Home

ECS H61H2-M2 motherboard

1. PCIE1 Slot w H PEP PCIE2 Slot PCIEX16 Slot The PCI Express x16 slot is used to install an external PCI Express graphics card that is fully compliant to the PCI Express Base Specification revision 2 0 PCIE1 2 Slot The PCI Express x1 slots are fully compliant to the PCI Ex press Base Specification revision 2 0 Before installing an add on card check the documentation for the card carefully If the card is not Plug and Play you may have to manually configure the card before installation Installing the Motherboard 19 Follow these instructions to install an add on card 1 Remove a blanking plate from the system case corresponding to the slot you are going to use Install the edge connector of the add on card into the expansion slot Ensure that the edge connector is correctly seated in the slot Secure the metal bracket of the card to the system case with a screw 2 For reference only 1 For some add on cards for example graphics adapters and network adapters you have to install drivers and software before you can begin using the add on card 2 The onboard PCI interface does not support 64 bit SCSI cards 16 Connecting Optional Devices Refer to the following for information on connecting the motherboard s optional devices dd PL DEBUG SATA4 E SATAJ r EL SATA Li SATAT MO s MS EE I 1 ra m gu a oO st pir ME UNLOCK F USB F_USB TPM
2. Audio Ports Use the lower PS 2 port to connect a PS 2 keyboard Connect the DVI port to the monitor Connect your monitor to the VGA port Connect an RJ 45 jack to the LAN port to connect your computer to the Network Use the USB 2 0 ports to connect USB 2 0 devices Use the three audio ports to connect audio devices The first jack is for stereo line in singal The second jack is for stereo line out singal The third jack is for microphone 21 Connecting Case Components After you have installed the motherboard into a case you can begin connecting the motherboard components Refer to the following Connect the CPU cooling fan cable to CPU FAN Connect the standard power supply connector to ATX POWER Connect the case switches and indicator LEDs to the F PANEL Connect the system cooling fan connector to SYS FAN Connect the auxiliary case power supply connector to ATX12V Connect the case speaker cable to SPK og ia ATX12V me CPU FAN Ferri O O1 Q IN e HOTH2 M2 1 0 ATX POWER 1 3 SYS_FAN F PANEL Connecting 24 pin power cable The ATX 24 pin connector allows you to connect to ATX v2 x power supply With ATX v2 x power supply users please note that when installing 24 pin power cable the latches of power cable and the ATX match perfectly Installing the Motherboard 22 Connecting 4 pin power cable The ATX12V4P power connector is used to provide power to the CPU When inst
3. Wizard This will install eJIFFY x x xx on your computer It is recommended that you close all other applications before continuing Click Next to continue or Cancel to exit Setup Setting Up eJIFFY 3 After setting up eJIFFY under Windows you can switch eJIFFY display keyboard language from English to your local language The changes will be applied after rebooting 4 eJIFFY Configuration OJ CE i re Language English US English us dl Arabic Deutsch German English UI English UK English US English us Espanol Spanish Francais French Hebrew Indonesia Indonesian Italiano Italian Japanese Korean Dutch Polish Portuguese Russian Thai Keyboard Ukrainian Vietnamese Chinese Simplified Chinese Traditional eJIFFY Configuration E SF P 29 zi hee uu Language T rk e Turkish b Keyboard T rk e Turkish v Arabic German English UK English UK English US English US Espanol Spanish Francais French Hebrew Italian Japanese Polish Portuguese Russian Ukrainian Vietnamese YkpaiHcbkKa Vi t Note The keyboard language selection list offers several more regional keyboard setups to switch with the default English typing Please refer to the usage FAQ for more tips Setting Up eJIFFY 64 4 Restart your computer after eJIFFY instal
4. amp Exit ESC Exit SMART Fan Slope PWM value 10 PWM value unite CPU Fan Full Speed Offset 23 Version 2 02 1205 Copyright C 2010 American Megatrends Inc CPU SMART FAN Control Enabled This item allows you to enable disable the control of the CPU fan speed by chang ing the fan voltage SMART Fan Mode Normal This item allows you to select the fan mode Normal Quiet Silent or Manual for a better operation environment If you choose Normal mode the fan speed will be auto adjusted depending on the CPU temperature If you choose Quite mode the fan speed will be auto minimized for quiet environment If you choose Silent mode the fan speed will be auto restricted to make system more quietly If you choose Manual mode the fan speed will be adjust depending on users parameters Using BIOS 31 SMART Fan start PWM value 180 This item is used to set the start PWM value of the smart fan SMART Fan start TEMP 30 This item is used to set the start temperature of the smart fan DeltaT 3 This item specifies the range that controls CPU temperature and keeps it from going so high or so low when smart fan works SMART Fan Slope PWM value 10 PWM value unite This item is used to set the Slope Select PWM of the smart fan CPU Fan Full Speed Offset 23 This item is used to set the CPU fan full speed offset value Press Esc to return to the PC Health Status page System Component Characte
5. Defaults F3 Optimized Defaults Restore User Defaults F4 Save amp Exit ESC Exit Boot Override Version 2 02 1205 Copyright C 2010 American Megatrends Inc Save Changes and Exit This item enables you to save the changes that you have made and exit Discard Changes and Exit This item enables you to discard any changes that you have made and exit Save Changes and Reset This item enables you to save the changes that you have made and reset Discard Changes and Reset This item enables you to discard any changes that you have made and reset Save Options This item enables you to save the options that you have made Save Changes This item enables you to save the changes that you have made Discard Changes This item enables you to discard any changes that you have made Restore Defaults This item enables you to restore the system defaults Save as User Defaults This item enables you to save the changes that you have made as user defaults Restore User Defaults This item enables you to restore user defaults Boot Override Use this item to select the boot device Using BIOS Updating the BIOS You can download and install updated BIOS for this motherboard from the manufacturer s Web site New BIOS provides support for new peripherals improve ments in performance or fixes for known bugs Install new BIOS as follows 4 If your motherboard has a BIOS protection jumper change the setting to allow BIOS flash
6. Input and Output System Setup Utility displays the system s configuration status and provides you with options to set system parameters The parameters are stored in battery backed up CMOS RAM that saves this information when the power is turned off When the system is turned back on the system is configured with the values you stored in CMOS The BIOS Setup Utility enables you to configure Hard drives diskette drives and peripherals Video display type and display options Password protection from unauthorized use Power Management features The settings made in the Setup Utility affect how the computer performs Before using the Setup Utility ensure that you understand the Setup Utility options This chapter provides explanations for Setup Utility options The Standard Configuration A standard configuration has already been set in the Setup Utility However we recommend that you read this chapter in case you need to make any changes in the future This Setup Utility should be used when changing the system configuration when a configuration error is detected and you are prompted to make changes to the Setup Utility when trying to resolve IRQ conflicts when making changes to the Power Management configuration when changing the password or making other changes to the Security Setup Entering the Setup Utility When you power on the system BIOS enters the Power On Self Test POST routines POST is a
7. T F AUDIO Front Panel Audio header This header allows the user to install auxiliary front oriented microphone and line out ports for easier access Pin Signal Name Pin Signal Name 3 POR 4 presence 5 FPORTIR 6 SENSERETURN 7 SENESEND s KY OOOO 9 PORT2L SENSE2 RETURN SATA1 4 Serial ATA connectors These connectors are used to support the Serial ATA 3 0Gb s device simpler disk drive cabling and easier PC assembly It eliminates limitations of the current Parallel ATA interface But maintians register compatibility and sofeware compatibility with Prallel ATA Pin Signal Name Pin Signal Name De pm ooo 4 Gnd y 5 RX RR peu Ground F USB1 2 Front Panel USB headers The motherboard has two USB 2 0 headers supporting four USB 2 0 ports Addition ally some computer cases have USB ports at the front of the case If you have this kind of case use auxiliary USB connector to connect the front mounted ports to the motherboard Pin Signal Name USB_FP_P0 USB_FP_P1 Function Front Panel USB Power Front Panel USB Power USB Port 0 Negative Signal USB Port 1 Negative Signal USB Port 0 Positive Signal USB Port 1 Positive Signal Ground No pin Not connected Please make sure that the USB cable has the same pin assignment as indicated above A different pin assignment may cause damage or system hang up W TPM Optional Trusted Platform Module header Trusted platfor
8. item and press lt Enter gt to display the submenu Aptio Setup Utility Copyright C 2010 American Megatrends Inc Main ME en NN RES Mi X00 E711 C E1378 2 BIOS Information Choose the system default language System Data Mon 12 27 2010 System Time 21 54 45 Select Screen l Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 02 1205 Copyright C 2010 American Megatrends Inc 27 28 Multi Language BIOS Multi language BIOS allows you to see and set up the BIOS with your native language It helps Non English users to solve the problem of setting up the BIOS and achieve extra system performance easily Date amp Time The Date and Time items show the current date and time on the computer If you are running a Windows OS these items are automatically updated whenever you make changes to the Windows Date and Time Properties utility Advaned Menu The Advanced menu items allow you to change the settings for the CPU and other system Aptio Setup Utility Copyright C 2010 American Megatrends Inc WEWE Advanced Blei sm AA m me DT ST HE MESE E03 A Legacy OpROM Support Enable Disable Onboard LAN Option ROM Launch Storage ODROM Enabled p LAN Configuration gt ECS eJIFFY Function Select Screen p PC Health Status 11 Select Item p Power Management Setup Enter Sel
9. of the audio configuration Azalia HD Audio Enabled This item enables or disables Azalia HD audio Azalia Internal HDMI codec Enabled This item enables or disables Azaia Internal HDMI codec Case Open Warning Disabled This item enables or disables the warning if the case is opened up and the item below indicates the current status of the case Chassis Opened No This item indicates whether the case has been opened Press Esc to return to the chipset menu page Using BIOS 45 ME Subsystem Scroll to this item and press Enter to view the following screen Aptio Setup Utility Copyright C 2010 American Megatrends Inc WET Pa VC Chipset II RBSEIEEE TOT WEST T TE EST 1 S 4 Intel ME Subsystem Configuration ME Subsystem Help ME Version 7 0 2 1164 Select Screen 11 Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 02 1205 Copyright C 2010 American Megatrends Inc ME Version 7 0 2 1164 This item shows the ME version ME Subsystem Enabled This item allows you to enable or disable ME subsystem Press Esc to return to the chipset menu page M I B III MB Intelligent BIOS III Menu This page enables you to set the clock speed and system bus for your system The clock speed and system bus are determined by the kind of processor you have installed in your system A
10. on separate logical processors within the same physical processor Chipset The Intel H61 Chipset is a single chip with proven reliability and performance Support two PCI Express x1 slots Integrated four SATA 3 0 Gb s Host Controller Eight USB 2 0 ports supported Serial Peripheral Interface SPI support Integrated Graphics Support with PAVP 1 5 Intel High Definition Audio Controller Memory Supports DDR3 1333 1066 DDR3 SDRAM with Dual channel architec ture Accommodates two unbuffered DIMMs Up to 8 GB per DIMM with maximum memory size up to 16 GB Audio 5 1 2 Channel High Definition Audio Codec Meets Microsoft WLP3 x Windows Logo Program audio requirements All DACs supports 44 1k 48k 96k 192kHz sample rate Software selectable 2 5V 3 2V 4 0V VREFOUT Direct Sound 3D compatible Power Support Digital 3 3V Analog 5 0V Introducing the Motherboard Onboard LAN Optional The onboard LAN provides the following features TM 11 Supports PCI Express Integrated 10 100 1000 transceiver Wake on LAN and remote wake up support Supports PCI Express M 1 1 Integrated 10 100 transceiver Wake on LAN and remote wake up support Expansion Options The motherboard comes with the following expansion options One PCI Express x16 slot for Graphic Interface Two PCI Express x1 slots Four SATA 3 0 Gb s connectors Integrated I O The motherboard has a full set of I O ports and connectors One L
11. the AC power by unplugging the power cord from the power outlet before installing or removing the motherboard or other hardware components This motherboard has an LGA1155 socket When choosing a processor consider the performance requirements of the system Performance is based on the processor design the clock speed and system bus frequency of the processor and the quantity of internal cache memory and external cache memory Fail Safe Procedures for Over clocking When end users encounter failure after attempting over clocking please take the following steps to recover from it Shut down the computer 2 Press and hold the Page Up Key PgUp of the keyboard and then boot the PC up 3 Two seconds after the PC boots up release the Page Up Key PgUp 4 The BIOS returns to the default setting by itself Installing the Motherboard CPU Installation Procedure The following illustration shows CPU installation components A Opening of the Load Plate Put your thumb on the tail of the load plate and press the tail down Rotate the load plate to fully open position B Disengaging of the Load Lever Hold the hook of lever and pull it to the left side to clear retention tab Rotate the load lever to fully open position C Removing the Cap Be careful not to touch the contact at any time D Inserting the Package Grasp the package Ensure to grasp on the edge of the substrate Make sure pin 1 indicato
12. utility software available from this page is Windows compliant They are provided only for the convenience of the customer The following software is fur nished under license and may only be used or copied in accordance with the terms of the license These software s are subject to change at anytime without prior notice Please refer to the support disk for available software Using the Motherboard Software 61 Chapter 5 Setting Up eJIFFY Introduction eJIFFY is a fast boot program under Linux Instead of waiting Windows O S to start execution eJIFFY is ready to provide users the instant enjoyment on web browsing photo review and online chat just within several seconds after boot up Pu 5 ECS ELITEGROUP A s Note eJIFFY is ECS optional feature utility corresponding to the DVD activation and BIOS setup Please check the hard copy user s guide or product color box to see if the model has embodded eJIFFY feature eJIFFY icon on color box Cc GELT Version 6 0 Setting Up eJIFFY 62 Installation and BIOS Setup DVD Activation Finish the DVD utility setup and then set the BIOS to complete eJIFFY activation 1 Insert ECS software utility DVD and enter below Utilities screen Click eJIFFY feature item to install e Information Utilities p Adobe Reader m eBLU eDLU MES 2S JE B Select utility amp Click to install Welcome to the eJIFFY Setup
13. 16 GB Do not remove any memory module from its antistatic packaging until you are ready to install it on the motherboard Handle the modules only by their edges Do not touch the components or metal parts Always wear a grounding strap when you handle the modules Installation Procedure Refer to the following to install the memory modules 1 2 3 This motherboard supports unbuffered DDR3 SDRAM Push the latches on each side of the DIMM slot down Align the memory module with the slot The DIMM slots are keyed with notches and the DIMMs are keyed with cutouts so that they can only be installed correctly Check that the cutouts on the DIMM module edge connector match the notches in the DIMM slot Install the DIMM module into the slot and press it firmly down until it seats correctly The slot latches are levered upwards and latch on to the edges of the DIMM Install any remaining DIMM modules Installingthe Motherboard For reference only Installing the Motherboard 13 14 Expansion Slots Installing Add on Cards The slots on this motherboard are designed to hold expansion cards and connect them to the system bus Expansion slots are a means of adding or enhancing the motherboard s features and capabilities With these efficient facilities you can in crease the motherboard s capabilities by adding hardware that performs tasks that are not part of the basic system PCIEX16 Slot Ti TY 7 e a
14. 2 1205 Copyright C 2010 American Megatrends Inc CPU Configuration Scroll to this item to view the following screen Aptio Setup Utility Copyright C 2010 American Megatrends Inc Main Advanced Chipset M I B Ill Boot Security Save amp Exit IA Core Current CPU Ratio 31 Power Limit 1 Value Watt 65 Power Limit 2 Switch Enabled Power Limit 2 Value 81 Select Screen Long duration Maintained 1 11 Select Item Enhanced Intel SpeedStep Technology Enabled Enter Select Turbo Mode Enabled Change Opt 1 Core Ratio Limit 31 bil General Help 2 Core Ratio Limit 31 F2 Previous Values 3 Core Ratio Limit 0 F3 Optimized Defaults 4 Core Ratio Limit 0 F4 Save amp Exit ESGAExit Version 2 02 1205 Copyright C 2010 American Megatrends Inc CPU Ratio 31 This item allows users to control non turbo CPU ratio A Core Current Normal Use this item to control CPU Current Limit This is for Turbo mode Power Limit 1 Value Watt 65 Use this item to control the limit of the TDP This is for Turbo mode Power Limit 2 Switch Enabled Use this item to control the Power Limit 2 This is for Turbo mode 49 Power Limit 2 Value 81 Use this item to control Power Limit 2 PL2 provides an upper limit of the TDP excursions This is for Turbo mode Long Duration maintainded 1 Use this item to control the time window over PL1 value should be maintained This is for Turbo mode Enh
15. 200 recommended Orientation Landscape Multiple displays C Extend desktop to this display This is currently your main display Advance settings Make text and other items larger or smaller What display settings should choose Cancel Apply The type of the display Set the multiple displays 2 Select display devices set the multiple displays option and to extend destop for display Multi Monitor technology O X xd P Control Panel gt All Control Panel Items Display Screen Resolution BE Search Control Panel Change the apprearance of your displays m 9 Detect G Identify Display 3 DELLU2410 v Resolution 1920 x 1200 recommended Orientation Landscape Multiple displays Disconnect this display Extend desktop to this display A You must select Disconnect this display Make this my main aispiay Advance settings Make text and other items larger or smaller What display settings should choose Cancel Apply Using BIOS 43 Be ed P Control Panel gt All Control Panel Items Display Screen Resolution z Search Control Panel Change the apprearance of your displays m 4 Detect G Identify Display 4 AL1717 Y Resolution 1920 x 1200 recommended Orientation Landscape y Multiple displays Disconnect this display v ZX You mustselect Apply before making additional changes Make this my main display Advance settings Make text and other items larger or small
16. AN port One D sub VGA port One DVI port Optional One HDMI port Optional Four USB 2 0 ports One PS 2 keyboard and PS 2 mouse connectors Audio Jacks for microphone line in and 6 ch line out BIOS Firmware This motherboard uses AMI BIOS that enables users to configure many system features including the following Power management Wake up alarms CPU parameters CPU and memory timing Graphic parameters The firmware can also be used to set parameters for different processor clock speeds 1 Some hardware specifications and software items are subject to change without prior notice 2 Due to chipset limitation we recommend that motherboard be operated in the ambiance between 0 and 50 C Introducing the Motherboard Specifications CPU LGA1155 socket for latest 2 4 Generation Intel Core Fam ily processors Supports Hyper Threading technology CPU DMI 5 0GT s Chipset Intel H61 Chipset Memory Dual channel DDR3 memory architecture 2 x 240 pin DDR3 DIMM sockets support up to 16 GB Supports 1333 1066 DDR3 SDRAM Expansion x PCI Express x16 Gen2 slot Slots 2 x PCI Express x1 slots Storage Supported by Intel H61 Express Chipset 4 x Serial ATA 3 0 Gb s devices Audio VIA VT1705 6 Ch HD audio CODEC Compliant with HD audio specification LAN Atheros AR8152 B 10 100 Lan Optional Atheros AR8152 B Gigabit Fast Ethernet Controll
17. CC over clocking lib version Number of ICC Profiles N A This item shows number of ICC profiles Using BIOS 47 Current ICC Profiles Index N A This item shows current ICC profiles index ICC Enable Disabled This item allows you to enable or disable current ICC Press Esc to return to the M I B III menu page Memory Voltage Control Configuration Scroll to this item to view the following screen Aptio Setup Utility Copyright C 2010 American Megatrends Inc Main Advanced Chipset M I B Il Boot Security Save amp Exit Memory Voltage Control CONFIGURATION Memory aqe Canro Select Screen 11 Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 02 1205 Copyright C 2010 American Megatrends Inc Memory Voltage Config Auto This item allows users to select memory voltage config Press Esc to return to the M I B III menu page 48 gt Performance Tunning Scroll to this item to view the following screen Aptio Setup Utility Copyright C 2010 American Megatrends Inc Main Advanced Chipset Boot Security Save amp Exit Performance Tuning CPU Configuration p Chipset Configuration Select Screen 11 Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 0
18. CD ROM disc loads automatically under Windows XP Vista 7 When you insert the DVD ROM CD ROM disc in the DVD ROM CD ROM drive the autorun feature will automatically bring up the install screen The screen has three buttons on it Setup Browse CD and Exit EFS ELITEGROUP LES SEI HETH ZHZ DIDS Verden 10422710 Dryer LI Version OYO ZI For reference only If the opening screen does not appear double click the file setup exe in the root directory Using the Motherboard Software 97 J8 Drivers Click the Setup button to run the software installation program Select from the menu which software you want to install Click the Utilities button to display the application software and other software utilities that are available on the disk Select the sofware you want to install then follow installation procedure Browse CD The Browse CD button is the standard Windows command that allows you to open Windows Explorer and show the contents of the support disk Before installing the software from Windows Explorer look for a file named README TXT or something similar This file may contain important information to help you install the software correctly Some software is installed in separate folders for different operating systems In installing the software execute a file named SETUP EXE by double clicking the file and then following the instructions on the screen The EXIT button closes the Auto Setup wind
19. IMM PCI slots Spread Spectrum Enabled If you enable spread spectrum it can significantly reduce the EMI Electro Magnetic Interference generated by the system Command Rate Auto This item allows users to set command rate Genuine Intel R CPU 0 3 00GHz This is display only field and displays the information of the CPU installed in your computer Processor Speed 3000MHz This item shows the CPU speed Total Memory 2048MB DDR3 1066 This item shows the total momery of DDR3 CPU Current Voltage 1 212V This item diplays the CPU current voltage VAXG Voltage 0 468V This item displays the current VAXG voltage VDIMM 1 548V This item displays the current VDIMM voltage Using BIOS 91 52 boot Menu This page enables you to set the keyboard NumLock state Aptio Setup Utility Copyright C 2010 American Megatrends Inc DIET EUIS BACCI BRSIN Boot Exe HH MESE Wome AU Boot Configuration Selectthe keyboard NumLock state Boot Option Priorities Select Screen 11 Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 02 1205 Copyright C 2010 American Megatrenas Inc Boot Configuration This item shows the information of the boot configuration Bootup NumLock State On This item determines if the NumLock key is active or inactive at system start up time Boot Option Priorit
20. Jumper Seul S sees ua ava ette ua aaa HIR REN 9 FII SAL T 9 Installing Hardware 10 Installing the ProCessor aaa asasanaskawasanawpaqaaqqayakawkaqa 10 Installing Memory Modules 12 u u pr UH ERFURT HR ERR VISUM Sp agnor sioner EUN 14 Connecting Optional Devices 16 Installing a SATA Hard Drive 19 Connec ng 1O GV 16S 20 Connecting Case Componentis 21 Front Panel Hendel 24 Chapter 3 29 Using BIOS 25 About the Setup Utiltty 23 Ihe Standard Configuration 25 Entering the Setup Utilities 25 Resetting the Default CMOS Values 26 ian BIOU 26 BIOS NOVI SOON JOY 6 27 JOH NCTA 27 Advanced Mentu 28 p I AONE EAN V EEA T 39 M I B III MB Intelligent Bios IIT Menu 46 B ot Menil RT 52 lii iv DOCH Y V1 L 53 SAVE Oc FCI iraaivccasainctisankvievideRsievens r or EEaren ki ra kS aai 54 Updating t
21. Ms in the world MSN ICO AIM ete Shows ePal on line connection status Shut Down Restart Ends your session and turns off the computer Ends your session and restart the computer Shows the network connection status Click once to connect the storage disk to your computer Click for the second time to remove your storage disk safely please refer to the FAQ for more usage information Language Control Panel Switch Keyboard Languages Allows you to adjust the sound volume level from mute to the max Setting Up eJIFFY 67 Usage FAQ Language Control Panel Besides setting English as the default interface eJIFFY offers multi language displays and keyboard settings for language switch Open the language control panel to select a preferable language setting Keyboard Language Setup Stepl Click to open the language control panel PE rou Method Setup UNE rz Display Language BJ Language eJIFFY v2 0 35 Step 2 Click Keyboard Language icon to open the keyboard selection list which offers several regional keyboard settings besides default English keyboard Step 3 Click the selected keyboard language e g English US and press OK Keyboard language Keyboard language English US Arabic sll German Deutsch English UK English US Spanish Espanol French Francais Hebrew n ay Italian Italiano Japanese 433 Dutch Nederlandse Polish Pols
22. PCI Modem or PCI LAN card You must use an ATX power supply in order to use this feature Use this item to do wake up action if inserting the PCI card Resume By USB S3 Disabled This item allows you to enable disable the USB device wakeup function from S3 mode Resume By PS2 KB S3 Disabled This item enables or disables you to allow keyboard activity to awaken the system from power saving mode Resume By PS2 MS S3 Disabled This item enables or disables you to allow mouse activity to awaken the system from power saving mode EUP Support Enabled This item allows user to enable or disable EUP support Power Led Type Dual Color LED This item shows the type of the power LED Press Esc to return to the Advanced Menu page Using BIOS jj ACPI Setting The item in the menu shows the highest ACPI sleep state when the system enters suspend Aptio Setup Utility Copyright C 2010 American Megatrends Inc El Advanced Rei Cras NRI Lele MEET TE G sr KS 4 ACPI Settings Selectthe highest ACPI sleep state the system will enter when the SUSPEND button is pressed Select Screen 11 Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 02 1205 Copyright C 2010 American Megatrenas Inc ACPI Sleep State S3 Suspend to RAM This item allows user to enter the APCI S3 Suspend toRAM Sleep Stat
23. Preface Copyright This publication including all photographs illustrations and software is protected under international copyright laws with all rights reserved Neither this manual nor any of the material contained herein may be reproduced without written consent of the author Version 1 0 The information in this document is subject to change without notice The manufac turer makes no representations or warranties with respect to the contents hereof and specifically disclaims any implied warranties of merchantability or fitness for any particular purpose The manufacturer reserves the right to revise this publication and to make changes from time to time in the content hereof without obligation of the manufacturer to notify any person of such revision or changes Trademark Recognition Microsoft MS DOS and Windows are registered trademarks of Microsoft Corp MMX Pentium Pentium II Pentium III Celeron are registered trademarks of Intel Corporation Other product names used in this manual are the properties of their respective owners and are acknowledged Federal Communications Commission FCC This equipment has been tested and found to comply with the limits for a Class B digital device pursuant to Part 15 of the FCC Rules These limits are designed to provide reasonable protection against harmful interference in a residential installa tion This equipment generates uses and can radiate radio frequency energy and if n
24. The next chapter explains how to install the motherboard Chapter 2 Installing the Motherboard Safety Precautions Follow these safety precautions when installing the motherboard Wear a grounding strap attached to a grounded device to avoid dam age from static electricity Discharge static electricity by touching the metal case of a safely grounded object before working on the motherboard Leave components in the static proof bags they came in Hold all circuit boards by the edges Do not bend circuit boards Choosing a Computer Case There are many types of computer cases on the market The motherboard complies with the specifications for the micro ATX system case Some features on the motherboard are implemented by cabling connectors on the motherboard to indica tors and switches on the system case Make sure that your case supports all the features required Most cases have a choice of I O templates in the rear panel Make sure that the I O template in the case matches the I O ports installed on the rear edge of the motherboard This motherboard carries a micro ATX form factor of 225 x 180 mm Choose a case that accommodates this form factor Installing the Motherboard in a Case Refer to the following illustration and instructions for installing the motherboard in a case Most system cases have mounting brackets installed in the case which correspond the holes in the motherboard Place the motherboard over th
25. Y19 SOA uo pauJnj S u23IMs NSd pue BUIYJOM SI MSd HUN Aiddns 180g 4 99 m ddns 1 9949 ON pessn d si p109 wamod jy Hels 01 S IeJ 9d NG passaid s uoyng JeMog JIVYIMO Sunoouyso qno orseq 76 Trouble Shooting
26. alling 4 pin power cable the latches of power cable and the ATX12V4P match perfectly 4 pin power cable CPU FAN CPU cooling FAN Power Connector Pin Signal Name Function 1 System Ground 2 Power 12V 4 PWM PWM Users please note that the fan connector supports the CPU cooling fan of 1 1A 2 2A 26 4W max at 12V SYS FAN System Cooling FAN Power Connectors Pin Signal Name Function 1 System Ground ATX POWER ATX 24 pin Power Connector Pin Signal Name Pin Signal Name 2 12V 3 Ground 15 Ground 4 a 5 Gema fr G elw 08 Ground OoOO ow Ground EUM Ground 8 PWRGD 20 V ove n e 24 Ground Installing the Motherboard ATX12V ATX 12V Power Connector Pin Signal Name ENNE ANN SPK Internal speaker Pin Signal Name Installing the Motherboard 23 24 Front Panel Header The front panel header F PANEL provides a standard set of switch and LED headers commonly found on ATX or Micro ATX cases Refer to the table below for informa tion F PANEL Pin Signal Function Pin Signal Function HD_LED_P Hard diskLED 2 FP PWR SLP MSG LED HD LED N HarddiskLED 4 FPPWR SLP MSGLED 5 RST SW N Reset Switch 6 PWR SW P Power Switch RST SW P Reset Switch 8 PWR SW N Power Switch RSVD Reserved Key Nopin MSG LED dual color or single color Hard Drive Activity LED Connecting pins 1 and 3 to a fr
27. anced Intel SpeedStep Technology Enabled This item allows users to enable or disable the EIST Enhanced Intel SpeedStep Technology Turbo Mode Enabled This item allows you to control the Intel Turbo Boost Technology 1 2 3 4 Core Ratio 31 31 0 0 This item shows the Core Ratio limit value Press lt Esc gt to return to the Performance Tunning page gt Chipset Configuration Scroll to this item to view the following screen Aptio Setup Utility Copyright C 2010 American Megatrends Inc Main Advanced Chipset Boot Security Save amp Exit Disabled Enabled GT Memory Multiplier Configuration OverClocking Memory Multiplier 10 67 Memory Timing Configuration Select Screen 11 Select Item CAS Latency tCL Enter Select Row Precharge Time tRP Value RAS to CAS Delay tRCD F1 General Help RAS Active Time tRAS F2 Previous Value F3 Optimized Defaults Intel Graphics Configuration F4 Save amp Exit ESC Exit GT OverColocking Enabled Graphics Current Normal Graphics Core Ratio Limit 22 Version 2 02 1205 Copyright C 2010 American Megatrends Inc Memory Multiplier Configuration This item shows the information of Memory Multiplier Configuration Memory Multiplier 10 67 This item determines the operation of DDR SDRAM memory CAS colulmn address strobe It is recommanded that you leave this item at the default value The 2T setting requires faster memory that speci
28. d Wizard for ATI Software The InstallShield Wizard will install ATI Software on your computer To continue click Next Back Cancel 5 Follow the instructions on the screen to install the items Drivers and software are automatically installed in sequence Follow the onscreen instructions confirm commands and allow the computer to restart a few times to complete the installation Using the Motherboard Software 60 Windows Vista 7 will appear below UAC User Account Control message Ley after the system restart You must select Allow to install the next driver Continue this process to complete the drivers installation Manual Installation Insert the disk in the DVD ROM CD ROM drive and locate the PATH DOC file in the root directory This file contains the information needed to locate the drivers for your motherboard Look for the chipset and motherboard model then browse to the directory and path to begin installing the drivers Most drivers have a setup program SETUP EXE that automatically detects your operating system before installation Other drivers have the setup program located in the operating system subfolder If the driver you want to install does not have a setup program browse to the Operating system subfolder and locate the readme text file README TXT or README DOC for information on installing the driver or software for your oper ating system Utility Software Reference All the
29. e default Press Esc to return to the Advanced Menu page CPU Configuration Scroll to this item and press Enter to view the following screen Aptio Setup Utility Copyright C 2010 American Megatrends Inc EAdvanced ag REI Lele EST TE er u Sh 4 CPU Configuration Enabled foir Windows XP and Linux OS optimized for Genuine Intel R CPU 0 3 00GHz Hyper Threading Technology EMT64 Supported and Disabled for other OS OS Processor Speed 3000 MHz not optimized for Processor Stepping 206a3 Hyper Threading Technology Microcode Revision 8 When Disabled only one thread Processor Cores 4 per enabled core is enabled Intel HT Technology Supported Select Screen Limit CPUID Maximum Disabled E reed Execute Disable Bit Enabled 1 RE elec Intel Virtualization Technology Enabled vhange Upt F1 General Help Power Technol E Efficient ower technology neo ei F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 02 1205 Copyright C 2010 American Megatrends Inc Using BIOS 34 Genuine Inter R CPU 0 3 00GHz This is display only field and diaplays the information of the CPU installed in your computer EMT64 Supported This item shows the computer supports EMT64 Processor Speed 3000MHz This item shows the current processor speed Processor Stepping 20623 This item shows the processor stepping version Microcode Revision 8 This item sh
30. e mounting brackets and secure the motherboard onto the mounting brackets with screws Ensure that your case has an I O template that supports the I O ports and expansion slots on your motherboard Installing the Motherboard a 232 0 ibi E piar a T I amp Chnanre Audso 9 Do not over tighten the screws as this can stress the motherboard Checking Jumper Settings This section explains how to set jumpers for correct configuration of the motherboard Setting Jumpers Use the motherboard jumpers to set system configuration options Jumpers with more than one pin are numbered When setting the jumpers ensure that the jumper caps are placed on the correct pins The illustrations show a 2 pin jumper When i the jumper cap is placed on both pins the ius jumper is SHORT If you remove the jumper cap or place the jumper cap on just one pin the jumper is OPEN SHORT OPEN This illustration shows a 3 pin jumper Pins 1 and 2 are SHORT NI E eit Installing the Motherboard Checking Jumper Settings The following illustration shows the location of the motherboard jumpers Pin 1 is labeled D y a aL ho kk F oo Chanal Audio i Byers CLR_CMOS Jumper Settings 1 2 NORMAL 2 3 CLEAR CLR CMOS 3 pin n Clear CMOS petore clearing the CLR CMOS CMOS make sure to turn off the system To avoid the system instability after clearing CMOS we
31. e the settings for the North chipset South chipset and other system Aptio Setup Utility Copyright C 2010 American Megatrends Inc VELE OEE Chipset B RBSEITEEE TOT ST LE S E S 11 North Bridge Parameters p South Bridge gt ME Subsystem Select Screen 11 Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exil Version 2 02 1205 Copyright C 2010 American Megatrends Inc gt North Bridge Scroll to this item and press Enter and view the following screen Aptio Setup Utility Copyright C 2010 American Megatrends Inc WET Meese Chipset I RBSEITEE TT ESTs MEET T 824 North Bridge IGD Share Memory Size DVMT Mode Select DVMT Mode DVMT FIXED Memory 256MB IGD Multi Monitor Disabled T poe Screen oelect item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 02 1205 Copyright C 2010 American Megatrends Inc IGD Memory 64M This item shows the information of the IGD Internal Graphics device memory DVMT Mode Select DVMT Mode This item allows you to select the DVMT operating mode DVMT FIXED Memory 256MB When set to Fixed Mode the graphics driver will reserve a fixed position of the system memory as graphics memory according to system and graphics requirements 40 IGD Multi Monitor E
32. ect gt ACPI Settings Change Opt p CPU Configuration F1 General Help p SATA Configuration F2 Previous Values p USB Configuration F3 Optimized Defaults p Super IO Configuration F4 Save amp Exit p Trusted Computing ESC Exit Version 2 02 1205 Copyright C 2010 American Megatrends Inc Launch PXE OpROM Disabled Use this item to enable or disable the PXE OpROM Launch Storage OpROM Enabled Use this item to enable or disable the Storage OpROM Using BIOS 29 LAN Configuration The item in the menu shows the LAN related information that the BIOS automatically detects Aptio Setup Utility Copyright C 2010 American Megatrends Inc WEE Advanced eiil am 8 31 MI Lele ETT d Sr A a DA LAN Configuration Enable Disable Onboard LAN Controller Select Screen 11 Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Onboard LAN Controller Enabled Use this item to enable or disable the Onboard LAN Press lt Esc gt to return to the Advanced Menu page ECS eJIFFY Function Scroll to this item and press Enter to view the following screen Aptio Setup Utility Copyright C 2010 American Megatrends Inc WEE Advanced Biel 38 AM m1 ME sole EST a LN EST E S 4 ECS eJIFFY Function Make sure that the eJIFFY has been installed to hard disk Select Screen 11 Select Item E
33. egatrends Inc El Advanced Kel M RETE IT EST LEES WY S 4 SATA Configuration 1 IDE Mode 2 AHCI Mode Serial ATA Controller O Compatible Serial ATA Controller 1 Enhanced SATA Port1 Not Present SATA Port2 Not Present Select Screen 11 Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit SATA Port3 Not Present SATA Port4 Not Present Version 2 02 1205 Copyright C 2010 American Megatrends Inc SATA Mode IDE Mode Use this item to select SATA mode Serial ATA Controller 0 1 Compatible Enhanced Use this item to select the Serial ATA cotroller options Disabled Compatible En hanced SATA Port 1 4 Not Present This motherboard supports four SATA channel and each channel allows one SATA device to be installed Use these items to configure each device on the SATA channel H61 Chipset is not fully support AHCI Mode HW support only Press Esc to return to the Advanced Menu page Using BIOS 36 USB Configuration Scroll to this item and press lt Enter gt to view the following screen Aptio Setup Utility Copyright C 2010 American Megatrends Inc WET me Advanced Bell e RENE EDT EST VS or CX 8541 USB Configuration Enabled Disabled All USB Devices Legacy USB Support Enabled Select Screen 11 Select Item Enter Select Change Opt F1 General Help F2 P
34. er Optional Rear Panel I O 4 x USB 2 0 ports 1 x D sub VGA x DVI port optional 1 x HDMI port optional x RJ45 LAN connector x Audio port Line in microphone in line out x PS 2 keyboard amp PS 2 mouse connectors Internal I O x 24 pin ATX Power Supply connector Connectors amp x 4 pin ATX Power Supply connector Headers 1 x 4 pin CPU FAN connector x 3 pin SYS FAN connector 2 x USB 2 0 headers support additional four USB 2 0 ports 4 x Serial SATA 3 0 Gb s connectors x COM header x Case Open header x SPDIF out header x TPM header 1 x ME UNLOCK header x Speaker header x Clear CMOS header System BIOS AMI BIOS with 32Mb SPI Flash ROM Support Multi language BIOS Utility Support ECS M I B III Utility AP support Support eJIFFY eBLU eDLU eSF Form Factor Micro ATX Size 225mm x 180mm Introducing the Motherboard Motherboard Components 9 3 lt P lt c a Introducing the Motherboard Table of Motherboard Components COMPONENIS LGA1155 socket for 2 Generation Intel Core Family Processors 2 CPU FAN 4 pin CPU cooling fan connector 3 DDR 1 2 240 pin DDR3 SDRAM slots 4 ATX POWER Standard 24 pin ATX power connector 1 CPU Socket 2 18 PCIET 2 PCI Express x1 slot 19 PCIEX16 PCI Express slot for graphics interface 20 ATX12V 4 pin 12V power connector This concludes Chapter 1
35. er What display settings should choose Cancel Apply m i A xd gt Control Panel gt All Control Panel Items Display Screen Resolution E Search Control Panel Change the apprearance of your displays CII a Display 4 AL1717 Y Resolution 1920x1200 recommended Orientation Landscape v Multiple displays Extend desktop to this display N You must select Apply before making additional changes Make this my main display Advance settings Make text and other items larger or smaller What display settings should choose Cancel Apply Using BIOS 44 gt South Bridge Scroll to this item and press Enter to view the following screen Aptio Setup Utility Copyright C 2010 American Megatrends Inc IEIEEChipset ele MEET TU T TEL amet Wo S u South Bridge Specify what state to go to when power is re applied after a power failure G3 state Audio Configuration Azalia HD Audio Enabled Select Screen Azalia Internal HDMI codec Enabled 11 Select Item Enter Select Case Open Warning Disabled Change Opt Chassis Opened No F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 02 1205 Copyright C 2010 American Megatrends Inc Restore AC Power Loss Power Off This item enables your computer to automatically restart or return to its operating status Audio Configuration This item shows the information
36. erformance Hyper Threading peripheral controller unmatched by any other single chip device controller This motherboard supports up to 16 GB of system memory with dual channel DDR3 1333 1066 SDRAM High resolution graphics via PCI Express x16 slot intended for Graphics Interface is fully compliant to the PCI Express Base Specification revision 2 0 In addition two PCI Express slots are supported It implements an EHCI En hanced Host Controller Interface compliant interface that provides eight USB 2 0 ports four USB 2 0 ports at the back panel and two USB 2 0 headers support additional four USB 2 0 ports The motherboard is equipped with advanced full set of I O ports in the rear panel including PS 2 mouse and PS 2 keyboard connectors one DVI HDMI Optional port one D_sub VGA port one Lan port four USB 2 0 ports and audio jacks for microphone line in and line out In addition this motherboard supports four SATA 3Gb s connectors for expansion Introducing the Motherboard Feature Processor The motherboard uses an LGA1155 type of socket that carries the following features Accommodates latest 2 Generation Intel Core Family processors Supports Hyper Threading technology CPU One PCI Express x16 Gen2 port supporting up to 5 GB s direction peak bandwidth Hyper Threading technology enables the operating system into thinking it s hooked up to two processors allowing two threads to be run in parallel both
37. erly 13 14 2 From the BIOS setting try to disable the Smartfan function to let the fan run at default speed Doing a Load Optimised Default will also disable the Smartfan Start up problems after prolong use After a prolong period of use your PC may experience start up problems again This may be caused by breakdown of devices connected to the motherboard such as HDD CPU fan etc The following tips may help to revive the PC or identify the cause of failure 1 Clear the CMOS values using the CLR_CMOS jumper Refer to CLR_CMOS jumper in Chapter 2 for Checking Jumper Settings in this user manual When completed follow up with a Load Optimised Default in the BIOS setup 2 Check the CPU cooler fan for dust Long term accumulation of dust will reduce its effectiveness to cool the processor Clean the cooler or replace a new one if necessary 3 Check that the 12V power amp ATX connectors are fully inserted into the motherboard connectors Make sure the latches of the cable and connector are locked into place 4 Remove the hard drive optical drive or DDR memory to determine which of these component may be at fault Maintenance and care tips Your computer like any electrical appliance requires proper care and maintenance Here are some basic PC care tips to help prolong the life of the motherboard and keep it running as best as it can 1 Keep your computer in a well ventilated area Leave some space between the PC and t
38. f the Canadian Interference causing Equipment Regulations Cet appareil num rique de la classe B respecte toutes les exigences du R glement sur le mat riel brouilieur du Canada Aboutthe Manual The manual consists of the following Chapter 1 Describes features of the motherboard Introducing the Motherboard Go to gt page 1 Chapter 2 Describes installation of motherboard components Installing the Motherboard Go to page 7 Provides information on using Chapter 3 i the BIOS Setup Utility Using BIOS Go to page 25 Chapter 4 Describes the motherboard software Goto page 57 Using the Motherboard Software Chapter 5 Describes the eJIFFY setting Setting Up eJIFFY up Go to page 61 Chapter 6 Provides basic trouble shoot Trouble Shooting gape Go to page 73 Preface TABLE OF CONTENTS Preface 1 Chapter 1 1 Introducing the Motherboard 1 Ey nora E COG NR RR Rt l J 0 ee E A EEEE 2 Specie GOES NNI TE Motherboard Components 5 Chapter 2 1 Installing the Motherboard 7 Safety Precautions I Choosing a Computer Case d Installing the Motherboard in a Case 7 Checking Jumper SettIngs 8 Checking
39. fically supports this mode Using BIOS 90 Memory Timing Configuration This item shows the information of Memory Timing Configuration CAS Latency tcl 8 This item determines the operation of DDR SDRAM memory CAS colulmn address strobe It is recommanded that you leave this item at the default value The 2T setting requires faster memory that specifically supports this mode Row Precharge Time tRP 8 This item specifies Row precharge to Active or Auto Refresh of the same bank RAS to CAS Delay tRD 8 This item specifies the RAS to CAS delay to Rd Wr command to the same bank RAS Active Time tRAS 20 This item specifies the RAS active time Initate Graphics Adapter This item shows the information of Intel Graphics Configutation GT OverClocking Disabled This item allows you to control the internal GFX Turbo mode Graphics Current Normal This item shows the information of the Graphics Current Graphics Core Ratio Limit 22 This item shows the information of the Graphics Core Ratio Limit Press Esc to return to the Performance Tunning page Press Esc to return to the M I B III menu page Using BIOS B O M P Technology Enabled This item allows users to enable or disable B O M P technology This function can run safe setting to setup menu when system boot fail 3 times Auto Detect DIMM PCI CIk Enabled When this item is enabled BIOS will disable the clock signal of free D
40. h BIOS aac EER uas edad n CIERRE RR RN 55 Chapter 4 9 Using the Motherboard Software 57 About the Software DVD ROM CD ROM eese 27 Auto installing under Windows XP Vista 7 sss ou Finn mo COD RIRs 56 Manual l Installation 60 Utility Software REIT en CG sg uu u a Skunk sassa ncs cut 60 Chapter 5 61 Settine Up eJIFFY 61 61 Installation and BIOS Setup 62 e PD Ud e Eu b UU LIL ee ENEE 65 lie Om 66 lo J Uu uuu 67 Chapter 6 13 Trouble Shooting 73 Start up problems during assembly 13 Start up problems after prolong use 74 Maintenance and care tips 74 Basic Troubleshooting Flowchalt 75 Chapter 1 Introducing the Motherboard Introduction Thank you for choosing the H61H2 M2 motherboard This motherboard is a high performance enhanced function motherboard designed to support the LGA1155 socket for latest 2 4 Generation Intel Core Family processors for high end business or personal desktop markets This motherboard is based on Intel H61 Express Chipset for best desktop platform solution H61 is a single chip highly integrated high p
41. he wall for sufficient airflow 2 Keep your computer in a cool dry place Avoid dusty areas direct sunlight and areas of high moisture content Oo Routinely clean the CPU cooler fan to remove dust and hair 4 In places of hot and humid weather you should turn on your computer once every other week to circulate the air and prevent damage from humidity 5 Add more memory to your computer if possible This not only speeds up the system but also reduces the loading of your hard drive to prolong its life span 6 If possible ensure the power cord has an earth ground pin directly from the wall outlet This will reduce voltage fluctuation that may damage sensitive devices 75 SOINDYTD 01 peau 10119 dn1 s SOW gunies SOI Ajipouu saye 1463581 pue SOND 112 9 qeisun JO 3Je3s 03 Ie WAISAS uu qo d AAH nssl 92IA ep JeJeudiJad S9A VINY 3261000 16J J 1463s2J pue SOND 419 VIAM 1261000 lt e dsip seu JoWUOW JI 29u ule qoJd pueog pa3221ep JOU YDA ON sd q Yous g pue daaq 8uo T J S9A ainyies A1ouu uu JO payasul 4e3s9J pue 1Je3saJ p A 19doud you Aow w WNIA sdaaq 140us JI U93J95 150d 1e EH 195205 PM 03 128uuoo JO U91IMS Sd uo uln odie HED ON SOA SOA VIAM 1281009 lt uje qoJd pJeoqg J p2129UUuO SI pseog JO nSd YUM ule qoJd asp samod AZT fid J PUNES G n AU sey JOUUOW JI pau ON ON SOA oouo pue SOI
42. ies This item enables you to select boot priorities for all boot devices Security Menu 94 This page enables you to set setup administrator and password Aptio Setup Utility Copyright C 2010 American Megatrends Inc Isi Security EEV ea Main Advanced Chipset M I B Ill If ONLY the Administrator s password is set then this only limits access to Setup and is only asked for when entering Setup If ONLY the User s password is set then this is a power on password and must be entered to boot or enter Setup In Setup the User will have Administrator rights The password must be 3 to20 characters long Set Setup Administrator Password Select Screen 11 Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 02 1205 Copyright C 2010 American Megatrends Inc 94 Save amp Exit Menu This page enables you to exit system setup after saving or without saving the changes Aptio Setup Utility Copyright C 2010 American Megatrends Inc LUTEA Ye ET r EL l Tas 88 ELTE TL MEE Save amp Exit Exit system setup after saving Discard Changes and Exit the changes Save Changes and Reset Discard Changes and Reset Select Screen Save Options 11 Select Item Save Changes Enter Select Discard Changes Change Opt F1 General Help Restore Defaults F2 Previous Values Save as User
43. ing If your motherboard has an item called Firmware Write Protect in Ad vanced BIOS features disable it Firmware Write Protect prevents BIOS from being overwritten Prepare a bootable device or create a bootable system disk Refer to Windows online help for information on creating a bootable system disk Download the Flash Utility and new BIOS file from the manufacturer s Web site Copy these files to the bootable device Turn off your computer and insert the bootable device in your com puter You might need to run the Setup Utility and change the the boot priority items on the Advanced BIOS Features Setup page to force your computer to boot from the bootable device first At the C or AA prompt type the Flash Utility program name and the file name of the new BIOS and then press Enter Example AFUDOS EXE 040706 ROM When the installation is complete remove the bootable device from the computer and restart your computer If your motherboard has a Flash BIOS jumper reset the jumper to protect the newly installed BIOS from being overwritten The computer will restart automatically This concludes Chapter 3 Refer to the next chapter for information on the software supplied with the motherboard Using BIOS 99 96 Chapter 4 Using the Motherboard Software About the Software DVD ROM CD ROM The support software DVD ROM CD ROM that is included in the motherboard package contains all the drivers and utility progra
44. ka Portuguese Portugu s Russian Pycckun Turkish T rkce Ukrainian YkpaiHcbKa Vietnamese Vi t Setting Up eJIFFY 68 to enable all possible language inputs you want to apply and click v FrontEnd v MEngine Anthy Panel GTK Global Setup Name Enable Hotkeys Filters Global Setup Chewing Smart Pinyin Generic Table Chinese traditional The installed input method services b Japanese b Korean b Russian b Thai b Chinese simplified D SI S lt SI SI S fs b Other You can enable disable input methods and set hotkeys for input methods here Ale Edit View History Bookmarks Jools Help t pG fn Most Visited ECS Google 8 d tpe googie com isearch cccct e AP Bhoe ut BGeqg thrls comub v Ni dh E BA BE E nE EUM HE conus ME BET RA Google BEST hit mun Emu TETAN RANAN A RE RT Es 2H gt siwa In ECS PPR 170 000 000 TARER PIRE D 13 E pipi ECS Web Slie wun Move your mouse pointer on 14 Jui 2010 Mochernoarts desktop and mobile PCs paripnerais and viet fre text box and press Ctrl Space The language caer maska SEN bar will then appear as fol Laes Site Products lows exu com ba DT Ps p ER ER ECS Web Site ul mr pared HEHHE WETE Green ECS TPR eae Sr fcn gill Se SERA E m r CSB WWW BCR COT PAGE Cer al natin nego Merl eo ERGA Mig Welom
45. lation Press DEL or click the BIOS Setup button on the post screen to enter the BIOS setup page after boot up aptio Setup Utility Copyright C 2010 American Hegatrends Inc I 5 And then enter the Advanced Setup page to enable the item ECS eJIFFY Func tion Press F4 to save the configuration and exit Restart your computer Aptio Setup Utility Copyright C 2010 American Megatrends Inc ECS eJIFFY Function Enab Led Yes Note 1 eJIFFY is available in SATA IDE AHCI mode It does not support RAID configuration and the onboard 34 pin floppy drives 2 Please refer to ECS website for new eJIFFY application updates Setting Up eJIFFY 65 Entering e JIFFY The post screen appears within several seconds after boot up and it has three buttons Click to enter the normal OS you have installed Operating systen such as Windows lick to enter eJIFFY OS O Click to set the BIOS le BIOS Setu 3 If you click eJIFFY the following screen will appear And If you make no choice it will enter the normal OS automatically after ten seconds ErS ELITEGROUP 1 Setting Up eJIFFY Feature Icons The following illustration shows the main feature icons that eJIFFY provides on the menu USA Thu Aug 13 mr ha 12 20AM eWeb Firefox for web browsing webmail and watching flash video ePix Photo viewing ePal On line chat tool to use the most popular I
46. m module TPM is a published specification detailing a microcontrollerthat can store secured information and implementations of that specification Pin Signal Name Pin TPM_CLK N LFRAME Signal Name O le o D N RESERVE0 RESERVE1 VCC3_DUAL SERIRQ GND GND 9 LPCPD 20 SMBCLK LREST SMBDATA ES 8 VCC3 LAD1 10 Installing the Motherboard SPDIFO SPDIF out header This is an optional header that provides an SPDIFO Sony Philips Digital Interface output to digital multimedia device through optical fiber or coaxial connector Pin Signal Name SPDIFOUT aG CASE Chassis Intrusion Detect Header This detects if the chassis cover has been removed This function needs a chassis equipped with instrusion detection switch and needs to be enabled i BIOS Pin 1 2 Function Short Chassis cover is removed Open Chassis cover is closed ME UNLOCK ME Unlock Header Pin 1 2 Function Open Lock COM Onboard serial port header Connect a serial port extension bracket to this header to add a serial port to your system Pin Signal Name Function DCDB Serial Input SOUTB UART B Serial Output UART B Data Terminal Ready DTRB Ground Data Set Ready RART B Request to Send F 0 Installingthe Motherboard Installing a SATA Hard Drive This section describes how to install a SATA Hard Drive About SATA Connectors Your motherboard features four SATA co
47. mble the PC to remove the VGA adaptor card DDR memory LAN USB and other peripherals including keyboard and mouse Leave only the motherboard CPU with CPU cooler and power supply connected Turn on again to see if the CPU and power supply fans are running 2 Make sure to remove any unused screws or other metal objects such as screwdrivers from the inside PC case This is to prevent damage from short circuit 3 Check the CPU FAN connector is connected to the motherboard 4 For Intel platforms check the pins on the CPU socket for damage or bent A bent pin may cause failure to boot and sometimes permanent damage from short circuit 5 Check the 12V power connector is connected to the motherboard 6 Check that the 12V power amp ATX connectors are fully inserted into the motherboard connectors Make sure the latches of the cable and connector are locked into place b Power is on fans are running but there is no display 1 Make sure the monitor is turned on and the monitor cable is properly connected to the PC 2 Check the VGA adapter card if applicable is inserted properly 3 Listen for beep sounds If you are using internal PC speaker make sure it is connected a continuous 3 short beeps memory not detected b 1 long beep and 8 short beeps VGA not detected c The PC suddenly shuts down while booting up 1 The CPU may experience overheating so it will shutdown to protect itself Ensure the CPU fan is working prop
48. me to ECS The Electrochemical Society IEEE j The Society Mw Eokd Stab and Electroehemica l ecienoe and Te Click the language bar here ECS Web lb ite E wawa plecirochem ngy Bae E Maa P eipnie pne Gaming Power Trj Lieiielieyabie Cem koca ru ECS Bunches Black GTX 460 graptucs card famity for performance desined gamers Wesco OET TES ECS Ane miematons Manultacturar at Fregieney Cantal m Japanese Anthy Select your desired Korean language Russian Thai Chinese simplified Chinese traditional Other English Keyboard Setting Up eJIFFY 69 How to change display language Open the Language Control Panel and click to show the display language list Check your desired display language Your selected display language will be applied after rebooting English US Came Arabic s Il German Deutsch English UK English US Spanish Espa ol French Fran ais Hebrew nay Indonesian Indonesia Italian Italiano Japanese R Korean 713 Dutch Nederlandse Polish Polska Portuguese Portugu s Russian Pycckuii Thai lns Turkish T rkce Ukrainian YKpaiHcbKa Vietnamese Vi t Simplified Chinese i ff rp x Traditional Chinese 42722 How to set networking connection If you do not have IP shared server direct link you can select the icon P and press the right key of your mouse Show
49. ms needed to properly run the bundled products Below you can find a brief description of each software program and the location for your motherboard version More information on some pro grams is available in a README file located in the same directory as the software Before installing any software always inspect the folder for files named README TXT or something similar These files may contain important information that is not included in this manual 1 Never try to install all software from folder that is not specified for use with your motherboard 2 The notice of Intel HD Audio Installation optional The Intel High Definition audio functionality unexpectedly quits working in Windows Server 2003 Service Pack I or Windows XP Professional x64 Edition Users need to download and install the update packages from the Microsoft Download Center before installing HD audio driver bundled in the driver disk Please log on to http support microsoft com default aspx scid kb en us 901105Zappliesto for more information Auto installing under Windows XP Vista 7 The Auto install DVD ROM CD ROM makes it easy for you to install the drivers and software for your motherboard I If the Auto install DVD ROM CD ROM does not work on your system you can still install drivers through the file manager for your OS for example Windows Explorer Refer to the Utility Folder Installation Notes later in this chapter The support software DVD ROM
50. nabled This item enables or disables IGD Internal Graphics device multi monitor Press Esc to return to the chipset menu page Multi Monitor technology Multi Monitor technology can help you to increase the area available for programs running on a single computer system through using multiple display devices It is not only to increase larger screen viewing but aslo to improving personal productivity Intel Integrated Graphics PCI Express Graphics one or two Intel integrated Graphics and one or two PCI Express graphics Please note that Multi Monitor technology supports up to four monitors devices under Windows 7 Step 1 Insert ECS drives DVD to run Auto setup or browse the DVD to install Intel chipset drivers VGA and sound drivers If you want know the detail information please refer to chapter 4 A Uu es infomation ESS ELITEGROUP Mainboard H61 H2 M2 BIOS Version 10722710 Driver CD Version DVD 2 01 Using BIOS 41 Step 2 Install all the drivers of PCI Express graphic cards Click the Browse CD item then appears the following screen Select the driver you want to install e g NVIDIA GeForce 8400 GS Microsoft Corporation WDDM v1 1 and double click it File Action View Help gt Hs S i wu 4 ECS PC gt 4M Computer gt Disk drives 4 amp Display adapters Ms NVIDIA GeForce 8400 GS Microsoft Corporation WDDM v1 1 gt DVD CD ROM drives b dics Human In
51. nnectors supporting a total of four drives SATA refers to Serial ATA Advanced Technology Attachment is the standard inter face for the IDE hard drives which are currently used in most PCs These connectors are well designed and will only fit in one orientation Locate the SATA connectors on the motherboard and follow the illustration below to install the SATA hard drives Installing Serial ATA Hard Drives To install the Serial ATA SATA hard drives use the SATA cable that supports the Serial ATA protocol This SATA cable comes with a SATA power cable You can connect either end of the SATA cable to the SATA hard drive or the connector on the motherboard SATA cable optional SATA power cable optional Refer to the illustration below for proper installation Attach either cable end to the connector on the motherboard 2 Attach the other cable end to the SATA hard drive 3 Attach the SATA power cable to the SATA hard drive and connect the other end to the power supply at T pe Kx KLAN For reference only Installing the Motherboard 20 Connecting I O Devices The backplane of the motherboard has the following I O ports PS2 Mouse USB 2 0 ports LAN port Line in Line out PS2 DVI port HDMI optional VGA port USB 2 0 ports keyboard PS2 Mouse Use the upper PS 2 port to connect a PS 2 pointing device PS2 Keyboard DVI Port HDMI optional VGA Port LAN Port USB 2 0 Ports
52. nter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 02 1205 Copyright C 2010 American Megatrends Inc ECS eJIFFY Function Disabled This item enables or disables ECS eJIFFY Function Press Esc to return to the Advanced Menu page PC Health Status On motherboards support hardware monitoring this item lets you monitor the paeameters for critical voltages temperatures and fan speeds Aptio Setup Utility Copyright C 2010 American Megatrends Inc WET Advanced elTe REI Teo EST TE Mt WY SS PC Health Status CPU Fan Speed 4687 RPM CPU Voltage 1 212V Select Screen DIMM Voltage X 1 548V 1l Select Item VAXG Voltage 0 468V Enter Select Change Opt F1 General Help F2 Previous Values PECI Mode F3 Optimized Defaults Offset to TCC Activation Temp 21 FA Save amp Exit ESC Exit Version 2 02 1205 Copyright C 2010 American Megatrends Inc Smart Fan Function Scroll to this item and press Enter to view the following screen Aptio Setup Utility Copyright C 2010 American Megatrends Inc WEILE Advanced Biel T2 RENE E TOT EST V ET a S 4 SMART Fan Mode Normal SMART Fan start PWM value SMART Fan start PWM TEMP Delta T Select Screen 11 Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save
53. ont panel mounted LED provides visual indication that data is being read from or written to the hard drive For the LED to function properly an IDE drive should be connected to the onboard IDE interface The LED will also show activity for devices connected to the SCSI hard drive activity LED connector Power Sleep Message waiting LED Connecting pins 2 and 4 to a single or dual color front panel mounted LED provides power on off sleep and message waiting indication Reset Switch Supporting the reset function requires connecting pin 5 and 7 to a momentary contact switch that is normally open When the switch is closed the board resets and runs POST Power Switch Supporting the power on off function requires connecting pins 6 and 8 to a momen tary contact switch that is normally open The switch should maintain contact for at least 50 ms to signal the power supply to switch on or off The time requirement is due to internal de bounce circuitry After receiving a power on off signal at least two seconds elapses before the power supply recognizes another on off signal This concludes Chapter 2 The next chapter covers the BIOS Installingthe Motherboard Chapter 3 Using BIUS About the Setup Utility The computer uses the latest American Megatrends Inc BIOS with support for Windows Plug and Play The CMOS chip on the motherboard contains the ROM setup instructions for configuring the motherboard BIOS The BIOS Basic
54. ot installed and used in accordance with the instructions may cause harmful inter ference to radio communications However there is no guarantee that interference will not occur in a particular installation If this equipment does cause harmful interference to radio or television reception which can be determined by turning the equipment off and on the user is encouraged to try to correct the interference by one or more of the following measures Reorient or relocate the receiving antenna Increase the separation between the equipment and the receiver Connect the equipment onto an outlet on a circuit different from that to which the receiver is connected Consult the dealer or an experienced radio TV technician for help Shielded interconnect cables and a shielded AC power cable must be employed with this equipment to ensure compliance with the pertinent RF emission limits governing this device Changes or modifications not expressly approved by the system s manu facturer could void the user s authority to operate the equipment Preface li Declaration of Conformity This device complies with part 15 of the FCC rules Operation is subject to the following conditions This device may not cause harmlul interference This device must accept any interference received including interfer ence that may cause undesired operation Canadian Department of Communications This class B digital apparatus meets all requirements o
55. ow Utilities Lists the software utilities that are available on the disk Information Displays the path for all software and drivers available on the disk Running Setup Follow these instructions to install device drivers and software for the motherboard 1 Click Setup The installation program begins 3 Ante Watup ELLA LEER ug H61H2 M2 Autosetup Program Mainboard IE Rand RoncuE 7 00 0011 WiFi ces bur Pr riis Bri whic ss l on Rurale T tait orando rta i emp cni p Comm Tora Chob Hasr fe The following screens are examples only The screens and driver lists will be different according to the motherboard you are installing The motherboard identification is located in the upper left hand corner Using the Motherboard Software 99 2 Click Next The following screen appears Auto Setup Package software Version 2 00 0018 Select Features Choose the features Setup will install Select the features you want to install clear the features you do not want to install 62540 K Description ATI Software Package Version 8 082 041130a Release Date 2005 01 04 Space Required on C 38715 K Space Avallable on C 6821104 K InstallShield Next gt Cancel 3 Check the box next to the items you want to install The default options are recom mended 4 Click Next run the Installation Wizard An item installation screen appears ATI Software Welcome to the InstallShiel
56. ows the Microcode version Processor Cores 4 This item shows the core number of the processor Intel HT Technology Supported This item shows that your computer supports Intel HT technology or not Hyper threading Enabled This item is only available when the chipset supports Hyper threading and you are using a Hyper threading CPU Limit CPUID Maximum Disabled Use this item to enable or disable the maximum CPUID value limit When supports Prescott and LGA775 CPUs enables this to prevent the system from rebooting when trying to install Windows NT 4 0 Excute Disable Bit Enabled This item allows the processor to classify areas in memory by where application code can execute and where it cannot When a malicious worm attempts to insert code in the buffer the processor disables code execution preventing damage or worm propa gation Replacing older computers with Execute Disable Bit enabled systems can halt worm attacks reducing the need for virus related repair Intel Virtualization Technology Disabled When disabled a VMM cannot utilize the additional hardware capabilities provided by Vandor Pool Technology Power Technology Energy Efficient Use this item to control the Energy mode of the processor Press Esc to return to the Advanced Menu page Using BIOS Jj SATA Configuration Use this item to show the mode of serial SATA configuration options Aptio Setup Utility Copyright C 2010 American M
57. ptio Setup Utility Copyright C 2010 American Megatrends Inc Main Advanced Chipset M I B HE Boot Security Save amp Exit M I B III MB Intelligent BIOS III Integrated Clock Chip Parameters gt Memory Voltage Control P Performance Tuning B O M P Technology Enabled Auto Detect DIMM PCI Clk Enabled Spread Spectrum Enabled Select Screen 11 Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Command Rate Auto Genuine Intel R CPU 0 3 00GHz Processor Speed 3000 MHz Total Memory 2048 MB DDR3 1066 CPU Current Voltage 1 212V VAXG Voltage 0 468V VDIMM 1 548V Version 2 02 1205 Copyright C 2010 American Megatrends Inc gt Integrated Clock Chip Configuration Scroll to this item to view the following screen Aptio Setup Utility Copyright C 2010 American Megatrends Inc Main Advanced Chipset M I B Ill Boot Security Save amp Exit Integrated Clock Chip Configuration Integrated Clock Chip Enabled Disabled ICC OverClocking Lib Version Number of ICC Profiles Current ICC Profile Index Select Screen 11 Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 02 1205 Copyright C 2010 American Megatrends Inc ICC Over Clocking Lib Version 7 0 0 29 This item shows the I
58. r is on your bottom left side Aim at the socket and place the package carefully into the socket by purely vertical motion E Closing the Load Plate Rotate the load plate onto the package IHS Intergraded Heat Spreader Engage the load lever while pressing down lightly onto the load plate Secure the load lever with the hook under retention tab F Fasten the cooling fan supporting base onto the CPU socket on the motherboard G Make sure the CPU fan is plugged to the CPU fan connector Please refer to the CPU cooling fan user s manual for more detail installation procedure Installing the Motherboard 12 that you use a high quality fan with 3800 rpm at least CPU fan and heatsink installation procedures may vary with the type of CPU fan heatsink supplied The form and size of fan heatsink may also vary 1 To achieve better airflow rates and heat dissipation we suggest 2 DO NOT remove the CPU cap from the socket before installing a CPU 3 Return Material Authorization RMA requests will be accepted only if the motherboard comes with the cap on the LGA1155 socket Installing Memory Modules This motherboard accommodates two memory modules It can support two 240 pin DDR3 1333 1066 The total memory capacity is 16 GB DDR3 SDRAM memory module table Memory module Memory Bus DDR3 1066 533 MHz DDR3 1333 667 MHz You must install at least one module in any of the two slots Total memory capacity is
59. recommend users to enter the main BIOS setting page to Load Default Settings and then Save and Exit Setup Installing the Motherboard 10 Installing Hardware Installing the Processor Caution When installing a CPU heatsink and cooling fan make sure that you DO NOT scratch the motherboard or any of the surface mount resis tors with the clip of the cooling fan If the clip of the cooling fan scrapes across the motherboard you may cause serious damage to the motherboard or its components On most motherboards there are small surface mount resistors near the processor socket which may be damaged if the cooling fan is carelessly installed Avoid using cooling fans with sharp edges on the fan casing and the clips Also install the cooling fan in a well lit work area so that you can clearly see the motherboard and processor socket Before installing the Processor This motherboard automatically determines the CPU clock frequency and system bus frequency for the processor You may be able to change the settings in the system Setup Utility We strongly recommend that you do not over clock processors or other components to run faster than their rated speed Warning 1 Over clocking components can adversely affect the reliability of the system and introduce errors into your system Over clocking can perma nently damage the motherboard by generating excess heat in components that are run beyond the rated limits 2 Always remove
60. revious Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 02 1205 Copyright C 2010 American Megatrends Inc All USB Devices Enabled Use this item to enable or disable all USB devices Legacy USB Support Enabled Use this item to enable or disable support for legacy USB devices Setting toAudio allows the system to detect the presence of the USB device at startup If detected the USB controller legacy mode is enabled If no USB device is detected the legacy USB support is disabled Press Esc to return to the Advanced Menu page 37 Super IO Configuration Scroll to this item and press lt Enter gt to view the following screen Aptio Setup Utility Copyright C 2010 American Megatrends Inc WELES Advanced Rei a RARI ETT A N gt I Super IO Configuration Set Parameters of Serial Port 0 COMA Select Screen 11 Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 02 1205 Copyright C 2012 American Megatrends Inc gt Serial Port 0 Configuration This item shows the information of the super IO chip Aptio Setup Utility Copyright C 2010 American Megatrends Inc Advanced eji E oTo EST d eri T qS 4 Serial Port 0 Configuration Enable or Disable Serial Port COM Device Settings IO 3F8h IRQ 4 Auto Select Screen 11 Select Item Enter Selec
61. ristics These items display the monitoring of the overall inboard hardware health events such as System amp CPU temperature CPU amp DIMM voltage CPU amp system fan speed etc CPU Fan Speed CPU Voltage DIMM Voltage VAXG Voltage Press Esc to return to the Advanced Menu page 32 Power Management Setup This page sets up some parameters for system power management operation Aptio Setup Utility Copyright C 2010 American Megatrends Inc WELES Advanced Beli gd AM o EST Li EST 1370 gt dL Power Management Setup About Resume by Ring Resume By PCI PCI E Lan PME Disabled Resume By USB S3 Disabled Resume By PS2 KB S3 Disabled Select Screen Resume By PS2 MS S3 Disabled l Select Item EUP Function Enabled Enter Select Power Led Type Dual Color LED Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESG Exit Version 2 02 1205 Copyright C 2010 American Megatrends Inc Resume By RING Disabled The system can be turned off with a software command If you enable this item the system can automatically resume if there is an incoming call on the Modem You must use an ATX power supply in order to use this feature Resume By PCI PCI E Lan PME Disabled The system can be turned off with a software command If you enable this item the system can automatically resume if there is an incoming call on the
62. series of built in diagnostics performed by the BIOS After the POST routines are completed the following message appears Press DEL to enter SETUP Using BIOS 29 26 Press the delete key to access BIOS Setup Utility Aptio Setup Utility Copyright C 2010 American Megatrends Inc Main urs E6111 NA 88 N SE P REST 100 E T3 UU BIOS Information Choose the system default language System Data Mon 12 27 2010 System Time 21 54 45 Select Screen 1 Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESOC Exit Version 2 02 1205 Copyright C 2010 American Megatrends Inc Resetting the Default CMOS Values When powering on for the first time the POST screen may show a CMOS Settings Wrong message This standard message will appear following a clear CMOS data at factory by the manufacturer You simply need to Load Default Settings to reset the default CMOS values Note Changes to system hardware such as different CPU memories etc may also trigger this message American Megatrends H61H2 M2 Release 10 13 2010 Version 2 02 1205 Copyright C 2010 American Megatrends Inc Press lt F7 gt to enter BBS POPUP Press lt DEL gt or lt F2 gt to enter setup CMOS Settings Wrong Using BIOS When you start the Setup Utility the main menu appears The main menu of the Setup Utility displays a list of the options
63. t Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESG Exit Change Settings Version 2 02 1205 Copyright C 2010 American Megatrends Inc Serial Port Enabled This item allows you to enable or disable serial port Device Settings lO 3F 8h IRQz4 This item shows the information of the device settings Change Settings Auto Use this item to change device settings Press Esc to return to the Super IO Configuration page Press Esc to return to the Advanced Menu page 38 Trusted Computing Scroll to this item and press lt Enter gt to view the following screen Aptio Setup Utility Copyright C 2010 American Megatrends Inc VELES Advanced Kerr e UR RENT M Lele ETT GLA EST X SS dL TPM Configuration Current TPM Status Information NO TPM Hardware Enables or Disables TPM support O S will not show TPM Reset of platform is required Select Screen 1l Select Item Enter Select Change Opt F1 General Help F2 Previous Values F3 Optimized Defaults F4 Save amp Exit ESC exit Version 2 02 1205 Copyright C 2010 American Megatrends Inc TPM Support Enabled This item enables or disables TPM support Current TPM Status Information This item shows the information of current TPM status NO TPM Hardware This item shows the TPM status 39 Chipset Menu The chipset menu items allow you to chang
64. terface Devices gt qq IDE ATA ATAPI controllers pem Keyboards p A Mice and other pointing devices b Monitors b Ea Network adapters gt Ai Portable Devices b D Processors b a Sound video and game controllers gt lll System devices b Universal Serial Bus controllers Step 3 Enable IGD Multi Monitor from BIOS In the following BIOS screen please set IGD Multi Monitor to Enabled Aptio Setup Utility Copyright C 2010 American Megatrends Inc MEI YC Chipset IB RBSEIEE ele MEET Te d EST 1 a oo North Bridge Enabled Disabled IGD Multi Monitor by Internal Initate Graphic Adapter PCI Express Graphics Decive IGD Memory 64M DVMT Mode Select DVMT Mode DVMT FIXED Memory 256MB Select Screen l Select Item Enter Select Value F1 General Help F2 Previous Value F3 Optimized Defaults F4 Save amp Exit ESC Exit Version 2 02 1205 Copyright C 2010 American Megatrends Inc 42 Step 4 Change the appearance of your displays under Windows 7 1 Enter the Control Panel menu select the Display in the All Control Panel Items and click the Screen Resolution then appears the following screen Show the path of the setting location Display devices nix ecg P Control Panel gt All Control Panel Items Display Screen Resolution Search Control Panel Change the apprearance of your displays Detect ql O Identify n Resolution 1920 x 1
65. that are available A highlight indicates which option is currently selected Use the cursor arrow keys to move the highlight to other options When an option is highlighted execute the option by pressing lt Enter gt Some options lead to pop up dialog boxes that prompt you to verify that you wish to execute that option Other options lead to dialog boxes that prompt you for infor mation Some options marked with a triangle P lead to submenus that enable you to change the values for the option Use the cursor arrow keys to scroll through the items in the submenu _ Using BI0S In this manual default values are enclosed in parenthesis Submenu items are denoted by a triangle P The default BIOS setting for this motherboard apply for most conditions with optimum performance We do not suggest users change the default values in the BIOS setup and take no responsibility to any damage caused by changing the BIOS settings BIOS Navigation Keys The BIOS navigation keys are listed below KEY FUNCTION For the purpose of better product maintenance the manufacture reserves the right to change the BIOS items presented in this manual The BIOS setup screens shown in this chapter are for reference only and may differ from the actual BIOS Please visit the manufacture s website for updated manual Main Menu When you enter the BIOS Setup program the main menu appears giving you an overview of the basic system information Select an
66. the networking connection status 2 If you want to set the networking connection you can press the right key of your mouse to edit it Setting Up eJIFFY 70 Stepl Select the icon press the right key of your mouse then select Edit Enable Networking Connection Information Edit Connections N JSA 99 Connection item Thu Aug 13 12 53 AM Connection name Auto etho w Connect automatically Wired 002 1x Security 1Pv4 settings ipv6 Settings it Wired ve Wireless gt DSL Method Automatic DHCP 2l Name Last Used Addresses Types of connections 1 Wired connection Connection name Connect automatically Wired 802 1x Security IPv6 Settings m bytes Setting Up eJIFFY 2 Wireless connection Editing Wireless connection 1 Connection name Wireless connection 1 Comes s J 3 DSL connection Note Details about eJIFFY please refer to eJIFFY in disk Setting Up eJIFFY 71 72 Setting Up eJIFFY Chapter 6 Trouble Shooting Start up problems during assembly After assembling the PC for the first time you may experience some start up problems Before calling for technical support or returning for warranty this chapter may help to address some of the common questions using some basic troubleshooting tips a System does not power up and the fans are not running 1 Disasse

ECS H61H2-M2 motherboard

Contents

Download Pdf Manuals

Related Search

Related Contents