Home

ECS H61H2-M motherboard

Contents

1. 1 x Parallel port header LPT 1 x CLR CMOS header Introducing the Motherboard System BIOS AMI BIOS with 32Mb SPI Flash ROM Supports Plug and Play STR S3 STD S4 Hardware monitor Multi Boot Supports ACPI amp DMI Audio LAN can be disabled in BIOS F7 hot key for boot up devices option Form Factor Micro ATX Size 244mm x 220mm Motherboard Components Introducing the Motherboard Table of Motherboard Components LABEL COMPONENTS LL CPD Socket LGA1155 socket for oe Generation Intel Core Family Processors CPU_FAN DDR3_1 4 240 pin DDR3 SDRAM slots ATX_POWER SATA1 2 SPI_DEBUG SPI debug header for factory use only SPK COM Onboard serial port header SATA3 4 Serial ATA 3 0 Gb s connectors 0 FLPANEL 1 F_USB1 2 2 CASE 3 ME_UNLOCK 4 F_1394A 5 TPM 6 LPT Printer Header 7 CLR_CMOS 8 SYS_FAN 9 SPDIFO SPDIF out header 0 F_AUDIO LPO 2 PCIF1 3 PCIEX16 4 ATX12V 4 pin 12V power connector This concludes Chapter 1 The next chapter explains how to install the motherboard Chapter 2 Installing the Motherboard Safety Precautions Follow these safety precautions when installing the motherboard Wear a grounding strap attached to a grounded device to avoid dam age from static electricity Discharge static electricity by touching the metal case of a safely grounded object before working on the motherboard Leave components in the sta
2. Description ATI Software Package Version 8 082 041130a Release Date 2005 01 04 Space Required on C 98715 K Space Available on C 6821104 K InstallShield Newt cored 3 Check the box next to the items you want to install The default options are recom mended 4 Click Next run the Installation Wizard An item installation screen appears ATI Software Welcome to the InstallShield Wizard for ATI Software The InstallShield Wizard will install ATI Software on your computer To continue click Next Back Cancel 5 Follow the instructions on the screen to install the items Drivers and software are automatically installed in sequence Follow the onscreen Instructions confirm commands and allow the computer to restart a few times to complete the Installation Using the Motherboard Software 62 Windows Vista 7 will appear below UAC User Account Control message fe after the system restart You must select Allow to install the next driver Continue this process to complete the drivers installation Manual Installation Insert the disk in the DVD ROM CD ROM drive and locate the PATH DOC file in the root directory This file contains the information needed to locate the drivers for your motherboard Look for the chipset and motherboard model then browse to the directory and path to begin installing the drivers Most drivers have a setup program SETUP EXE that automat
3. YNY 19e1uo2o lt Wajqoid pieoq J p p uuo SI e dsip pseog JO nSd YUM uu qo1d sey JOWUOW JI 233u2 punos daag Auy Jamod AZT Nd J ON ON SoA 9949 pue SOND H19 Sah UO p uun1 S YouUMs NSd pue Supo S ASd tun ON pa88njd si p103 Jamod JY on A ddng Jamog 4 49949 yeys 0 s eJ Dd Ng passaid si uonng Jamod JAVYIMO T Sunoous qno4 sIseg 78 Trouble Shooting
4. Version 2 11 1210 Copyright C 2011 American Megatrends Inc Restore AC Power Loss Power Off This item enables your computer to automatically restart or return to its operating status Audio Configuration This item shows the information of the audio configuration Azalia HD Audio Enabled This item enables or disables Azalia HD audio Azalia Internal HDMI codec Enabled This item enables or disables Azaia Internal HDMI codec Case Open Warning Disabled This item enables or disables the warning if the case is opened up and the item below indicates the current status of the case Chassis Opened No This item indicates whether the case has been opened Press lt Esc gt to return to the chipset menu page 47 gt ME Subsystem Scroll to this item and press lt Enter gt to view the following screen Aptio Setup Utility Copyright C 2011 American Megatrends Inc WET a CI Chipset BV8 8 23 WEN T SY cri gt 418 Intel ME Subsystem Configuration ME Subsystem Help ME Version 7 0 4 1197 Select Screen tl Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc ME Version 7 0 4 1197 This item shows the ME version ME Subsystem Enabled This item allows you to enable or disable ME subsystem Press lt Esc gt to return
5. Short Chassis cover is removed Open Chassis cover is closed ME_UNLOCK ME Uniock Header Pin 1 2 Function Open Lock COM Onboard serial port header Connect a serial port extension bracket to this header to add a serial port to your system Pin Signal Name Function SINB SerialInput Ring Indicator Nopin Installing the Motherboard LPT Onboard parallel port Header This is a header that can be used to connect to the printer scanner or other devices Pin Signal Name Ground Ground Ground Ground Ground Ground Ground TPM Optional Trusted Platform Module header Trusted platform module TPM is a published specification detailing a microcontrollerthat can store secured information and implementations of that specification Pin Signal Name Pin Signal Name i VCC3_DUAL SERIRQ LPCPD SMBCLK 2 5 2 i q mm 5 HER EA 7 8 6 CC3 GND 3 2 LREST 9 0 Installing the Motherboard 19 20 Installing a SATA Hard Drive This section describes how to install a SATA Hard Drive About SATA Connectors Your motherboard features four SATA connectors supporting a total of four drives SATA refers to Serial ATA Advanced Technology Attachment is the standard inter face for the IDE hard drives which are currently used in most PCs These connectors are well designed and will only fit in one orientation Locate the SATA connectors on the motherboard and foll
6. 3 3V Power Supply with 5V Tolerant Inputs Introducing the Motherboard Onboard LAN Optional The onboard LAN provides the following features TM 1 Supports PCI Express Integrated 10 100 1000 transceiver Wake on LAN and remote wake up support Supports PCI Express M 1 1 Integrated 10 100 transceiver Wake on LAN and remote wake up support Expansion Options The motherboard comes with the following expansion options One PCI Express x16 slot for Graphic Interface One PCI Express x1 slot Four SATA 3 0 Gb s connectors Integrated I O The motherboard has a full set of I O ports and connectors One PS 2 keyboard and PS 2 mouse connectors One D sub VGA port One DVI port Co Lay HDMI Port Four USB 2 0 ports One RJ45 LAN connector Two USB 3 0 ports USB 2 0 optional Audio jacks 6 ch for microphone line in and line out BIOS Firmware This motherboard uses AMI BIOS that enables users to configure many system features including the following Power management Wake up alarms CPU parameters CPU and memory timing Graphic parameters The firmware can also be used to set parameters for different processor clock speeds 1 Some hardware specifications and software items are subject to change without prior notice 2 Due to chipset limitation we recommend that motherboard be operated in the ambiance between 0 and 50 C Introducing the Motherboard
7. amp Exit ESC Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc Serial Port Enabled This item allows you to enable or disable serial port Device Settings lIO 3F 8h IRQ 4 This item shows the information of the device settings Change Settings Auto Use this item to change device settings Press lt Esc gt to return to the Super IO Configuration page 40 gt Parallel Port Configuration Scroll to this item and press lt Enter gt to view the following screen Aptio Setup Utility Copyright C 2011 American Megatrends Inc Advanced u EI a l EC r STTS W cr We gt LE Parallel Port Configuration Enable or Disable Parallel Port LTP LPTE Device Settings IO 378h IRQ 5 DMA 3 Change Settings Auto Select Screen Device Mode ECP Mode l Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESG Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc Parallel Port Enabled This item allows you to enable or disable parallel port Device Settings lIO 378h IRQ 4 DMA 3 This item shows the information of the device settings Change Settings Auto Use this item to change device settings Device Mode ECP Mode Use this item to select device mode Press lt Esc gt to return to the Super IO Configuration page Press lt Esc gt to return to the Advanced Men
8. give priority to the gray DIMMs DDR3_1 DDR3_3 when installing DIMMs 2 We suggest users not mix memory type It is recommended to use the same brand and type memory on this motherboard Do not remove any memory module from its antistatic packaging until you are ready to install it on the motherboard Handle the modules only by their edges Do not touch the components or metal parts Always wear a grounding strap when you handle the modules Installation Procedure Refer to the following to install the memory modules 1 2 3 This motherboard supports unbuffered DDR3 SDRAM Push the latches on each side of the DIMM slot down Align the memory module with the slot The DIMM slots are keyed with notches and the DIMMs are keyed with cutouts so that they can only be installed correctly Check that the cutouts on the DIMM module edge connector match the notches in the DIMM slot Install the DIMM module into the slot and press it firmly down until it seats correctly The slot latches are levered upwards and latch on to the edges of the DIMM Install any remaining DIMM modules For reference only Installing the Motherboard 13 14 Expansion Slots Installing Add on Cards The slots on this motherboard are designed to hold expansion cards and connect them to the system bus Expansion slots are a means of adding or enhancing the motherboard s features and capabilities With these efficient facilities you can
9. this chapter may help to address some of the common questions using some basic troubleshooting tips a System does not power up and the fans are not running 1 Disassemble the PC to remove the VGA adaptor card DDR memory LAN USB and other peripherals including keyboard and mouse Leave only the motherboard CPU with CPU cooler and power supply connected Turn on again to see if the CPU and power supply fans are running 2 Make sure to remove any unused screws or other metal objects such as screwdrivers from the inside PC case This is to prevent damage from short circuit 3 Check the CPU FAN connector is connected to the motherboard 4 For Intel platforms check the pins on the CPU socket for damage or bent A bent pin may cause failure to boot and sometimes permanent damage from short circuit 5 Check the 12V power connector is connected to the motherboard 6 Check that the 12V power amp ATX connectors are fully inserted into the motherboard connectors Make sure the latches of the cable and connector are locked into place b Power is on fans are running but there is no display 1 Make sure the monitor is turned on and the monitor cable is properly connected to the PC 2 Check the VGA adapter card if applicable is inserted properly 3 Listen for beep sounds If you are using internal PC speaker make sure it is connected a continuous 3 short beeps memory not detected b 1 long beep and 8 short beeps VGA n
10. English UK Englsh UK English US English US Espa ol Spanish Fran ais French Hebrew Italian Japanese Polish Portuguese Russian Ukrainian Vietnamese YkpalHCbka Viet Note The keyboard language selection list offers several more regional keyboard setups to switch with the default English typing Please refer to the usage FAQ for more tips Setting Up evlFFY 66 4 Restart your computer after eJIFFY installation Press lt DEL gt or click the BIOS Setup button on the post screen to enter the BIOS setup page after boot up k ECS mJIFFY Funct Lon 5 And then enter the Advanced Setup page to enable the item ECS eJIFFY Func tion Press F4 to save the configuration and exit Restart your computer EES e eJIFFY Function Note 1 eJIFFY is available in SATA IDE AHCI mode It does not support RAID configuration and the onboard 34 pin floppy drives 2 Please refer to ECS website for new eJIFFY application updates Setting Up eviFFY 67 Entering eJIFFY The post screen appears within several seconds after boot up and it has three buttons Click to enter the normal OS you have installed such as Windows lick to enter eJIFFY OS Click to set the BIOS If you click eJIFFY the following screen will appear And If you make no choice it will enter the normal OS automatically after ten seconds ES ELITEGROUP USA ag Thu Aug 13 9 VAG ge a i Setting Up evlFFY Feature
11. Screen tl Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc ECS eJIFFY Function Disabled This item enables or disables ECS eJIFFY Function Press lt Esc gt to return to the Advanced Menu page 32 PC Health Status On motherboards support hardware monitoring this item lets you monitor the paeameters for critical voltages temperatures and fan speeds Aptio Setup Utility Copyright C 2011 American Megatrends Inc WEE Advanced Re Fr AM m Mum Lele me Cele W d cy K SS 4 PC Health Status CPU Fan Speed 1534 RPM CPU Voltage 1 020V Select Screen DIMM Voltage 1 524V l Select Item VAXG Voltage 0 972V Enter Select IMC Voltage 1 044V Change Opt F1 General Help F2 Previous Values PECI Mode F3 Optimized Defaults Offset to TCC Activation Temp ASAREE ESC EXit Version 2 11 1210 Copyright C 2011 American Megatrends Inc gt Smart Fan Function Scroll to this item and press lt Enter gt to view the following screen Aptio Setup Utility Copyright C 2011 American Megatrends Inc Advanced W AA A I CT ETT W sr A A SMART Fan Mode Normal SMART Fan start PWM value 180 SMART Fan start PWM TEMP 30 E s Del p tl Select Item Enter Select Change Opt F1 General Help F2 Previous Va
12. Setup Utility Copyright C 2011 American Megatrends Inc Main FG ES Mmm od lI TE BEN SEN Xoo MS XK eZ La Save amp Exit BIOS Information Choose the system default language System Data Wed 02 23 2011 System Time 03 32 25 Select Screen 1 Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc Resetting the Default CMOS Values When powering on for the first time the POST screen may show a CMOS Settings Wrong message This standard message will appear following a clear CMOS data at factory by the manufacturer You simply need to Load Default Settings to reset the default CMOS values Note Changes to system hardware such as different CPU memories etc may also trigger this message American Megatrends H61H2 4 Release 10 13 2010 Version 2 02 1205 Copyright C 2010 American Hegatrends Inc Press lt F7 gt to enter BBS POPUP Press lt DEL gt or lt F2 gt to enter setup CMOS Settings Wrong Using BIOS When you start the Setup Utility the main menu appears The main menu of the Setup Utility displays a list of the options that are available A highlight indicates which option is currently selected Use the cursor arrow keys to move the highlight to other options When an option is highlighted execute the option by pressing lt En
13. Use this item to enable or disable support for legacy USB devices Setting to Audio allows the system to detect the presence of the USB device at startup If detected the USB controller legacy mode is enabled If no USB device is detected the legacy USB support is disabled Press lt Esc gt to return to the Advanced Menu page 39 Super IO Configuration Use this item to show the information of the Super IO Configuration Aptio Setup Utility Copyright C 2011 American Megatrends Inc Advanced Keii A a o ES A SNE AA Super IO Configuration Set Parameters of Serial Port 0 COMA Super IO Chip IT8728 p Parallel Port Configutation Select Screen tl Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESGC Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc Super IO Chip IT8728 This item shows the information of the super IO chip gt Serial Port 0 Configuration Scroll to this item and press lt Enter gt to view the following screen Aptio Setup Utility Copyright C 2011 American Megatrends Inc VELES Advanced Re FI aan AM 2 Mumm Lele NTT W amy K SS u Serial Port 0 Configuration Enable or Disable Serial Port COM Device Settings 1IO 3F 8h IRQ 4 Change Settings Auto F s ee Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save
14. achieve better airflow rates and heat dissipation we suggest fe that you use a high quality fan with 3800 rpm at least CPU fan and heatsink installation procedures may vary with the type of CPU fan heatsink supplied The form and size of fan heatsink may also vary 2 DO NOT remove the CPU cap from the socket before installing a CPU 3 Return Material Authorization RMA requests will be accepted only if the motherboard comes with the cap on the LGA1155 socket Installing Memory Modules This motherboard accommodates four memory modules It can support four 240 pin DDR3 1333 1066 The total memory capacity is 16 GB DDR3 SDRAM memory module table Memory module Memory Bus DDR3 1066 533 MHz DDR3 1333 667 MHz You must install at least one module in any of the four slots Total memory capacity is 16 GB The four DDR3 memory sockets DDR3 1 DDR3 2 DDR3 3 and DDR3 4 are divided into two channels and each channel has two memory sockets as following gt gt Channel A DDR3 1 DDR3 2 gt gt Channel B DDR3 3 DDR3 4 Recommend memory configuration Sockets Soke omm Poa T 2DIMMs Populated Populated Populated Populated Populated Populated Single Side Single Side Single Side Single Side 4 DIMMs fe When insert 4 DIMM single side memory it may run at DDR3 1066 Installing the Motherboard 1 For best performance and compatibility we recommend that users
15. connected to the SCSI hard drive activity LED connector Power Sleep Message waiting LED Connecting pins 2 and 4 to a single or dual color front panel mounted LED provides power on off sleep and message waiting indication Reset Switch Supporting the reset function requires connecting pin 5 and 7 to a momentary contact switch that is normally open When the switch is closed the board resets and runs POST Power Switch Supporting the power on off function requires connecting pins 6 and 8 to a momen tary contact switch that is normally open The switch should maintain contact for at least 50 ms to signal the power supply to switch on or off The time requirement is due to internal de bounce circuitry After receiving a power on off signal at least two seconds elapses before the power supply recognizes another on off signal This concludes Chapter 2 The next chapter covers the BIOS 26 Installing the Motherboard Chapter3 Using BIOS About the Setup Utility The computer uses the latest American Megatrends Inc BIOS with support for Windows Plug and Play The CMOS chip on the motherboard contains the ROM setup instructions for configuring the motherboard BIOS The BIOS Basic Input and Output System Setup Utility displays the system s configuration status and provides you with options to set system parameters The parameters are stored in battery backed up CMOS RAM that saves this information when the power
16. link you can select the icon P 54 and press the right key of your mouse 1 Show the networking connection status 2 If you want to set the networking connection you can press the right key of your mouse to edit it Setting Up evlFFY 72 Stepl Select the icon press the right key of your mouse then select Edit 39 Connection item Enable Networking Connection Information Edit Connections JSF Thu Aug 13 12 53AM Step2 Select the connection you want eg Wired and click Add button Connection name Auto etho W Connect automatically Wired 802 1x Security 1Pv4 Settings IPv6 Settings it Wired yy Wireless i gt DSL Method Automatic DHCP Name Last Used Addresses Auto eth0 never i Delete Types of connections 1 Wired connection Connection name 6 ii Connect automatically um bytes Setting Up eJiFFY 73 2 Wireless connection Editing Wireless connection 1 x Connection name W Connect automatically Fi 3 DSL connection Editing DSL connection 1 Note Details about eJIFFY please refer to eJIFFY in disk Setting Up esiFFY 74 Setting Up evlFFY Chapter 6 Trouble Shooting Start up problems during assembly After assembling the PC for the first time you may experience some start up problems Before calling for technical support or returning for warranty
17. location Display devices E 2 Control Panel AIl Control Panel Items gt Display Screen Resolution Search Control Panel Change the apprearance of your displays Detect Identify Display m Resolution 1920x 1200 recommended Orientation Landscape Multiple displays C Extend desktop to this display This is currently your main display Advance settings Make text and other items larger or smaller What display settings should choose Cancel Apply The type of the display Set the multiple displays 2 Select display devices set the multiple displays option and to extend destop for display Multi Monitor technology i pq ey gt Control Panel gt All Control Panel Items gt Display Screen Resolution Search Control Panel Change the apprearance of your displays Tobi Identify Display 3 DELL U2410 Resolution 1920x 1200 recommended Orientation Landscape Multiple displays Disconnect this display Extend desktop to this display A You must select Disconnect this display Make this my main alsplay Advance settings Make text and other items larger or smaller What display settings should choose Cancel Apply 45 m E S Control Panel gt All Control Panel Items gt Display gt Screen Resolution cS Search Control Panel Change the apprearance of your displays m Detect Identify Display 4 AL1717 Y Resolution 1920 x 1200 re
18. processor socket which may be damaged if the cooling fan is carelessly installed Avoid using cooling fans with sharp edges on the fan casing and the clips Also install the cooling fan in a well lit work area so that you can clearly see the motherboard and processor socket Before installing the Processor This motherboard automatically determines the CPU clock frequency and system bus frequency for the processor You may be able to change the settings in the system Setup Utility We strongly recommend that you do not over clock processors or other components to run faster than their rated speed Warning 1 Over clocking components can adversely affect the reliability of the system and introduce errors into your system Over clocking can perma nently damage the motherboard by generating excess heat in components that are run beyond the rated limits 2 Always remove the AC power by unplugging the power cord from the power outlet before installing or removing the motherboard or other hardware components This motherboard has an LGA1155 socket When choosing a processor consider the performance requirements of the system Performance is based on the processor design the clock speed and system bus frequency of the processor and the quantity of internal cache memory and external cache memory Fail Safe Procedures for Over clocking When end users encounter failure after attempting over clocking please take the following steps to
19. Configuration F3 Optimized Defaults p USB Configuration F4 Save amp Exit p Super IO Configuration ESG Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc Launch PXE OpROM Disabled Use this item to enable or disable the PXE OpROM Launch Storage OpROM Enabled Use this item to enable or disable the Storage OpROM IEE 1394 Controller Enabled This item allows you to enable or disable the IEE 1394 Controller Using BIOS 31 LAN Configuration The item in the menu shows the LAN related information that the BIOS automatically detects Aptio Setup Utility Copyright C 2011 American Megatrends Inc VEE Advanced Weil al l Mem Lele Soa L EST WK A LAN Configuration Enable Disable Onboard LAN Controller Select Screen tl Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ES Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc Onboard LAN Controller Enabled Use this item to enable or disable the Onboard LAN Press lt Esc gt to return to the Advanced Menu page ECS eJIFFY Function Scroll to this item and press lt Enter gt to view the following screen Aptio Setup Utility Copyright C 2011 American Megatrends Inc Advanced suls Eras Aa 0 mm Lele ETIS W Ar dL ECS eJIFFY Function Make sure that the eJIFFY has been installed to hard disk Select
20. Icons The following illustration shows the main feature icons that eJIFFY provides on the menu eWeb Firefox for web browsing webmail and watching flash video ePix Photo viewing ePal On line chat tool to use the most popular IMs in the world MSN ICO AIM etc Shows ePal on line connection status Shut Down Restart Ends your session and turns off the computer Ends your session and restart the computer Shows the network connection status Click once to connect the storage disk to your computer Click for the second time to remove your storage disk safely please refer to the FAQ for more usage information Language Control Panel Switch Keyboard Languages Allows you to adjust the sound volume level from mute to the max Setting Up ejiFFY 69 Usage FAQ Language Control Panel Besides setting English as the default interface e IFFY offers multi language displays and keyboard settings for language switch Open the language control panel to select a preferable language setting Keyboard Language Setup Step1 Click to open the language control panel PED rou Method Setup a Display Language Boroa Language ejJiFFY v2 0 35 Step 2 Click Keyboard Language icon to open the keyboard selection list which offers several regional keyboard settings besides default English keyboard Step 3 Click the selected keyboard language e g English US and press OK Key
21. Optimized Defaults F4 Save amp Exit ESC Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc ICC Over Clocking Lib Version 7 0 0 29 This item shows the ICC over clocking lib version Number of ICC Profiles N A This item shows number of ICC profiles Current ICC Profiles Index N A This item shows current ICC profiles index ICC Enable Disabled This item allows you to enable or disable current ICC Press lt Esc gt to return to the M I B III menu page Using BIOS 49 50 gt Performance Tunning Scroll to this item to view the following screen Aptio Setup Utility Copyright C 2011 American Megatrends Inc EI pa AYE LAKO e Kedi Era M I B Ill Ee dmmmesy vel0 EEE SS 4 Performance Tuning sr p Chipset Configuration Select Screen tl Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc gt CPU Configuration Scroll to this item to view the following screen Aptio Setup Utility Copyright C 2011 American Megatrends Inc Main Advanced Chipset Boot Security Save amp Exit IA Core Current CPU Ratio 31 Power Limit 1 Value Watt 95 Power Limit 2 Switch Enabled Power Limit 2 Value 118 Select Screen Long duration Maintained 1 I Select Item Enhanced Intel SpeedStep Technolo
22. Preface Copyright This publication including all photographs illustrations and software is protected under international copyright laws with all rights reserved Neither this manual nor any of the material contained herein may be reproduced without written consent of the author Version 1 0 The information in this document is subject to change without notice The manufac turer makes no representations or warranties with respect to the contents hereof and specifically disclaims any implied warranties of merchantability or fitness for any particular purpose The manufacturer reserves the right to revise this publication and to make changes from time to time in the content hereof without obligation of the manufacturer to notify any person of such revision or changes Trademark Recognition Microsoft MS DOS and Windows are registered trademarks of Microsoft Corp MMX Pentium Pentium II Pentium III Celeron are registered trademarks of Intel Corporation Other product names used in this manual are the properties of their respective owners and are acknowledged This equipment has been tested and found to comply with the limits for a Class B digital device pursuant to Part 15 of the FCC Rules These limits are designed to provide reasonable protection against harmful interference in a residential installa tion This equipment generates uses and can radiate radio frequency energy and if not installed and used in accordance with th
23. Rd Wr command to the same bank RAS Active Time tRAS 20 This item specifies the RAS active time Intel Graphics Configuration This item shows the information of Intel Graphics Configutation GT OverClocking Disabled This item allows you to control the internal GFX Turbo mode Press lt Esc gt to return to the Performance Tunning page Press lt Esc gt to return to the M I B III menu page Using BIOS B O M P Technology Enabled This item allows users to enable or disable B O M P technology This function can run safe setting to setup menu when system boot fail 3 times Auto Detect DIMM PCI Clk Enabled When this item is enabled BIOS will disable the clock signal of free DIMM PCI slots Spread Spectrum Enabled If you enable spread spectrum it can significantly reduce the EMI Electro Magnetic Interference generated by the system Command Rate Auto This item allows users to set command rate Genuine Intel R CPU 0 2 40GHz This is display only field and displays the information of the CPU installed in your computer Processor Speed 2400MHz This item shows the CPU speed Total Memory 2048MB DDR3 1066 This item shows the total momery of DDR3 CPU Current Voltage 1 020V This item diplays the CPU current voltage VAXG Voltage 1 044V This item displays the current VAXG voltage VDIMM 1 524V This item displays the current VDIMM voltage Using BIOS J3 54 Boot Menu This pa
24. Specifications CPU LGA1155 socket for latest 2 Generation Intel Core Fam ily processors Supports Hyper Threading technology CPU Chipset Intel H61 Chipset Memory Dual channel DDR3 memory architecture 4 x 240 pin DDR3 DIMM sockets support up to 16 GB Supports 1333 1066 DDR3 SDRAM Expansion 1 x PCI Express x16 Gen2 slot Slots 1 x PCI Express x1 Gen2 slot 2 x PCI slots Storage Supported by Intel H61 Express Chipset 4 x Serial ATA 3 0 Gb s devices Audio VIA VT1705 6 Ch HD audio CODEC Compliant with HD audio specification LAN Atheros AR8151 Gigabit Lan Co lay Atheros AR8152 10 100 LAN Rear Panel I O 1 x PS 2 keyboard and PS 2 mouse connectors 1 x D sub VGA port 1 x DVI port Co Lay HDMI Port 4 x USB 2 0 ports 1 x RJ45 LAN connector 2 x USB 3 0 ports USB 2 0 optional Audio Jacks 6 ch for microphone line in and line out Internal I O 1 x 24 pin ATX Power Supply connector Connectors amp 1 x 4 pin 12V Power connector Headers 1 x 4 pin CPU FAN connector 1 x 3 pin SYS FAN connector 1 x Frant Panel audio header 1 x Frant Panel switch LED header 1 x Speaker header 1 x SPDIF out header 4 x Serial SATA 3Gb s connectors 1 x 1394 header Optional 2 x USB 2 0 headers support additional four USB 2 0 ports F USBI support EZ charger 1 x Chassis intrusion header 1 x TPM header 1 x Serial port header COM
25. T stalline Hard Waiorea 10 Installine the PrOCESSOR sisien nearr a E 10 Installing Memory Modules 12 EXPOS ORM OLOS oni uu usapu kamuaasassauhakaqkasanysaytauawqatanasahuspasthqs 14 Connecting Optional Devices 16 Installing a SATA Hard Drive 20 Connect VO T evieeau uuu u u nanna aE ae 2l Connecting Case Components 22 POUL h ACAI dances sax N EA 25 Chapter 3 21 Using BIOS 21 About the Setup Utilify u LU uaaasastasseqawaaskaqa 2i The Standard Configuration a r 27 Entering the Serup OTLB CS uuu sarasssasatiqaswasqushaqqasaqaqaawaa qaqaqa 27 Resetting the Default CMOS IJalues 28 Ue BI L una AE EE EA 28 BIOS Navigation Key aou aaa aayqa q qaqas u q asw aaaaaaus 29 VEIT u E REE E sas ulna asa anasu 29 Advanced Menisin eie a anie arik 30 CHIPSET M NU aoa stores sata a SAE notions 41 M L B HI MB Intelligent Bios III Mentu 48 Boot Mehut asas qusa asa aaa usasqa asqa qaa qasa qasa 54 ii E hI fO Come Re RPE ECR SE Te Reo Pe IARAA naat 55 DOVE Ce MENU uuu aksu swasyasyasykawqaytayakwawaspwsyiqaawawaqacaawqkaoska 56 Up aline THC DOS u usasiasqasasssqstataqcsiaqasahasapaqayaehasqasqhaqhqka py Chap
26. T Mode This item allows you to select the DVMT operating mode DVMT FIXED Memory 256MB When set to Fixed Mode the graphics driver will reserve a fixed position of the system memory as graphics memory according to system and graphics requirements 42 IGD Multi Monitor Disabled This item enables or disables IGD Internal Graphics device multi monitor Press lt Esc gt to return to the chipset menu page Multi Monitor technology Multi Monitor technology can help you to increase the area available for programs running on a single computer system through using multiple display devices It is not only to increase larger screen viewing but aslo to improving personal productivity Intel Integrated Graphics PCI Express Graphics Please note that Multi Monitor technology supports up to four monitors one or two Intel integrated Graphics and one or two PCI Express graphics devices under Windows 7 Step 1 Insert ECS drives DVD to run Auto setup or browse the DVD to install Intel chipset drivers VGA and sound drivers If you want know the detail information please refer to chapter 4 Drivers Z Utilities Information ESS ELITEGROUP Mainboard H61H2 M BIOS Yersion 10722710 Driver CD Yersion DYD 2 01 Using BIOS 43 Step 2 Install all the drivers of PCI Express graphic cards Click the Browse CD item then appears the following screen Select the driver you want to install e g NVIDIA GeForce 8400 GS Mic
27. T Save amp Exit BIOS Information Choose the system default language System Data Wed 02 23 2011 System Time 03 32 25 Select Screen 1 Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESG Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc 30 Multi Language BIOS Multi language BIOS allows you to see and set up the BIOS with your native language It helps Non English users to solve the problem of setting up the BIOS and achieve extra system performance easily Date amp Time The Date and Time items show the current date and time on the computer If you are running a Windows OS these items are automatically updated whenever you make changes to the Windows Date and Time Properties utility Advaned Menu The Advanced menu items allow you to change the settings for the CPU and other system Aptio Setup Utility Copyright C 2011 American Megatrends Inc WEES Advanced sura qm MA 0 Mmm e Mame e10 101 CE W K S gt u Legacy OpROM Support Enable Disable Onboard LAN Option ROM Launch Storage OpROM Enabled IEEE 1394 Controller Enabled gt LAN Configuration Select Screen P ECS eJIFFY Function tl Select Item p PC Health Status Enter Select gt Power Management Setup Change Opt gt ACPI Settings F1 General Help p CPU Configuration F2 Previous Values p SATA
28. T r SEK Ol a1 Ia BB 0 IS r ETTI dl Save amp Exit Exit system setup after saving Discard Changes and Exit the changes Save Changes and Reset Discard Changes and Reset Select Screen Save Options l Select Item Save Changes Enter Select Discard Changes Change Opt F1 General Help Restore Defaults F2 Previous Values Save as User Defaults F3 Optimized Defaults Restore User Defaults F4 Save amp Exit ESC Exit Boot Override Version 2 11 1210 Copyright C 2011 American Megatrends Inc Save Changes and Exit This item enables you to save the changes that you have made and exit Discard Changes and Exit This item enables you to discard any changes that you have made and exit Save Changes and Reset This item enables you to save the changes that you have made and reset Discard Changes and Reset This item enables you to discard any changes that you have made and reset Save Options This item enables you to save the options that you have made Save Changes This item enables you to save the changes that you have made Discard Changes This item enables you to discard any changes that you have made Restore Defaults This item enables you to restore the system defaults Save as User Defaults This item enables you to save the changes that you have made as user defaults Restore User Defaults This item enables you to restore user defaults Boot Override Use this item to select th
29. amed README TXT or something similar This file may contain important information to help you install the software correctly Some software is installed in separate folders for different operating systems In installing the software execute a file named SETUP EXE by double clicking the file and then following the instructions on the screen The EXIT button closes the Auto Setup window Utilities Lists the software utilities that are available on the disk Information Displays the path for all software and drivers available on the disk Running Setup Follow these instructions to install device drivers and software for the motherboard 1 Click Setup The installation program begins s date Sasu Package stiente Varulaa 2 00 MT i H61H2 M Antosetup Program Mainboard ID Auto Seleg Package soltware Version 2 00 0011 wick te the neta heck d on Aabeli The Iraia ehi ied el rial iho on pm ampie Tis corre chh Hes fy The following screens are examples only The screens and driver lists will be different according to the motherboard you are installing The motherboard identification is located in the upper left hand corner Using the Motherboard Software 61 2 Click Next The following screen appears Auto Setup Package software Version 2 00 0018 Select Features Choose the features Setup will install Select the features you want to install clear the features you do not want to install 62540 K
30. an Megatrends Inc Main Advanced Chipset M I B Il Boot Security Save amp Exit Disabled Enabled GT Memory Multiplier Configuration OverClocking Memory Multiplier 10 67 Memory Timing Configuration Select Screen 1 Select Item CAS Latency tCL Enter Select Row Precharge Time tRP Value RAS to CAS Delay tRCD F1 General Help RAS Active Time tRAS F2 Previous Value F3 Optimized Defaults Intel Graphics Configuration F4 Save amp Exit ESC Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc Memory Multiplier Configuration This item shows the information of Memory Multiplier Configuration Memory Multiplier 10 67 This item determines the operation of DDR SDRAM memory CAS colulmn address strobe It is recommanded that you leave this item at the default value The 2T setting requires faster memory that specifically supports this mode Using BIOS 52 Memory Timing Configuration This item shows the information of Memory Timing Configuration CAS Latency tcl 7 This item determines the operation of DDR SDRAM memory CAS colulmn address strobe It is recommanded that you leave this item at the default value The 2T setting requires faster memory that specifically supports this mode Row Precharge Time tRP 7 This item specifies Row precharge to Active or Auto Refresh of the same bank RAS to CAS Delay tRD 7 This item specifies the RAS to CAS delay to
31. board language English US Arabic 1l German Deutsch English UK English US Spanish Espa ol French Fran ais Hebrew n ay Italian Italiano Japanese A438 Dutch Nederlandse Polish Polska Portuguese Portugu s Russian Pycckun Turkish Turkce Ukrainian YKpaiHcbKa Vietnamese Vi t Setting Up evlFFY v FrontEnd The installed input method services Global Setup Enable Hotkeys Filters v IMEngine Global Setup b b Anthy b b b Japanese Korean Chewing Thai Smart Pinyin Chinese simplified Generic Table Chinese traditional v Panel b Other GTK amp lt lt lt lt lt lt Select Filters Edit Hotkeys You can enable disable input methods and set hotkeys for input methods here File Edit View History Bookmarks Jools Help Ao BE D 28 rtp googte com teysearchtq ECS hie ut Bhoe utt Sheq thrls com ub Em Most Visited BM Be EE nE BOE HHI ome ME eae 1 Google ECS By 170 000 000 TAREA HN p 113 h ee ECS Web Site muH 8 Move your mouse pointer on E3 14 Jul 2010 Meghaepoards desktop and mobie PCs peiphests ana viet he text box and press wacom p BA HEP m Dominas Socket T75 Ctri Space The language eT Mianen Graphics Cord ate ii bar will then appear as fol SENAT Latest EOSrEybetiManual Products lows TEM scn cim ba MIREA s eee HA ECS Web Site BSWGLA REH AOE Ee ee G
32. commended Y Orientation Landscape v Multiple displays Disconnect this display Y A Youmust select Apply before making additional changes Make this my main display Advance settings Make text and other items larger or smaller What display settings should choose Cancel Apply eal X ond gt Control Panel gt All Control Panel Items Display Screen Resolution Search Control Panel Change the apprearance of your displays co B Display 4 AL1717 Y Resolution 1920 x 1200 recommended Orientation Landscape v Multiple displays Extend desktop to this display A Youmust select Apply before making additional changes Make this my main display Advance settings Make text and other items larger or smaller What display settings should choose Cancel Apply 46 p South Bridge Scroll to this item and press lt Enter gt to view the following screen Aptio Setup Utility Copyright C 2011 American Megatrends Inc WET aC YGS Chipset BAe 8 Mumm sole E W d cr WY A gt u South Bridge Specify what state to go to when power is re applied after a power failure G3 state Audio Configuration Azalia HD Audio Enabled Select Screen Azalia Internal HDMI codec Enabled 1 Select Item Enter Select Case Open Warning Disabled Change Opt Chassis Opened No F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit
33. disable the maximum CPUID value limit When supports Prescott and LGA775 CPUs enables this to prevent the system from rebooting when trying to install Windows NT 4 0 Excute Disable Bit Enabled This item allows the processor to classify areas in memory by where application code can execute and where it cannot When a malicious worm attempts to insert code in the buffer the processor disables code execution preventing damage or worm propa gation Replacing older computers with Execute Disable Bit enabled systems can halt worm attacks reducing the need for virus related repair Intel Virtualization Technology Enabled When disabled a VMM cannot utilize the additional hardware capabilities provided by Vandor Pool Technology Power Technology Energy Efficient Use this item to control the Energy mode of the processor Press lt Esc gt to return to the Advanced Menu page Using BIOS 37 SATA Configuration Use this item to show the mode of serial SATA configuration options Aptio Setup Utility Copyright C 2011 American Megatrends Inc VELE Advanced Kolei Aal Mum ele ETTI 8 EST E A u SATA Configuration 1 IDE Mode 2 AHCI Mode Serial ATA Controller 0 Compatible Serial ATA Controller 1 Enhanced SATA Port1 Not Present SATA Port2 Not Present Select Screen SATA Port3 Not Present Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized D
34. e boot device Using BIOS Updating the BIOS You can download and install updated BIOS for this motherboard from the manufacturer s Web site New BIOS provides support for new peripherals improve ments in performance or fixes for known bugs Install new BIOS as follows 1 If your motherboard has a BIOS protection jumper change the setting to allow BIOS flashing If your motherboard has an item called Firmware Write Protect in Ad vanced BIOS features disable it Firmware Write Protect prevents BIOS from being overwritten Prepare a bootable device or create a bootable system disk Refer to Windows online help for information on creating a bootable system disk Download the Flash Utility and new BIOS file from the manufacturer s Web site Copy these files to the bootable device Turn off your computer and insert the bootable device in your com puter You might need to run the Setup Utility and change the the boot priority items on the Advanced BIOS Features Setup page to force your computer to boot from the bootable device first At the C or A prompt type the Flash Utility program name and the file name of the new BIOS and then press lt Enter gt Example AFUDOS EXE 040706 ROM When the installation is complete remove the bootable device from the computer and restart your computer If your motherboard has a Flash BIOS jumper reset the jumper to protect the newly installed BIOS from being overwritten The co
35. e following features Accommodates latest 24 Generation Intel Core Family processors Supports Hyper Threading technology CPU One PCI Express x16 Gen2 port supporting up to 5 GB s direction peak bandwidth Hyper Threading technology enables the operating system into thinking it s hooked up to two processors allowing two threads to be run in parallel both on separate logical processors within the same physical processor Chipset The Intel H61 Chipset is a single chip with proven reliability and performance Support one PCI Express x1 slot Integrated four SATA 3 0 Gb s Host Controller Eight USB 2 0 ports supported Serial Peripheral Interface SPI support Integrated Graphics Support with PAVP 1 5 Intel High Definition Audio Controller Memory Supports DDR3 1333 1066 DDR3 SDRAM with Dual channel architec ture Accommodates four unbuffered DIMMs Up to 4 GB per DIMM with maximum memory size up to 16 GB Audio 5 1 2 Channel High Definition Audio Codec Meets Microsoft WLP3 x Windows Logo Program audio requirements All DACs supports 44 1k 48k 96k 192kHz sample rate Software selectable 2 5V 3 2V 4 0V VREFOUT Direct Sound 3D compatible Power Support Digital 3 3V Analog 5 0V 1394a Firewire Optional Compliant with single chip host controller for IEEE Std 1394 1955 and IEEE 1394a 2000 Integrated 400 Mb s 2 Port PHY for the PCI BUS
36. e instructions may cause harmful inter ference to radio communications However there is no guarantee that interference will not occur in a particular installation If this equipment does cause harmful interference to radio or television reception which can be determined by turning the equipment off and on the user is encouraged to try to correct the interference by one or more of the following measures Reorient or relocate the receiving antenna Increase the separation between the equipment and the receiver Connect the equipment onto an outlet on a circuit different from that to which the receiver is connected Consult the dealer or an experienced radio TV technician for help Shielded Interconnect cables and a shielded AC power cable must be employed with this equipment to ensure compliance with the pertinent RF emission limits governing this device Changes or modifications not expressly approved by the system s manu facturer could void the user s authority to operate the equipment Preface Declaration of Conformity This device complies with part 15 of the FCC rules Operation is subject to the following conditions This device may not cause harmful interference This device must accept any interference received including interfer ence that may cause undesired operation Canadian Department of Communications This class B digital apparatus meets all requirements of the Canadian Interference causing Equip
37. ect audio devices The first jack is for stereo line in singal The second jack is for stereo line out singal The third jack is for microphone Installing the Motherboard 22 Connecting Case Components After you have installed the motherboard into a case you can begin connecting the motherboard components Refer to the following O O1 Q Connect the CPU cooling fan cable to CPU_FAN Connect the standard power supply connector to ATX_POWER Connect the case switches and indicator LEDs to the F_PANEL Connect the system cooling fan connector to SYS_FAN Connect the auxiliary case power supply connector to ATX12V Connect the case speaker cable to SPK ATX42V CID CPU_FAN CJC ATX_POWER Wx et nee SPK je SYS_FAN F_PANEL Connecting 24 pin power cable The ATX 24 pin connector allows you to connect to ATX v2 x power supply With ATX v2 x power supply users please note that when installing 24 pin power cable the latches of power cable and the ATX match perfectly T T 24 pin power cable Installing the Motherboard Connecting 4 pin power cable The ATX12V4P power connector is used to provide power to the CPU When installing 4 pin power cable the latches of power cable and the ATX12V4P match perfectly 4 pin power cable CPU_FAN CPU cooling FAN Power Connector Pin Signal Name Function System Ground Power I2V 4 PNM PWM _ Users please note that the
38. ect the front mounted ports to the motherboard Unlike F USB2 in this mainboard F USB1 supports EZ Charger technology pro vides 3 times current than general USB port in off mode for USB devices It is useful and excellent especially for the iPhone iPad and iPod touch devices that need a large amount of current for faster recharging within less time Pin Signal Name Function Front Panel USB Power USBPWR Front Panel USB Power SB_FP_ P0 USB Port 0 Negative Signal SB_FP_P1 USB Port 1 Negative Signal USB_FP_P0 USB Port 0 Positive Signal G U U USB Port 1 Positive Signal ND e Nopin Not connected Please make sure that the USB cable has the same pin assignment as 8 indicated above A different pin assignment may cause damage or system hang up F_1394A Front 1394 header Optional Connect this header to any device with IEEE 1394a interface Pin Signal Name Pin Signal Name 3 Gp NCS Cable Power KEN Cable Power Installing the Motherboard 17 18 SPDIFO SPDIF out header This is an optional header that provides an SPDIFO Sony Philips Digital Interface output to digital multimedia device through optical fiber or coaxial connector Pin Signal Name 1 SPDIFOUT vcc ap CASE Chassis Intrusion Detect Header This detects if the chassis cover has been removed This function needs a chassis equipped with instrusion detection switch and needs to be enabled in BIOS Pin 1 2 Function
39. een ECS WTAE E fishes gi Se Se E EA cok A COT m ECS WebGenio asco Meni Ded BHS Mig l l e Electrochemical 5 Lorene The Society bor Gobd State and Eleckrounemied science ara Ta waww ntecirochom nay i MAAE Click the language bar here ECS Web Site fete Release Ina Gaming Powar Dy Unbaliavitse Overtiotxing Capabiies ECS launches Black GTX 460 gmptics card family for performance tesined gamers wees com B EET IK MAF ECS Inc Intemational Manutacturer ot Frequency Canteal Done Phew fer ae oe TS Select your desired Korean language Russian Thai Chinese simplified Chinese traditional Other English Keyboard Setting Up evlFFY 71 How to change display language Open the Language Control Panel and click to show the display language list Check your desired display language Your selected display language will be applied after rebooting Display Language English US cance ox Arabic c1l German Deutsch English UK English US Spanish Espa ol French Fran ais Hebrew n ay Indonesian Indonesia Italian Italiano Japanese R Korean 713 Dutch Nederlandse Polish Polska Portuguese Portugu s Russian PyccKW Thai lns Turkish Turkce Ukrainian YKpaiHcbKa Vietnamese Vi t Simplified Chinese PX Traditional Chinese 42722 How to set networking connection If you do not have IP shared server direct
40. efaults F4 Save amp Exit ESG Exit SATA Port4 Not Present Version 2 11 1210 Copyright C 2011 American Megatrends Inc SATA Mode IDE Mode Use this item to select SATA mode Serial ATA Controller 0 1 Compatible Enhanced Use this item to select the Serial ATA cotroller options Disabled Compatible En hanced SATA Port 1 4 Not Present This motherboard supports four SATA channel and each channel allows one SATA device to be installed Use these items to configure each device on the SATA channel Press lt Esc gt to return to the Advanced Menu page 38 USB Configuration Scroll to this item and press lt Enter gt to view the following screen Aptio Setup Utility Copyright C 2011 American Megatrends Inc VEE Advanced eii A l Mm Lele ESAT A EST WV A USB Configuration Enabled Disabled All USB Devices USB 3 0 Controller Enabled Legacy USB Support Enabled Select Screen l Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESG Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc All USB Devices Enabled Use this item to enable or disable all USB devices USB 3 0 Controller Enabled Use this item to enable or disable USB 3 0 controller We recommand users keep the default value Diabling it might cause the USB devices not to work properly Legacy USB Support Enabled
41. fan connector supports the CPU cooling fan of 1 1A 2 2A 26 4W max at 12V SYS_FAN System Cooling FAN Power Connector Pin Signal Name Function Power I2V ATX_POWER ATX 24 pin Power Connector Pin Signal Name Pin Signal Name A a SON s o 7 e 6 sv 8 Goma 7 Ground 19 Ground pm a a KEE E waw es o o Installing the Motherboard 23 24 ATX12V ATX 12V Power Connector Pin Signal Name ao Ea 5 ta q ow SPK Internal speaker _ Pin Signal Name _ 1 ve 2 Ky A Sm Installing the Motherboard 25 Front Panel Header The front panel header F_ PANEL provides a standard set of switch and LED headers commonly found on ATX or Micro ATX cases Refer to the table below for informa tion F_PANEL Pin Signal Function Pin Signal Function HD_LED_P Hard disk LED 2 FP PWR SLP MSG LED 3 HD LED_N HarddiskLED 4 FP PWR SLP MSG LED RST_SW_N _SW_N Reset Switch 6 PWR_ PWR_SW_P P Power Switch Bee RST_SW_P Reset Switch eae PWR_SW_N Power Switch o RSVD Resend Ni MSG LED dual color or single color Hard Drive Activity LED Connecting pins 1 and 3 to a front panel mounted LED provides visual indication that data is being read from or written to the hard drive For the LED to function properly an IDE drive should be connected to the onboard IDE interface The LED will also show activity for devices
42. ge enables you to set the keyboard NumLock state Aptio Setup Utility Copyright C 2011 American Megatrends Inc EIL a Gl Z AAL Boot EIZA Fr Wik u Boot Configuration Select the keyboard NumLock state Boot Option Priorities Select Screen tl Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESG Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc Boot Configuration This item shows the information of the boot configuration Bootup NumLock State On This item determines if the NumLock key is active or inactive at system start up time Boot Option Priorities This item enables you to select boot priorities for all boot devices Security Menu 99 This page enables you to set setup administrator and password Aptio Setup Utility Copyright C 2011 American Megatrends Inc ALEE LLAI Yo V r D 03 I Ia BB q WEN rq Security Ber Wen ad Set Setup Administrator Password Select Screen tl Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit EoG Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc 56 Save amp Exit Menu This page enables you to exit system setup after saving or without saving the changes Aptio Setup Utility Copyright C 2011 American Megatrends Inc ET P C IC
43. gy Enabled Enter Select Turbo Mode Enabled Change Opt 1 Core Ratio Limit F1 General Help 2 Core Ratio Limit F2 Previous Values 3 Core Ratio Limit F3 Optimized Defaults 4 Core Ratio Limit F4 Save amp Exit ESC Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc CPU Ratio 31 This item allows users to control non turbo CPU ratio IA Core Current Normal Use this item to control CPU Current Limit This is for Turbo mode Power Limit 1 Value Watt 95 Use this item to control the limit of the TDP This is for Turbo mode Power Limit 2 Switch Enabled Use this item to control the Power Limit 2 This is for Turbo mode 91 Power Limit 2 Value 118 Use this item to control Power Limit 2 PL2 provides an upper limit of the TDP excursions This is for Turbo mode Long Duration maintainded 1 Use this item to control the time window over PL1 value should be maintained This is for Turbo mode Enhanced Intel SpeedStep Technolo Enabled This item allows users to enable or disable the EIST Enhanced Intel SpeedStep Technology Turbo Mode Enabled This item allows you to control the Intel Turbo Boost Technology 1 2 3 4 Core Ratio 34 33 33 32 This item shows the Core Ratio limit value Press lt Esc gt to return to the Performance Tunning page gt Chipset Configuration Scroll to this item to view the following screen Aptio Setup Utility Copyright C 2011 Americ
44. he Auto install DVD ROM CD ROM makes it easy for you to install the drivers and software for your motherboard l If the Auto install DVD ROM CD ROM does not work on your system you can still install drivers through the file manager for your OS for example Windows Explorer Refer to the Utility Folder Installation Notes later in this chapter The support software DVD ROM CD ROM disc loads automatically under Windows XP Vista 7 When you insert the DVD ROM CD ROM disc in the DVD ROM CD ROM drive the autorun feature will automatically bring up the install screen The screen has three buttons on it Setup Browse CD and Exit T Den wan D anata ES ELITEGROUP Haanboard HEI HZ H BIOS Veron 5 TAZA 0 Driver CO Veron DVD 2 01 For reference only If the opening screen does not appear double click the file setup exe in the root directory Using the Motherboard Software 59 60 Drivers Click the Setup button to run the software installation program Select from the menu which software you want to install Click the Utilities button to display the application software and other software utilities that are available on the disk Select the sofware you want to install then follow installation procedure The Browse CD button is the standard Windows command that allows you to open Windows Explorer and show the contents of the support disk Before installing the software from Windows Explorer look for a file n
45. his item allows user to enter the ACPI S3 Suspend toRAM Sleep State default Press lt Esc gt to return to the Advanced Menu page CPU Configuration Scroll to this item and press lt Enter gt to view the following screen Aptio Setup Utility Copyright C 2011 American Megatrends Inc VEES Advanced Re I FTa s AA i WE r ETTI d cr i gt A Intel R Core TM i5 2400 CPU 3 10GHz EMT64 Supported Processor Speed 3100 MHz Processor Stepping 206a6 Microcode Revision 28 Processor Cores 4 Intel HT Technology Not Supported Select Screen Execute Disable Bit Enabled Rats ae Intel Virtualization Technology Enabled miar SAEC Change Opt P Technol Efficient SSIS COo ooy Energy Ei cl ni F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc J6 Intel R Core TM i5 2400 CPU 3 10GHz This is display only field and diaplays the information of the CPU installed in your computer EMT64 Supported This item shows the computer supports EMT64 Processor Speed 3100MHz This item shows the current processor speed Processor Stepping 206a6 This item shows the processor stepping version Microcode Revision 28 This item shows the Microcode version Processor Cores 4 This item shows the core number of the processor Limit CPUID Maximum Disabled Use this item to enable or
46. ically detects your operating system before installation Other drivers have the setup program located in the operating system subfolder If the driver you want to install does not have a setup program browse to the operating system subfolder and locate the readme text file README TXT or README DOC for information on installing the driver or software for your oper ating system Utility Software Reference All the utility software available from this page is Windows compliant They are provided only for the convenience of the customer The following software is fur nished under license and may only be used or copied in accordance with the terms of the license These software s are subject to change at anytime without prior notice Please refer to the support disk for available software Using the Motherboard Software 63 Chapter 5 Setting Up eJiFFY Introduction eJIFFY is a fast boot program under Linux Instead of waiting Windows O S to start execution eJIFFY is ready to provide users the instant enjoyment on web browsing photo review and online chat just within several seconds after boot up ErS ELITEGROUP A ai Note eJIFFY is ECS optional feature utility corresponding to the DVD activation and BIOS setup Please check the hard copy user s guide or product color box to see if the model has embodded eJIFFY feature eJIFFY icon on color box e GELAAF Version 6 0 Setting Up eJiFFY 64 Installat
47. in crease the motherboard s capabilities by adding hardware that performs tasks that are not part of the basic system PCIEX16 Slot PCIE Slot PCI2 Slot PC Slot PCIEX16 Slot PCIE1 Slot PCl1 2 Slots x CE ii al The PCI Express x16 slot is used to install an external PCI Express graphics card that is fully compliant to the PCI Express Base Specification revision 2 0 The PCI Express x1 slot is fully compliant to the PCI Express Base Specification revision 2 0 This motherboard is equipped with two standard PCI slots PCI stands for Peripheral Component Interconnect and is a bus stan dard for expansion cards which for the most part is a supple ment of the older ISA bus standard The PCI slots on this board are PCI v2 2 compliant Before installing an add on card check the documentation for the card carefully If the card is not Plug and Play you may have to manually configure the card before installation 15 Follow these instructions to install an add on card 1 Remove a blanking plate from the system case corresponding to the slot you are going to use 2 Install the edge connector of the add on card into the expansion slot Ensure that the edge connector is correctly seated in the slot 3 Secure the metal bracket of the card to the system case with a screw For reference only 1 For some add on cards for example graphics adapters and network adapters you have to install dr
48. ion and BIOS Setup DVD Activation Finish the DVD utility setup and then set the BIOS to complete eJIFFY activation 1 Insert ECS software utility DVD and enter below Utilities screen Click eJIFFY feature item to install Utilities A Adobe Reader eDLU C eJIFFY 2S aes E Select utility amp Click to install 2 Follow the onscreen instructions to finish eJIFFY setup w m U Welcome to the eJIFFY Setup Wizard This will install eJIFFY x x xv on your computer It is recommended that you close all other applications before continuing Click Next to continue or Cancel to exit Setup Setting Up evlFFY 3 After setting up eJIFFY under Windows you can switch eJIFFY display keyboard language from English to your local language The changes will be applied after rebooting eJIFFY Configuration CJ CHAFF Ys cor Language English US English us 443 pel Arabic German English UK English US English us Keyboard Spanish French Hebrew Indonesia Indonesian Italiano Italian ARSE Japanese Korean Dutch Polish Portuguese Russian Thai Ukrainian Vietnamese Chinese Simplified Chinese Traditional Ykpa iHcbka Viet Bi eJIFFY Configuration fx EII FEDI cos Language T rk e Turkish Keyboard T rk e Turkish 4y jil Arabic Deutsch German
49. ips to help prolong the life of the motherboard and keep it running as best as it can 1 Keep your computer in a well ventilated area Leave some space between the PC and the wall for sufficient airflow 2 Keep your computer in a cool dry place Avoid dusty areas direct sunlight and areas of high moisture content Uo Routinely clean the CPU cooler fan to remove dust and hair 4 In places of hot and humid weather you should turn on your computer once every other week to circulate the air and prevent damage from humidity 5 Add more memory to your computer if possible This not only speeds up the system but also reduces the loading of your hard drive to prolong its life span ON If possible ensure the power cord has an earth ground pin directly from the wall outlet This will reduce voltage fluctuation that may damage sensitive devices 77 suas solg Ajipow J 1lJe 116e1S 4 pue SOND H19 SOND YTD 0 p u qe1sun JO HEIS 0 12 W JS S oa dn1 s SOIND uu qoid AAH nssl VdIAap jesaydiad S A YNY PeO IeJ Jl 9e U0D lt VINY 1381 11e1s 1 pue SOND Y19 Ae dsip sey JowWUoW JI y99YD uj qoid pieog ON P2 99 9p JOU VDA sd q oys g pue d q Bud T 4l SOA ainjies AXOWawW JO payasul esal pue Ajsadosd 1ou Aiowaw WIAIG 3990S EM O1 JOBUUOD JO U99JIS SOd 3 EH sd q HOUS J 5 YOUMS Sd uo WIN 3d 34 ees N S A SOK
50. is turned off When the system is turned back on the system is configured with the values you stored in CMOS The BIOS Setup Utility enables you to configure Hard drives diskette drives and peripherals Video display type and display options Password protection from unauthorized use Power Management features The settings made in the Setup Utility affect how the computer performs Before using the Setup Utility ensure that you understand the Setup Utility options This chapter provides explanations for Setup Utility options The Standard Confieuration A standard configuration has already been set In the Setup Utility However we recommend that you read this chapter In case you need to make any changes in the future This Setup Utility should be used when changing the system configuration when a configuration error is detected and you are prompted to make changes to the Setup Utility when trying to resolve IRQ conflicts when making changes to the Power Management configuration when changing the password or making other changes to the Security Setup Entering the Setup Utility When you power on the system BIOS enters the Power On Self Test POST routines POST is a series of built in diagnostics performed by the BIOS After the POST routines are completed the following message appears Press DEL to enter SETUP Using BIOS 27 28 Press the delete key to access BIOS Setup Utility Aptio
51. ivers and software before you can begin using the add on card 2 The onboard PCI interface does not support 64 bit SCSI cards Installing the Motherboard 16 Connecting Optional Devices Refer to the following for information on connecting the motherboard s optional devices SATAZ Lt SATA1 P SPI DEBUG F com SES B SATA4 SPOIFO menen hc sns F_AUDIO GE CASE kin aaa p ME UNLOCK Proce Wise one ac LPT TPM F 1394A Z F_USB2 F_USB1 F AUDIO Front Panel Audio header This header allows the user to install auxiliary front oriented microphone and line out ports for easier access Pin Signal Name Pin Signal Name 3 porrim 4 PRESENCE s porrn 6 SENSELRETURN 7 sss 8 e PORT 2L SENSE2 RETURN SATA1 4 Serial ATA connectors These connectors are used to support the Serial ATA 3 0Gb s device simpler disk drive cabling and easier PC assembly It eliminates limitations of the current Parallel ATA interface But maintains register compatibility and sofeware compatibility with Prallel ATA Signal Name Pin Name uru m d e s m Je OyO I eoma CS Installing the Motherboard F_USB1 2 Front Panel USB 2 0 headers F_USB1 supports EZ Charger The motherboard has two USB 2 0 headers supporting four USB 2 0 ports Addition ally some computer cases have USB ports at the front of the case If you have this kind of case use auxiliary USB connector to conn
52. lly resume if there is an incoming call on the PCI Modem or PCI LAN card You must use an ATX power supply in order to use this feature Use this item to do wake up action if inserting the PCI card Resume By USB2 0 S3 Disabled This item allows you to enable disable the USB device wakeup function from S3 mode Resume By PS2 KB S3 Disabled This item enables or disables you to allow keyboard activity to awaken the system from power saving mode Resume By PS2 MS S3 Disabled This item enables or disables you to allow mouse activity to awaken the system from power saving mode EUP Support Enabled This item allows user to enable or disable EUP support Power LED Type Dual Color LED This item shows the type of the power LED Press lt Esc gt to return to the Advanced Menu page Using BIOS J5 ACPI Setting The item in the menu shows the highest ACPI sleep state when the system enters suspend Aptio Setup Utility Copyright C 2011 American Megatrends Inc WELE Advanced RQ FT aa AM m E Lele Mel Veil ai y K gt A ACPI Settings Select the highest ACPI sleep state the system will enter when the SUSPEND button is pressed Select Screen tl Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc ACPI Sleep State S3 Suspend to RAM T
53. lues F3 Optimized Defaults F4 Save amp Exit ESG Exit SMART Fan Slope PWM value 10 PWM value unite CPU Fan Full Speed Offset 25 Version 2 10 1211 Copyright C 2011 American Megatrends Inc CPU SMART FAN Control Enabled This item allows you to enable disable the control of the CPU fan speed by chang ing the fan voltage SMART Fan Mode Normal This item allows you to select the fan mode Normal Quiet Silent or Manual for a better operation environment If you choose Normal mode the fan speed will be auto adjusted depending on the CPU temperature If you choose Quite mode the fan speed will be auto minimized for quiet environment If you choose Silent mode the fan speed will be auto restricted to make system more quietly If you choose Manual mode the fan speed will be adjust depending on users parameters 33 SMART Fan start PWM value 180 This item is used to set the start PWM value of the smart fan SMART Fan start TEMP 30 This item is used to set the start temperature of the smart fan DeltaT 3 This item specifies the range that controls CPU temperature and keeps it from going so high or so low when smart fan works SMART Fan Slope PWM value 10 PWM value unite This item is used to set the Slope Select PWM of the smart fan CPU Fan Full Speed Offset 23 This item is used to set the CPU fan full speed offset value Press lt Esc gt to return to the PC Health Status page Sy
54. ment Regulations Cet appareil num rique de la classe B respecte toutes les exigences du R glement sur le mat riel brouilieur du Canada About the Manual The manual consists of the following Chapter 1 Describes features of the motherboard Introducing the Motherboard Go to gt page 1 Chapter 2 Describes installation of motherboard components Installing the Motherboard Go to page Chapter 3 Provides information on using the BIOS Setup Utility Using BIOS Go to page 27 Chapter 4 Describes the motherboard software Goto page 59 Using the Motherboard Software Chapter 5 Describes the eJIFFY setting Setting Up eJIFFY up Go to gt page 63 Chapter 6 Provides basic trouble shoot Trouble Shooting Ing tips Go to page 5 Preface TABLE OF CONTENTS Preface i Chapter 1 Introducing the Motherboard 1 Introductio sips e E I FSW e S EPE A E A E uuu 2 Sp Gil nil i AAEE AEE I E ET TAE 4 Motherboard Components 5 Chapter 2 Installing the Motherboard 7 Safety Preca ons sussie iein 7 Choosing a Computer Case vcccteasexconesexsagercsestosecanacensaeacerabeececserers 7 Installing the Motherboard in a Case 7 Checking Jumper Settings u u Lu uuu au aaa awaqa 8 gI S iim pO eet ee ee ER RT a CHECKING dumper SCUINOS u u T u usasapa enS 9 Jumper SettingsS nn nnssssssssssssssss 9
55. mputer will restart automatically This concludes Chapter 3 Refer to the next chapter for information on the software supplied with the motherboard Using BIOS J7 58 Chapter 4 Using the Motherboard Software About the Software DVD ROM CD ROM The support software DVD ROM CD ROM that is included in the motherboard package contains all the drivers and utility programs needed to properly run the bundled products Below you can find a brief description of each software program and the location for your motherboard version More information on some pro grams is available in a README file located in the same directory as the software Before installing any software always inspect the folder for files named README TXT or something similar These files may contain important information that is not included in this manual 1 Never try to install all software from folder that is not specified for use with your motherboard 2 The notice of Intel HD Audio Installation optional The Intel High Definition audio functionality unexpectedly quits working in Windows Server 2003 Service Pack 1 or Windows XP Professional x64 Edition Users need to download and install the update packages from the Microsoft Download Center before installing HD audio driver bundled in the driver disk Please log on to http support microsoft com default aspx scid kb en us 901105 appliesto for more information Auto installing under Windows XP Vista 7 T
56. ntegrated high performance Hyper Threading peripheral controller unmatched by any other single chip device controller This motherboard supports up to 16 GB of system memory with dual channel DDR3 1333 1066 SDRAM High resolution graphics via PCI Express x16 slot intended for Graphics Interface is fully compliant to the PCI Express Base Specification revision 2 0 It provides two PCI rev 2 2 slots and one PCI Express x1 rev 2 0 slot for extending usage It implements an EHCI Enhanced Host Controller Interface compliant interface that provides eight USB 2 0 ports four USB 2 0 ports at the back panel and two USB 2 0 headers support additional four USB 2 0 ports and one of Front USB 2 0 headers provide EZ charger technology please refer to chapter 2 parts of Front Panel USB headers for more details This motherboard implements optional USB 3 0 chip which provides two optional USB 3 0 ports at rear I O with blue connectors also The motherboard is equipped with advanced full set of I O ports in the rear panel including PS 2 mouse and PS 2 keyboard connectors one DVI port Co Lay HDMI Port one D sub VGA port one RJ45 LAN connector four USB 2 0 ports two USB 3 0 ports USB 2 0 optional and audio jacks 6 ch for microphone line in and line out In addition this motherboard supports four SATA 3Gb s connectors for expansion Introducing the Motherboard Feature Processor The motherboard uses an LGA1155 type of socket that carries th
57. ot detected c The PC suddenly shuts down while booting up 1 The CPU may experience overheating so it will shutdown to protect itself Ensure the CPU fan is working properly 75 76 2 From the BIOS setting try to disable the Smartfan function to let the fan run at default speed Doing a Load Optimised Default will also disable the Smartfan Start up problems after prolong use After a prolong period of use your PC may experience start up problems again This may be caused by breakdown of devices connected to the motherboard such as HDD CPU fan etc The following tips may help to revive the PC or identify the cause of failure 1 Clear the CMOS values using the CLR CMOS jumper Refer to CLR CMOS jumper in Chapter 2 for Checking Jumper Settings in this user manual When completed follow up with a Load Optimised Default in the BIOS setup 2 Check the CPU cooler fan for dust Long term accumulation of dust will reduce its effectiveness to cool the processor Clean the cooler or replace a new one if necessary 3 Check that the 12V power amp ATX connectors are fully inserted into the motherboard connectors Make sure the latches of the cable and connector are locked into place 4 Remove the hard drive optical drive or DDR memory to determine which of these component may be at fault Maintenance and care tips Your computer like any electrical appliance requires proper care and maintenance Here are some basic PC care t
58. ow the illustration below to install the SATA hard drives Installing Serial ATA Hard Drives To install the Serial ATA SATA hard drives use the SATA cable that supports the Serial ATA protocol This SATA cable comes with a SATA power cable You can connect either end of the SATA cable to the SATA hard drive or the connector on the motherboard SATA cable optional SATA power cable optional Refer to the illustration below for proper installation Attach either cable end to the connector on the motherboard Attach the other cable end to the SATA hard drive Attach the SATA power cable to the SATA hard drive and connect the other end to the power supply ON Installing the Motherboard 21 Connecting I O Devices The backplane of the motherboard has the following I O ports PS2 USB 2 0 VGA port ports LAN port Mouse Line in eo Line out Microphone PS2 DVI port HDMI Optional USB 3 0 ports keyboard PS2 Mouse Use the upper PS 2 port to connect a PS 2 pointing device PS2 Keyboard Use the lower PS 2 port to connect a PS 2 keyboard DVI Port HDMI Connect the DVI port to the monitor optional VGA Port Connect your monitor to the VGA port LAN Port Connect an RJ 45 jack to the LAN port to connect your computer to the Network USB 2 0 Ports Use the USB 2 0 ports to connect USB 2 0 devices USB 3 0 Ports Use the USB 3 0 ports to connect USB 3 0 devices Audio Ports Use the three audio ports to conn
59. pers Use the motherboard jumpers to set system configuration options Jumpers with more than one pin are numbered When setting the jumpers ensure that the jumper caps are placed on the correct pins The illustrations show a 2 pin jumper When the jumper cap is placed on both pins the jumper is SHORT If you remove the jumper cap or place the jumper cap on just one pin the jumper is OPEN SHORT OPEN This illustration shows a 3 pin jumper Pins 1 and 2 are SHORT Mi tet Installing the Motherboard Checking Jumper Settings The following illustration shows the location of the motherboard jumpers Pin 1 is labeled CLR_CMOS Jumper Settings Type Description Setting default 1 2 NORMAL 2 3 CLEAR CLR_CMOS 3 pin Clear CMOS Before clearing the 1 CMOS make sure to CLR CMOS turn off the system 7 To avoid the system instability after clearing CMOS we recommend users to enter the main BIOS setting page to Load Default Settings i and then Save and Exit Setup 10 Installing Hardware Installing the Processor Caution When installing a CPU heatsink and cooling fan make sure that you DO NOT scratch the motherboard or any of the surface mount resis tors with the clip of the cooling fan If the clip of the cooling fan scrapes across the motherboard you may cause serious damage to the motherboard or its components On most motherboards there are small surface mount resistors near the
60. recover from it 1 Shut down the computer 2 Press and hold the Page Up Key PgUp of the keyboard and then boot the PC up 3 Two seconds after the PC boots up release the Page Up Key PgUp 4 The BIOS returns to the default setting by itself Installing the Motherboard CPU Installation Procedure The following illustration shows CPU installation components A Disengaging of the Load Lever Press the hook of lever down and pull it to the right side to release it from retention tab B Opening of the Load Plate Lift the tail of the load lever Rotate the load plate to fully open position C Removing the Cap Be careful not to touch the contact at any time D Inserting the Package Grasp the package Ensure to grasp on the edge of the substrate Make sure pin 1 indicator is on your bottom left side Aim at the socket and place the package carefully into the socket by purely vertical motion E Closing the Load Plate Rotate the load plate onto the package IHS Intergraded Heat Spreader Engage the load lever while pressing down lightly onto the load plate Secure the load lever with the hook under retention tab F Fasten the cooling fan supporting base onto the CPU socket on the motherboard G Make sure the CPU fan is plugged to the CPU fan connector Please refer to the CPU cooling fan user s manual for more detail installation procedure Installing the Motherboard 12 1 To
61. rosoft Corporation WDDM v1 1 and double click it 4 g ECS PC gt ltl Computer gt a Disk drives a 4 Display adapters x II NVIDIA GeForce 8400 GS Microsoft Corporation WDDM v1 1 DVD CD ROM drives b 5 Human Interface Devices gt Cg IDE ATA ATAPI controllers gt lt gt Keyboards gt A Mice and other pointing devices gt ME Monitors b Network adapters b EB Portable Devices gt 4B Processors b 4 Sound video and game controllers gt gi System devices b W Universal Serial Bus controllers Step 3 Enable IGD Multi Monitor from BIOS In the following BIOS screen please set IGD Multi Monitor to Enabled Aptio Setup Utility Copyright C 2011American Megatrends Inc WET a Gr Chipset WAR WE r SY I dri 4 North Bridge Enabled Disabled IGD Multi Monitor by Internal Initate Graphic Adapter PCI Express Graphics Decive IGD Memory 64M DVMT Mode Select DVMT Mode DVMT FIXED Memory 256MB Select Screen tl Select Item Enter Select Value F1 General Help F2 Previous Value F3 Optimized Defaults F4 Save amp Exit EsG Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc 44 Step 4 Change the appearance of your displays under Windows 7 1 Enter the Control Panel menu select the Display in the All Control Panel Items and click the Screen Resolution then appears the following screen Show the path of the setting
62. stem Component Characteristics These items display the monitoring of the overall inboard hardware health events such as System amp CPU temperature CPU amp DIMM voltage CPU amp system fan speed etc CPU Fan Speed CPU Voltage DIMM Voltage VAXG Voltage IMC Voltage Press lt Esc gt to return to the Advanced Menu page Using BI0S 34 Power Management Setup This page sets up some parameters for system power management operation Aptio Setup Utility Copyright C 2011 American Megatrends Inc WELES Advanced eiii Aa Mmm e ES T Wd T WY A D Power Management Setup About Resume by Ring Resume By PCI PCI E Lan PME Disabled Resume By USB2 0 S3 Disabled Resume By PS2 KB S3 Disabled Select Screen Resume By PS2 MS S3 Disabled l Select Item EUP Function Enabled Enter Select PowerLED Type Dual Color LED Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc Resume By RING Disabled The system can be turned off with a software command If you enable this item the system can automatically resume if there is an Incoming call on the Modem You must use an ATX power supply in order to use this feature Resume By PCI PCI E Lan PME Disabled The system can be turned off with a software command If you enable this item the system can automatica
63. ter 4 09 Using the Motherboard Software 59 About the Software DVD ROM CD ROM 59 Auto installing under Windows XP Vtsta 7 59 PT STII uuu usus anus qanapi teeta 60 Manual Installation 62 Utility Software Refetrenge LLL aaa paasaska 62 Chapter 5 iia Setting Up eJIFFY 63 Fa 10181006116 u uu een ene ne Ce A eee ee ene ee 63 Installation and BIOS Se 0 secs occcarcnraresccatsvcedecsatecesceonteaven anette 64 Peete SI a A ET A A A 67 Ea i E E E TE EA E 68 Poan L X 2 E E E 69 Chanter 6 13 Trouble Shooting 75 Start up problems during assembly 75 Start up problems after prolong use 76 Maintenance and Care tIps 76 Basic Troubleshooting Flowchart qi Chapter 1 Introducing the Motherboard Introduction Thank you for choosing the H61H2 M motherboard This motherboard is a high performance enhanced function motherboard designed to support the LGA1155 socket for latest 2 Generation Intel Core Family processors for high end business or personal desktop markets This motherboard is based on Intel H61 Express Chipset for best desktop platform solution H61 is a single chip highly i
64. ter gt Some options lead to pop up dialog boxes that prompt you to verify that you wish to execute that option Other options lead to dialog boxes that prompt you for infor mation Some options marked with a triangle gt lead to submenus that enable you to change the values for the option Use the cursor arrow keys to scroll through the items in the submenu _ Using BI0S 29 In this manual default values are enclosed in parenthesis Submenu items are denoted by a triangle P The default BIOS setting for this motherboard apply for most conditions with optimum performance We do not suggest users change the default values in the BIOS setup and take no responsibility to any damage caused by changing the BIOS settings BIOS Navisation Keys The BIOS navigation keys are listed below FUNCTION BLOSS Previous Value Optimized Defaults For the purpose of better product maintenance the manufacture reserves the right to change the BIOS items presented in this manual The BIOS setup screens shown in this chapter are for reference only and may differ from the actual BIOS Please visit the manufacture s website for updated manual Main Menu When you enter the BIOS Setup program the main menu appears giving you an overview of the basic system information Select an item and press lt Enter gt to display the submenu Aptio Setup Utility Copyright C 2011 American Megatrends Inc Main PEU e Mam oaie SALA Lele A
65. tic proof bags they came in Hold all circuit boards by the edges Do not bend circuit boards Choosing a Computer Case There are many types of computer cases on the market The motherboard complies with the specifications for the Micro ATX system case Some features on the motherboard are implemented by cabling connectors on the motherboard to indica tors and switches on the system case Make sure that your case supports all the features required Most cases have a choice of I O templates in the rear panel Make sure that the I O template in the case matches the I O ports installed on the rear edge of the motherboard This motherboard carries a Micro ATX form factor of 244 x 220 mm Choose a case that accommodates this form factor Installing the Motherboard in a Case Refer to the following illustration and instructions for installing the motherboard in a case Most system cases have mounting brackets installed in the case which correspond the holes in the motherboard Place the motherboard over the mounting brackets and secure the motherboard onto the mounting brackets with screws Ensure that your case has an I O template that supports the I O ports and expansion slots on your motherboard Installing the Motherboard v Do not over tighten the screws as this can stress the motherboard Checking Jumper Settings This section explains how to set jumpers for correct configuration of the motherboard Setting Jum
66. to the chipset menu page M L b II MB Intelligent BIOS HI Menu This page enables you to set the clock speed and system bus for your system The clock speed and system bus are determined by the kind of processor you have installed in your system Aptio Setup Utility Copyright C 2011 American Megatrends Inc Main Advanced Chipset Boot Security Save amp Exit M I B III MB Intelligent BIOS III eA ROND Parameters Performance Tuning B O M P Technology Enabled Auto Detect DIMM PCI Clk Enabled Spread Spectrum Enabled Command Rate Auto Select Screen tl Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Genuine Intel R CPU 0 2 40GHz Processor Speed 2400 MHz Total Memory 2048 MB DDR3 1066 CPU Current Voltage 1 020V VAXG Voltage 1 044V VDIMM 1 524V Version 2 11 1210 Copyright C 2011 American Megatrends Inc gt Integrated Clock Chip Configuration Scroll to this item to view the following screen Aptio Setup Utility Copyright C 2011 American Megatrends Inc ET Pa AYZ Lao o M O l M I B II E ETIS KE Woe SS u Integrated Clock Chip Configuration Integrated Clock Chip Enabled Disabled ICC OverClocking Lib Version Number of ICC Profiles Current ICC Profile Index Select Screen tl Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3
67. u page 41 Chipset Menu The chipset menu items allow you to change the settings for the North chipset South chipset and other system Aptio Setup Utility Copyright C 2011 American Megatrends Inc VEUM Gl Chipset RUB s WE T mmm y el0 EST K A gt 4 North Bridge Parameters p South Bridge gt ME Subsystem Select Screen tl Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 11 1210 Copyright C 2011 American Megatrends Inc gt North Bridge Scroll to this item and press lt Enter gt and view the following screen Aptio Setup Utility Copyright C 2011 American Megatrends Inc WET pa lI Chipset RRV88 s WE T SYITI I cri K wl gt 4 North Bridge Select which graphics controller to use as the primary boot device IGD Memory 64M DVMT Mode Select DVMT Mode a DVMT FIXED Memory 256MB Select Screen IGD Multi Monitor Disabled t Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESCEXii Version 2 11 1210 Copyright C 2011 American Megatrends Inc Initate Graphic Adapter PCI Express This item allows you to select graphics controller to use as the primary boot device IGD Memory 64M This item shows the information of the IGD Unternal Graphics device memory DVMT Mode Select DVM

Download Pdf Manuals

Related Search

Related Contents

    Agilent Technologies Weather Radio 1680 User's Manual  Zelmer ZFP1000W  CentreCOM FS909M/FS917M/FS926M 取扱説明書    Arrow NW108 Instructions / Assembly  Info 38_Info 38  情報端末破壊工具  TOMO 2 - Repositorio CISC  

Copyright © All rights reserved. Failed to retrieve file