEMBER 18 2011 OPERATION GUIDE DATE TIME This menu allows the user to reset the battery backed up clock of the RED SCARLET X camera These values will be used to timestamp each recording as they are made to the RED MAG 1 8 SSD media Presets Media Settings Power NOTE Enter time in 24 hour clock format i e 2 35 pm should be entered as 14 35 00 COMMUNICATION Communication Menu allows you to set a NAME GROUP TARGET set a SERIAL PROTOCOL ENABLE DHCP C2C or EXT set an IP ADDRESS NETMASK and or GATEWAY This function also allows you to identify the camera NAME With the serial port or a direct link Ethernet cable Via UDP only two cameras or devices can be connected if the camera is connected to a hub or router multiple cameras or devices can communicate Presets Media Settings Power DEFAULT
175. ursor to the desired location to place the parameter 5 Press Soft Menu Button 3 Setup The Setup window will appear on screen Aperture Focus m Zoom u3cm Sone Turn Wireless Off Sis 4K HD Setup System HAITT Version 2 0 2 170 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE 6 Select Setup Slot 7 Anew Setup window will appear displaying available parameters to display Aperture Focus m Zoom Aperture emp Focus m HHP Focus ft Zoom Sensitivity Exposure Color Temp 8 Select the desired parameter and press the Enter button You may now control this parameter directly from the REDmote 3 SETUP When selected will give you the option to turn the Wireless connection ON or OFF or open the Setup System menu screen Available options are REDmote LCD screen brightness REDmote confirmation tone volume and Auto Shutdown time Below those options is the MAC address for the REDmote and setting parameters of the REDmote In particular F indicates the current firmware build of the REDmote Auto Shutdown When set will shut the REDmote down in the specified amount of time when the REDmote is detached from the camera AND the buttons have not been pressed during that time Version 2 0 2 171 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE SOFT MENU BUTTONS 4 8 To the right of the LCD are five 5 Soft Menu buttons 4 8 H These are
176. vert to gray if the signal is no longer detected GEN e GEN Gray No genlock signal is currently detected Version 2 0 2 33 2011 RED COM INC NOVEMBER 18 2011 RED SCARLET X OPERATION GUIDE e GEN Green A genlock signal compatible with the current project and monitor rates has been locked to SYNC e SYNC Gray The sensor sync mode is not Genlock e SYNC Red The sensor sync mode is Genlock but it is not locked to any genlock signal e SYNC Green A genlock signal compatible with the current project and monitor rates has been locked to and the sensor timing is also locked to it POWER STATUS If powering camera through DC power the current voltage will be displayed If using a REDBRICK or similar external battery to power the camera through DC IN power status displays the current supply voltage available from the battery Supply voltage decreases as battery is discharged the displayed text is color coded as follows e Green 12 0 V and up e Yellow 11 9 11 8V e Red 11 7 11 6V NOTE The camera will automatically power down if supply voltage drops to 11 5 Volts If using a REDVOLT battery in the Side Handle to power the camera power status displays the location of the power source example SH Side Handle and reports the of remaining battery capacity and the displayed text is color coded as follows e Green 99 11 e Yellow 10 6 e Red 5 0 If using a RED BRICK battery connected
177. wer Format Media Eject Media 2 Select EJECT MEDIA 3 When media is ejected Viewfinder output s will display MEDIA EJECTED SUCCESSFULLY ao 4 Media can now be removed from the camera Version 2 0 2 145 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE USING SIDE HANDLE 1 By default the lower of the three 8 SYSTEM KEYS is set to Eject Media when pressed 2 When media is ejected Viewfinder output s will display MEDIA EJECTED SUCCESSFULLY a 3 Media can now be removed from the camera USING SIDE SSD 1 Press both User Keys 1 and 2 at the same time to eject REDMAG 1 8 SSD Media 2 When media is ejected Viewfinder output s will display MEDIA EJECTED SUCCESSFULLY cent 3 Media can now be removed from the camera COPYING MEDIA For use when media is connected directly to your computer When copying media it is recommended that you drag the complete RDM folder on the digital magazine to the archive storage media This copies all the media and metadata files You will not need to copy the log magazine profile or presets files but if you do so it will do no harm ERASING MEDIA NOTE If the media was formatted using SECURE FORMAT you cannot erase the media using an external source Erasing of the media must be performed by formatting on the camera MACINTOSH OS X 1 Connect the REDMAG 1 8 SSD via RED STATION REDMAG 1 8
178. wn the camera POWER STATUS The power status is displayed for the BRAIN SIDE HANDLE REAR 1 REAR 2 REAR 3 and REAR 4 Below is what is displayed when the camera is connected to DC power and a REDvolt is installed into the side handle REAR 1 4 denote the battery locations available in the optional QUAD BATTERY MODULE Presets Media Settings Power Version 2 0 2 139 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE SHUTDOWN Power OFF controls are interlocked to prevent accidental powering down of the camera For details on the different ways to power down your RED SCARLET X refer to BASIC OPERATION gt POWER DOWN 1 Enter the Secondary Menu using the touch screen REDmote or Side Handle 2 Select POWER 3 Select SHUTDOWN Presets Media Settings Power 4 The camera will immediately power down displaying SHUTTING DOWN If a REDmote is connected the same message will display shutting Down Version 2 0 2 440 2011 RED COM INC NOVEMBER 18 2011 ET 2X OPERATION GUIDE APPENDIX A UPGRADING CAMERA FIRMWARE RED SCARLET X camera functionality may be upgraded by installing the latest firmware Camera firmware is identified by Version and SVN number which will be displayed by the camera on the LCD display when SYSTEM INFO is selected A higher number reflects a later release Make a habit of frequently visiting to check for later ve
179. y with the following Australian and New Zealand standards e AS NZS CISPR 22 Electromagnetic Interference e AS NZS 61000 3 2 Power Line Harmonics e AS NZS 61000 3 3 Power Line Flicker EUROPEAN UNION COMPLIANCE STATEMENTS RED declares that the radio equipment described in this document comply with the R amp TTE Directive 1999 5 EC issued by the Commission of the European Community Compliance with this directive implies conformity to the following European Norms in brackets are the equivalent international standards e EN 60065 IEC 60065 Product Safety e ETSI EN 300 328 Technical requirement for radio equipment e ETSIEN 301 489 General EMC requirements for radio equipment Version 2 0 2 NOVEMBER 18 2011 2011 RED COM INC RED SCARLET X OPERATION GUIDE INFORMATION Products with the CE marking comply with the EMC Directive 2004 108 EC and the Low Voltage Directive 2006 95 EC issued by the Commission of the European Community Compliance with these directives implies conformity to the following European Product Family Standards e EN 55022 CISPR 22 Electromagnetic Interference e EN 55024 1 CISPR 24 Electromagnetic Immunity e EN 61000 3 2 IEC610000 3 2 Power Line Harmonics e EN 61000 3 3 IEC610000 Power Line Flicker e EN 60065 IEC60065 Product Safety USAGE RESTRICTIONS FOR PRODUCTS THAT INCORPORATE REDLINK Products that fall into this category are denoted by inclusion
180. yback 130 Power 139 Power Status 139 Shutdown 140 APPENDIX A UPGRADING CAMERA FIRMWARE 141 Verify Current Camera Firmware 141 Upgrade Procedure 141 Multiple Cameras 142 APPENDIX B MANAGING DIGITAL MEDIA 143 VC l uuu EE E 143 Formatting Media 143 Media Capacity Remaining S RUIUJSu u u E 144 Eject Media from Camera Unmount 145 Using REDmote Touchscreen LCD 145 Using Side Handle 146 Using Side SSD 146 Copying Media 146 Erasing Media 146 RED SCARLET X OPERATION GUIDE Macintosh OS X 146 Windows 147 APPENDIX C CHARGING BATTERIES srice 148 REDVOL I uuu uuu ninenin 148 Battery LED Array 148 Battery Performance 148 RED Travelcharger 149 Operation 149 Charging Batteries 150 APPENDIX D INPUT OUTPUT CONNECTORS 151 Brain Front 151 MIC 1 MIC 2 Microphone Audio 152 Brain Rear 153 HD SDI uu asaasaassasqstumsusqapch 154 Headphone 155 SYNC Vide

Red Digital Cinema Scarlet X 2.0.2 Operation Guide

Contents

Download Pdf Manuals

Related Search

Related Contents