Home

User Manual - ADC Energy

Contents

1. W1 W2 FUNC Figure3 2 Currentinstantaneous differential protection operating characteristic X PNC TECH 3 36 PAC T100 Transformer Protection and Control Unit RIA 10 DIFF Differential E Restraint HR Calculate DIFF5 A gt DIFFS DIFF Hi i DIFF5 DIFF 20100 PHS Wi W2 W1 W3 FUNC KNEE HARM SETTING TYPE PHS PHS TION sock por are SLOPE2 POINT 120118 151111 DELAY EVENT Figure 3 3 Current percent differential protection operating characteristic SETTING PROTECT 1 4 HOC 50 87 Setting Item Step Unit Description FUNCTION ENABLED DISABLED Whether function useor not 4 BLOCK Protection blocking condition 5 ENABLED DISABLED Whether event recordornot SETTING PROTECT 1 4 PHS DIFF 87T Setting Item Step Unit Description FUNCTION ____ DISABLED Whether function use ornot_ PICKUP SLOP
2. 5 70 APPENDIX A PHASE COMPENSATION FORMULA 5 71 APPENDIX B TRANSFORMER AND COMPENSATION ANGLLE 5 72 APPENDIX C TIME CHARACTERISTICS CURVES 5 81 X PNC TECH 100 Transformer Protection and Control Unit p m Figure Figure 1 1 Figure 2 1 Figure 2 2 Figure 3 1 Figure 3 2 Figure 3 3 Figure 3 4 Figure 3 5 Figure 3 6 Figure 3 7 Figure 3 8 Figure 3 9 Figure 3 10 Figure 3 11 Figure 3 12 Figure 3 13 Figure 3 14 Figure 3 15 Figure 3 16 Figure 3 17 Figure 3 18 Figure 3 19 Figure 3 20 Figure 3 21 Figure 3 22 Figure 3 23 Figure 3 24 Figure 4 1 Figure 4 2 Figure 5 1 Figure 5 2 Figure 5 3 Figure 5 4 Figure 5 5 Figure 5 6 Figure 5 7 Table Table 1 1 Table 2 1 Table 2 2 Table 2 3 Table 2 4 Table 2 5 Table 4 1 Table 5 1 Function Single Line Diagram eren 1 9 Faceplate Interface cte ret n ie t e 2 18 LCD The First Display eei rhe Pe RES 2 20 Instantaneous Percent Differential Protection Characteristic esee 3 36 Intantaneous Differential Protection Characteristic esee 3 36 Percent Differential Protection Cha
3. Figure 3 21 Inrush current detection operating characteristic SETTING PROTECT 1 4 INRUSH Setting Item Step Unit Description 1 FUNCTION ENABLED DISABLED Whetherfunctionuseornot 2 Df I1f 10 100 1 96 2 harmonics current fundamental wave current 100 3 0 10 2 50 0 01 fundamental wave minimum operating current 4 DELAY 0 00 60 00 Operating time delay 5 BLOCK EasyLogic operand Protection blocking condition 6 EVENT ENABLED DISABLED Whethereventrecordornot Metering and EasyLogic Operand LCD display Item Description 12011 OP Inrush current detection operation X PNC TECH PAC T100 Transformer Protection and Control Unit p eere cx xc mc M M cr 3 3 Subsidiary Function 3 31 Record Event Fault record Relay can record event amp fault recording up to 1024 events record with information occurrence time by resolution of 1msec Event Fault items are power On Off protection operation status digital input output status CB control setting change monitoring diagnostic status event data clear waveform data clear circuit breaker output counter change etc When it is protection element operation status change relay records together fault information Single Phase voltage frequency Secondary magnitude Winding 1 current Phase Secon
4. DDD 0 0 1 T 0 0 0 60 1 1 60 60 0 120 n 1 x 120 120 0 180 a NZ 180 180 0 25 N 240 1 1 4 240 240 0 300 1 i 4 300 300 0 60 0 i 60 0 60 60 m 60 0 0 240 240 180 0 120 0 1 j 1 120 0 120 120 H 120 0 0 180 7 120 0 300 M 5 79 100 Transformer Protection and Control Unit DDD 180 0 ra 180 0 180 N 2 120 120 300 0 180 Y 0 180 180 N 300 7 NZ 300 120 0 S V 240 0 R 4 240 0 240 60 240 0 180 ALAT 240 1 240 0 0 AAA 300 0 H lt 300 0 300 180 4 300 0 120 N V 7 0 0 0 5 80 PAC T100 Transformer Protection and Control Unit E s Appendix C Time characteristics Curves Overcurrent overvoltage Undervoltage 1 Operating time K C xTM sec K xTM sed K C L Characteristic curve const GY 1 GY Current voltage input G n Gs Current voltage setting TM Multiplier 0 01 10 00 Protection element TC curve C Phase Ground Overcurrent 51 51N Negative Sequence Overcurrent 46T Normal Inverse 0 00 Very Inverse 0 00 Extremely Inverse 0 00 Long Inverse 0 00 ANSI Inverse 0 17966 ANSI Short Inverse 0 03393 ANSI Long Inverse
5. V Figure 3 24 TCS circuit composition SETTING SYSTEM TCS Setting Item Step Unit Description 1 FUNCTION ENABLED DISABLED Whetherfunctionuseornot 2 TRIP INPUT CONTIN 1 Trip input CONT IN 16 Metering and EasyLogic Operand LCD display Item Description TCS_FAIL TCS operation PAC T100 Transformer Protection and Control Unit 3 334 Communication SETTING SYSTEM COMMUNICATION sets that need in 2 RS485 communications that is situated to relay rear Appear in 2 RS485 communication port settings and DNP3 0 protocol setting screen in case of DNP3 0 protocol is included product Appear in 2 RS485 communication port setting screens in case of IEC60870 5 103 protocol is included product COM2 is Modbus protocol dedicated and protocol change is possible COM1 Should do power Off On certainly after store setting if change COMZI s 0 protocol Reflection does not become by protocol that change power if do SETTING SYSTEM COM 1 2 Off On Setting Item Step Unit Description 1 __ DISABLED Whetherfunctionuseormot 300 1200 2400 4800 Bit sec 9600 19200 38400 Modbus IEC60870 5 103 1 254 Modbus IEC60870 5 103 Differ according to ordering option SETTING SYSTEM DNP3 0 Setting Item Step Unit Description 1 TX DELAY 65000 1 Tx delay time 2 LINK CONFIRM ALWAYS Link layer confirm SOMETIMES 3 LINK RETRY 0 5 1 U
6. 2 3 Menu structure display Menu composition screen is separated into DISPLAY block that mark status metering record etc and SETTING block that set or displays setting value of system and protection element and COMMAND block that can initialize record and set trip counter of circuit breaker and status of point of contact and test front panel Menu tree key handle Relay is switched over in menu composition screen if press MENU key in early screen Refer menu composition screen can select menu wanting through 4 left lt right gt I key Example 1 In case of move from early screen to event screen IMENU DISPLAY 2 METERING gt EVENT Example 2 In case of move from event screen to setting screen lt DISPLAY VISETTING P SYSTEM P PASSWORD V POWER SYSTEM V RTC Relay is switched over to details menu if press gt key in least significant menu It is meaning that details menu is extant more than two in case of title of the first line blinks in details menu Press gt key if details menu to change setting after presses up A down V key is published and select details menu In the case of SETTING PROTECT item protection group of present state blinks if press gt key and come to low ord
7. gt gt gt Wi IC gt gt SETTING 5 Figure 3 18 Circuit breaker protection operating characteristic ETTING PROTECT 1 4 CBF 50BF Setting Item Unit Description FUNCTION ENABLED DISABLED Whetherfunctionuseornot 2 TRIPINPUT 6 Trip input contact 5 7 FasyLogicoperand Protection blocking condition 6 ENABLED DISABLED Whethereventrecordornot Metering EasyLogic Operand LCD display Item Description 50 Circuit breaker fail protection operation 100 Transformer Protection and Control Unit H 3 2 8 Cold Load Pickup COLDLD Inrush current when it is line transformer and reactor etc are injected can lead to malfunction to exceed setting value of time of normal operation of protection element Can achieve most suitable protection that Cold Load Pickup element applies setting value of protection element high during setup time from injection detecting closing time and stationary state applies proper form setting value Relay has operation delay time and acts in case of it is below size that phase current W1 IA W1 IB 1 IC is set all and relay has reset delay time and returns in case of it is more than size that current more than among phase current is set Curr n Normal Cur Time Figure 3 19 Cold
8. PAC T100 has 8 basis LEDs and 8 user setting LEDs and offers convenient menu tree through graphic LCD and relay and circuit breaker can be controlled by keypad There is one RS 232 port that front of PAC T100 can do in communication with PC program PACManager and are two RS 232 ports that rear of PAC F100 can do connection with remote monitoring system This relay provides ModBus DNP3 0 and IEC 60870 5 103 protocol for communication with remote monitoring system X PNC TECH 100 Transformer Protection and Control Unit p 1 1 Characteristics Digital transformer protective relay that use two processors Use possibility for two windings or three winding transformer protection Four protection element setting groups Eleven protection elements HOCR PHS DIFF OCR OCGR NSOCR GND DIFF OVR UVR CBF V Hz COLD LD INRUSH Various TC curve IEC standard ANSI standard KEPCO induction type P amp C curve Control of CB open close on local and remote mode Quantity of electricity measuring function Three winding three phase current Single phase voltage Three winding sequence current Differential current by a phase Fundamental wave Second harmonic wave Fifth harmonic wave Restrain current Compensation current Magnification by winding Reference winding Frequency 1024 event recording and maximum eight fault waveform recording 32 samples cycles Engineering too
9. Waveform Captured ProtPkp OCR ProtPkp OCR A ProtPkp OCRA C ProtOp OCR f 60 00 2 109 94V 0 0 la 10 004 268 9 Vb 110 25 240 27 Ib 9 99 148 7 Ve 109 85V 120 3 Ic 10 004 28 7 An AY Connected COM1 19200 N 8 1 Figure 3 22 Event record 3 53 100 Transformer Protection and Control Unit Ht Waveform record 100 has fault oscillograph function up to 8 waveforms with 32 sampling rate in non volatile memory Waveform has maximum 4 second recording time where current voltage I O contacts protection element status are included Trigger condition to start recording can be 1 contact status change protection element operation and combination of internal logic configuration by EasyLogic And trigger position can be set in 0 9996 location of total waveform size Evaluation Tool PACEval Option O Help H 2 PH 0 00 200 V B 8 96 21822 V C m 165225 N m 1852270 Current 6082359 8 14828888 C m 0021415 N 0 00 2249 39 Harmonic Data THD Voltage Current A 0 00 323 22 B 296 25 255 35 C 290 75 269 64 N 288 97 0 00
10. 1 lt x D 10 AC DC 10 240V 1 a 19 130 POWER POWER 50 SURGE SURGE CHASSIS SURGE GROUND BUS GIINP e L 4015 Y 4 4460116 Front Figure 5 2 100 three windings transformer CT connection PNC TECH um 100 Transformer Protection and Control Unit clee 9H CA CPerees c ve 5 32 PAC T100 two windings transformer CT connection PHS COMP INTERNAL CBA PAC T100 W1_IB W1_IC W1_IN CBA Figure 5 3 PAC T100 two windings transformer CT connection TECH PAC T100 Transformer Protection and Control Unit prm M MM M Qu 227 aT T Ji M mr 5 3 3 Current Transformer CT Connection for External Phase Compensation PHS COMP EXTERNAL CBA PAC T100 CBA Figure 5 4 Current Transformer CT Connection for External Phase Compensation X PNC TECH 100 Transformer Protection and Control Unit 5 3 4 Input Output contact connection PAC T100 mE HS 1 7 a oncom Figure 5 5 Input Output contact connection DC 125 5 3 5 5 RS232 Port Connection PAC T100 NoteBook ignal Ground NA NA RS232 D s
11. magnitude WI 10 Winding l zero sequence primary current magnitude angle Winding 1 positive sequence primary current WI Il magnitude angle Winding 1 negative sequence primary current WI 12 magnitude angle Winding 2 zero sequence primary current magnitude angle SEQUENCE CURRENT W2 n Winding 2 positive sequence primary current magnitude y angle Winding 2 negative sequence primary current W2 12 magnitude angle W3 10 Winding 3 zero sequence primary current magnitude angle Winding 3 positive sequence primary current W3 Il magnitude angle Winding 3 negative sequence primary current W3 12 magnitude angle 2 43 RECORD Event occurrence contents and waveform save information are confirmed in DISPLAY RECORD DISPLAY RECORD EVENT show record of maximum 1024 stored in memory of PAC T100 All fault records are recorded with information occurrence time by resolution of 1msec and managed by FIFO mode Fault record items have control power ON OFF protection element operation status contact input output status circuit breaker control setting value change monitoring self diagnosis status event data clear waveform record clear and circuit TECH PAC T100 Transformer Protection and Control Unit prc breaker counter change etc Event 15 possible for setting EANBLED DISABLED each function Event for operation status of protection element recor
12. Link layer retry count Link layer timeout PAC T100 Transformer Protection and Control Unit 3 3 5 SYSTEM Time System time may set in local or remote through communication SETTING SYSTEM RTC is used to change system time that 1s placed inside protective relay Setting order is order year month day hour minute second Select each item by left S 2 key and changes value by down V key If press ENTER key time is set SETTING SYSTEM RTC Item Step Unit Description 2000 2100 1 Year MM 0120 01 31 1 Dy 00 23 1 jHor 00 59 1 Minute 00 59 1 Second PAC T100 Transformer Protection and Control Unit 4 Application example 41 Wiring and setting PAC T100 Table 4 1 Application example POWER SYSTEM setting Power System Setting 1 FREQUENCY 60447 4 SET GROUP GROUP 1 Transformer 1 TYPE lag 3 WI W3PHS 81 88 olag Winding l Winding 2 kV E Figure 4 1 Application example two windings transformer wiring Set SETTING POWER SYSTEM like table 4 1 and inputs current voltage PAC T100 Transformer Protection and Control Unit 4 2 Measurement Current Voltage input Terminal Input value Primary current voltage frequency Sequence current display Current volta
13. burst disturbance Standard IEC60255 22 1 ANSI IEEE C37 90 1 Detail Contents Oscillation Frequency 1 MHz Voltage Rise Time 75 ns Repetition Frequency 400 Hz Output Impedance 200 Permission Method Asynchronous Polarity Positive Negative Control Power Circuit Common Mode 2 5 kV Differential Mode 1 0 kV Transformer Circuit Common Mode 2 5 kV Differential Mode 1 0 kV Contact Circuit Common Mode 2 5 kV Differential Mode 1 0 kV Fast transients burst Standard 60255 22 4 class IV ANSI IEEE C37 90 1 Detail Contents Voltage Rise Time 5 ns 50 Peak Voltage Hold Time 50 ns Repetition Frequency 2 5 kHz Burst Hold Time 15 ms Burst Period 300 ms Permission Method Asynchronous Common Mode Polarity Positive Negative Permission Time 1 min Downtime min Control Power Circuit 4kV Transformer Circuit 4 Contact Input Output Circuit 4 Earth Circuit 4 Electrostatic Discharge Standard IEC60255 22 2 class Detail Contents Voltage Polarity Positive Negative Permission Counter 10 Permission Interval 1 sec Permission Region Case Air discharge 8 kV Contact discharge 6 kV PAC T100 Transformer Protection and Control Unit eT Surge Immunity Standard IEC60255 22 5 class IV Detail Contents Voltage Waveform 1 2x50 us Current Waveform 8x20 us Output Impedance 2 O Permission Method Asynchronous Polarity Positive Negative Permission Counter 3 Pe
14. 3 55 3 3 3 Trip circuit supervision 8 2 402 221 440004000000000000000000000000000 0 3 56 3 3 4 Communication i rrr NAAN 3 57 3 3 5 SYSTEM TIME ANA 3 58 4 APPLICATION EXAMPLE 4 59 4 1 WIRINGANDSETTING S 4 59 4 2 MEASUREMENT PR 4 60 43 CURRENT DIFFERENTIAL 4 61 44 RESTRICTED GROUND FAULT PROTECTION MEASUREMENT WINDING 1 4 63 5 INSTALL AND EXTERNAL CONNECTION 5 64 5 1 DIMENSIONED 2 2 5 64 5 2 REAR TERMINAL 5 65 5 3 EXTERNAL CONNECTIONS 5 66 5 3 1 100 three windings transformer CT connection 5 66 5 3 2 PAC T100 two windings transformer CT connection PHS COMP 5 67 5 3 3 Current Transformer CT Connection for External Phase Compensation PHS EXTERNAL e PER e C PEERS ies eris 5 68 5 3 4 Input Output contact connection nennen neret nennen 5 69 5 3 5 5232 Port u a 5 69 5 3 6 RS485 Port
15. Standard angle W2 IB Winding 2 B Phase primary current magnitude angle W3 IB Winding 3 A Phase primary current magnitude angle Winding 1 B Phase secondary compensation current magnitude angle PHASE B CURRENT W2 CIB Winding 2 B Phase secondary compensation current magnitude angle W3 C IB Winding 3 B Phase secondary compensation current uim magnitude angle DIFF IB B Phase fundamental wave secondary differential current magnitude 2 26 X PNC TECH PAC T100 Transformer Protection and Control Unit DIFF2 IB B Phase 2 harmonics secondary differential current E magnitude DIFF5 IB B Phase 5 harmonics secondary differential current magnitude R IB B Phase fundamental wave secondary restraint current T magnitude Winding 1 C Phase primary current magnitude angle IC E Standard angle W2 IC Winding 2 C Phase primary current magnitude angle W3 IC Winding 3 C Phase primary current magnitude angle Winding 1 C Phase secondary compensation current WI C IC magnitude angle W2 C IC Winding 2 C Phase secondary compensation current magnitude angle PHASE C CURRENT W3 C IC Winding 3 C Phase secondary compensation current m magnitude angle DIFF IC C Phase fundamental wave secondary differential current magnitude DIFF2 IC C Phase 2 harmonics secondary differential current magnitude DIFFS IC C Phase 5 harmonics secondary differential current magnitude RI C Phase fundamental wave secondary restraint current
16. a lll lll ll T T 6 ST c6 ANSI Very Inverse 300 Multiplier 1 29 6 sq 42 lt 8 2 Fo 4 1 0 01 40 1 0 001 0 01 0 0001 i i ii i 400 1000 4000 Current ANSI Extremely Inverse 400 1 1 1 1 gt Multiplier 2 29 2 INT p01 2 1 0 01 0 1 0 001 0 01 0 0001 i i 1 E Eso ut r irii 1 400 1000 4000 Current PNC TECH PAC T100 Transformer Protection and Control Unit ANSI Definite Inverse 10 AN mad i d Multiplier Y x ES OE zs 2 4 1 6 95 44 2 a a ER a Roter 40 1 0 01 0 01 i 5 0 001 i Li 300 400 1000 2000 4000 Current 5 jMultiplier 10 5 2 2 i eo 1 40 1 0 01 0 01 i i LL iii iii 100 300 400 1000 2000 4000 Current 6 PN TECH 2 PAC T100 Transformer Protection and Control Unit 3000 1000 Multiplier 10 i gt E a E 0 01 0 001 i 1 i 1 i 200 300 400 1000 Current X5 sii idi i i 2000 4000 Overvoltage Inverse 4 Multiplier six 149 6 5 2 1 0 01 0 001 1 1 i i E YS L Sr 400 Woltage 24 PNC
17. set 9 j 1 0 001 1 300 400 1000 2000 4000 Current 75 IEC Long Inverse 15000 T 10000 1000 100 Multiplier 16 14 10 2 41 a 1 0 1 0 1 0 01 0 01 i i iii iii 100 200 300 400 1000 2000 4000 Current 25 PNC TECH PAC T100 Transformer Protection and Control Unit ANSI Inverse Multiplier 10 lt gt Bi 4 2 1 0 1 0 1 0 01 0 01 0 001 i i i 100 200 300 400 1000 2000 4000 Current 40 ANSI Short inverse 4 1 AMultiplier 29 Ee 16 4 o0 1 5 gt 32 z 4 3 0 01 0 1 0 001 0 01 0 0001 i nid 400 1000 2000 4000 Current PN TECH PAC T100 Transformer Protection and Control Unit ANSI Long Inverse T T T T T Ta Multiplier 10 5 4 2 lt gt a gt 1 0 1 0 1 0 01 0 01 i 100 200 300 400 1000 4000 Current ANSI Moderately Inverse H 51 10 Ur Multiplier n Rodi Aa i 10 5 i s 4 5 4 2 0 1 0 1 0 01 0 01 0 001 i i i i i i KA i i 1 200 300 400 1000 2000 4000 Current PNC TECH PAC T100 Transformer Protection and Control Unit errr rr
18. 2 25 Application example POWER SYSTEM setting 4 59 Terminal arrangement 5 65 X PNC TECH PAC T100 Transformer Protection and Control Unit 1 Overview gt a gt PAC T100 is multifunction relay that have all protection control and monitoring function This relay is equipped instantaneous percent differential phase ground neutral negative sequence overcurrent to maximum three by winding overexcitation protection element of single phase overvoltage undervoltage and is applicable to motor generator winding protection as well as two three winding transformer 100 has various measure and monitoring function such as quantity of electricity measure self diagnosis and trip circuit supervision TCS PAC T100 has setting groups for four protection and change and apply setting group according to system driving condition change and enables optimum protection This relay can be various and designs economically trip logic inter lock sequence and lock out function without external addition logic or connection by programmable logic Easy Logic Event and waveform recording function of PAC T100 offer driving history of necessary data and device to fault analysis PAC T100 has event and waveform recording data that is stored even if control power is lost Stored recording can analyze in PC after upload using front communication port in integration PC program PACManager
19. Inverse ANSI EI Definite Inverse ANSI DI KEPCO Normal Inverse KNI Very Inverse KVI Definite Normal Inverse KDNI 1 6 3 Negative Sequence Overcurrent Protection 46 46T Pickup 12 0 50 100 00 0 01 step Definite Time 0 00 60 00sec 0 01 step Time Multiplier TM 0 01 10 00 0 01 step TC Curve Is same a Phase Ground Overcurrent Protection 1 64 Restricted Ground Differential Protection 87G Pickup Current 0 20 2 50 0 01 step Slope Igd Imax 5 100 1 step Operating Delay 0 00 60 00sec 0 01 step 1 6 5 Overvoltage 59 Undervoltage 27 Protection Pickup Voltage 5 170V 1 step Definite Time 0 00 60 00 0 01 step Time Multiplier TM 0 01 10 00 0 01 step TC Curve Appendix C Inverse Characteristic Reference 1 6 6 Overexitation V Hz Protection 24 Minimum Voltage 5 50 1 step Pickup V Hz 1 00 4 00 V Hz 0 01 step Operating Delay 0 00 180 00sec 0 01 step 1 6 7 Circuit Breaker Failure Protection 50BF Trip Relay Binary Input 1 16 DII DI16 Pickup Current CB Closed 0 20 2 50A 0 01 step Operating Delay Trip Timer 0 00 60 00sec 0 01 step PAC T100 Transformer Protection and Control Unit 1 6 8 Cold Load Pickup COLDLD Current Detection Level 0 10 5 00A 0 01 step Operating Reset Delay 0 1000sec 1 step 1 69 Inrush Detection Inrush Minimum Current I1f 0 10 2 50 0 01 step Pickup I2f 11f 10 100 1 step Operating Delay 0 00 60 0
20. Load Pickup current shape FUNC RESET SETTING BLOCK PICKUP DELAY DELAY EVENT Figure 3 20 Cold Load Pickup operating characteristic SETTING PROTECT 1 4 COLD LD Setting Item Step Unit Description FUNCTION ENABLED DISABLED Whether functionuseornot sec 5 BLOCK EasyLogic operand U Protection blocking condition 6 EVENT ENABLED DISABLED Whethereventrecordornot PAC T100 Transformer Protection and Control Unit alen Metering and EasyLogic Operand LCD display Description COLD LD Cold Load Pickup detect Pickup COLD ID OP Cold Load Pickup detect Operation 3 29 Inrush Detection Inrush current detection element is used into expenditure that prevent malfunction of protection element from inrush current that occur when it is pressurization of long distance line transformer reactor etc When inrush current detection element is more than size that fundamental wave current 112 is set and ratio of 2 harmonics current 120 and fundamental wave current is more than setting value it is acting instantaneous definite time element Relay can control protection element operation during inrush current detection through Block setting that is to each protection element Inrush detection is applied only to transformer primary winding Wi lA gt Ht 126 W1 IB wie 227 OP
21. Pickup OR 59 1 OP Single phase Overvoltage 1 Operation OR Single phase Overvoltage 2 Operation OR x PNC TECH PAC T100 Transformer Protection and Control Unit pem M 3 2 6 Overexcitation protection V Hz 24 Overexcitation protection element is used to prevent damage of transformer by overexcitation It becomes overexcitation driving because saturated phenomenon happens and excitation current enlarges in case of drive transformer more than rated voltage or drives by rated frequency low Life time of transformer by overheats of malfunction and inside structure of percent differential relay at overexcitation driving is shortened and power dissipation is increased There are 2 overexcitation protection elements that act by definite time about single phase voltage input to relay Voltage uses single phase voltage input A phase To FREQUENCY PHS PT SEC setting of POWER SYSTEM must be confirmed when set pickup FREQUENCY Frequency setting POWER SYSTEM PHS PT SEC Phase PT Secondary setting POWER SYSTEM VA Phase A voltage measurement Frequency Frequency measurement Frequency VA Measure Frequency Calculate FREQU PHS PT FUNC MIN Figure 3 17 Overexcitation protection operating characteristic SETTING PROTECT 1 4 V Hz1 24 1 72 2
22. a B Phase restraint current 1 17 A a C Phase restraint current 1 17 A 4 4 Restricted ground fault protection measurement Winding 1 Current Voltage input Terminal Input value W1 1 30 0 0 WI IB 1 00 A 240 0 WI IC 1 00 120 0 0 50 A 0 0 Ground point CT Ratio compensation PHS RATIO I g GND CT RATIO E 400 200 40 50 1 00 0 0 310 1 1 t 0 30 A 0 0 Differential current Restraint current Igd B10 1 g Gi Differential current 1 00 0 30 0 70 A Imax MAX I I Ic m Restraint current 1 30 A PAC T100 Transformer Protection and Control Unit 5 Install and External connection 5 1 Dimensioned Drawings hi La d LEU J IL L a VIEW PANEL CUTOUT Protection 4 Control Unit 100 RUN TEST ERROR PICKUP TRIP FRONT VIEW SIDE VIEW Figure 5 1 PAC T100 Dimensioned Drawings x PNCTECH um PAC T100 Transformer Protection and Control Unit 5 2 Rear terminal arrangement plan zi n fuc 52 e a
23. and Control Unit 2 OPERATIONAL DESCRIPTION 2 1 Front Panel Front panel of 100 is consisted of graphic LCD 240x128 16linex30character 16 LEDs and 11 keypad buttons and RS 232C communication port This relay becomes to prevent malfunction by password input when operate setting value change or control keypad Protection function is achieved in interval that operate driving information through LCD and marks update in case of event of priority order occurs If connect PACManager on front RS232C port setting value change work of event fault waveform MIN MAX recording transmission is available conveniently to notebook Figure 2 1 Front Panel PNC TECH i PAC T100 Transformer Protection and Control Unit pec H x Jc H H rns Table2 1 LED LCD Function LED LCD Function 1 LCD 2 RUN TEST GREEN Lighting a LED when input control power Flicker a LED when it is contact output front display department test 3 ERROR RED Lighting a LED when occur system error LED status reset through RESET Key 4 PICKUP YELLOW Lighting a LED when is protection element pickup 5 TRIP RED Lighting a LED when is protection element operation LED status reset through RESET Key LIR LED GREEN Local RED Remote f Local Remote control possibility status display 3 GREEN Lighting a LED when c
24. can change as suddenly display is white If is pressing down V key continuously LCD screen brightness changes continuously Relay escapes LCD CONTRAST screen if press lt key after setting ends X PNC TECH 2 100 Transformer Protection and Control Unit preneur um cuoc amc xoxo 3 Function 3 1 General SETTING menu is to display or change setting value that need in function achievement of relay The present setting value can be confirmed by front key handling But in case of change setting value Input password should be confirmed Setting by front panel 1 Press gt key after select change item to use down V key in details menu to change setting value 2 Press ENTER key after input SET password using down V key moving by each position using left S gt key in case of ask password in last line of screen Password initial value is 0000 3 After input right password setting value blinks if press gt key In case of inputted wrong password relay asks password again 4 Press ENTER key after select value that wish to set pressing down V key 5 If press left key before press ENTER key relay returns by setting value ago 6 In case of return by early screen using left key relay asks
25. circuit breaker according to 2 contact input statuses in case of use 2 by contact input If use 2 digital inputs can not control circuit breaker judging that problem is to point of contact connection of circuit breaker or circuit breaker if status of point of contact is same If status of CB is shown abnormally confirm setting of contact input activation of set contact input and connection status SETTING SYSTEM BREAKER 1 2 Setting Item Step Unit Description 4 CLOSE PULSE 0 1 5 0 0 1 Circuit breaker Close control pulse 21 5 52 Circuit breaker status 52A contact input CONT IN 1 CONT IN 16 E NONE Circuit breaker status judgment by 52a Circuit breaker status 52B contact input NONE Circuit breaker status judgment by 52b Whether allowable local control for circuit breaker or not DISABLED In local circuit breaker control prohibition 6 52b INPUT NONE CONT IN 1 CONT IN 16 7 KEY CTRL ENABLED DISABLED PAC T100 Transformer Protection and Control Unit EE REI EXE EI 3 3 3 Trip circuit supervision TCS This is alarming function is case the status of a contact input feedback from trip contact output keeps O status for more than 5 minutes To monitor without CB open close status information CB aux contacts 52a 52b and resistance are required Trip Contact NA a ANN R
26. key in case of ask password If press SELECT key after input right password picture of circuit breaker blink If press SELECT key better two times in case of want control of the second circuit breaker picture of the second circuit breaker blink Press OPEN or CLOSE key according to user s intention and controls circuit breaker If do control command such as present state in case of phrase which is already present state orders LCD to appear for the lower line and differs with present state the command phrase LCD for the lower line appear and contact output that control command is established acts When control local CB password must be input Can control in high position communication or SCADA through RS485 communication after make control authority of circuit breaker through circuit breaker control authority change method by Remote status in case of want circuit breaker control in Remote 2 2 3 The other display Time registered under LCD for line means now system time and EVENTS WAVES displays recorded event fault data number Setting group of protection element that 861 is applied present means GROUP 1 T2R2 display of LCD first line marks transmission of RS485 communication and reception T1 means tx data of COMI and R1 means rx data of COMI and T2 means tx data of COM2 and R2 means rx data of COM2 224 Display switchover Relay is switched o
27. m T 463 02 msec 2 500 26 msec Delta T 3124 957 204 2 78 ul File Name demo Trigger Time 2004 1 15 12 8 320 00 Figure 3 23 PACManager Waveform Analysis Recorded waveform are listed up in LCD and uploaded to PACManager locally or by SCADA remotely Waveform recording is kept even if power of relay is lost Waveform is of COMTRADE file format so that it can be used for fault simulation with fault analysis and relay test equipment SETTING SYSTEM WAVEFORM RECORD Setting Item Step Unit Description 1 TYPE 8580 44160 24320 Cycle Waveform save number and capacity 8550 8 Number 80 2 TRIGGER SRC FasyLogicoperan 2 Trigger source seting 0000 3 TIRGGER POS 0 99 1 Trigger position setting 40 Waveform 40 before trigger waveform 60 after trigger X PNC TECH a PAC T100 Transformer Protection and Control Unit pasa sas Y 3 3 2 Circuit breaker control Relay can set up necessary setting to control circuit breaker 2 in SETTING SYSTEM BREAKER ID of circuit breaker can set 12 characters Each character should be set by English upper lower case digit spatial character registered to keyboard Each circuit breaker status can use one of 52a and 52b by contact input or use everybody by contact input Mark status of circuit breaker according to status of contact input in case of use contact input 1 relay marks status of
28. 0sec 0 01 step 1 6 10 Protection Elements Accuracy Pickup 3 of Setting Value Operating Time 2396 or 40msec of Setting Value Dropout Level 96 98 of Pickup Value Dropout Time Less than 40msec Angle 43 1 7 Additional Function 1 71 Measurement Current Three winding 3Phase current RMS Angle 0 05 250 0 5 0 5 45 1 090 gt 45 Voltage Single phase voltage RMS Angle 1 450V 0 5 Frequency Single phase voltage standard 40 70 Hz 0 002Hz Sequence Current Three winding Positive Negative Zero Sequence RMS Angle Differential Current Fundamental Wave 274 Harm 5 Harm Differential Current Restraint Current Fundamental Wave Restraint Current Compensation Current Three winding 3Phase Compensation Current RMS Angle 0 5 250 A Magnification by winding Three winding Current Magnitude Compensation Factor Reference Winding Phase Compensation Reference Winding Display TECH ew PAC T100 Transformer Protection and Control Unit 172 Recording Event Recording Maximum recording number 1024 Resolution 1msec Event Item Protection Status Current Voltage inclusion Contact Input Output Status Setting Change Circuit Breaker Control Control Power On Off Recording Data Clear Circuit Breaker Output Number Change etc Features When produce protection element event quantity of electricity Three winding Current Voltage Differential Current Restraint Current Magnific
29. 2 18592 ANSI Moderately Inverse 0 0228 ANSI Very Inverse ANSI Extremely Inverse ANSI Definite Inverse KEPCO Normal Inverse KEPCO Very Inverse KEPCO Definite Normal Inverse Overvoltage 59 Inverse Undervoltage 27 Inverse In the case of overcurrent protection element operating time of current is equal with operating time of 2000 more than 2000 of setting current In the case of overvoltage protection element operating time of voltage is equal with operating time of 800 more than 80096 of setting voltage PAC T100 Transformer Protection and Control Unit pu T 6 6 6 6T T 65T 6 6 8 TT 6 6 6 5T LT T 6T 6T T T T8T 85T5T86T T T5T57 7 IEC Normal Inverse 1000 4jiMultiplier 10 6 4 2 2 1 1 490 1 0 1 0 01 100 200 300 400 1000 2000 4000 Current 26 IEC Very Inverse 2000 E 1000 100 10 Multiplier 5 a z 1 EDI 0 1 40 1 0 01 0 01 0 001 i i i Pal 400 1000 2000 4000 Current 25 PNC TECH _ PAC T100 Transformer Protection and Control Unit 7 gt 2 7 7 2 gt 7 777 7 gt 7 77 7 2 Extremely Inverse 5000 1000 Ace WII ME PIE Multiplier pee e PEDRE RES 4 5 4 553 i 4 Time
30. 4 2 Setting Item Step Unit Description 1 FUNCTION ENABLED DISABLED Whetherfunctionuseornot 2 PICKUP 1 00 4 00 0 01 V Hz V Hz Pickup Input voltage rated voltage Frequency metering rated frequency 5 operand Protection blocking condition 6 EVENT ENABLED DISABLED jWhethereventrecordornot Metering and EasyLogic Operand LCD display Item Description FREQUENCY Single phase voltage frequency 24 PKP Overexcitation protection Pickup OR 24 1 OP Overexcitation protection 1 operation 24 2 OP Overexcitation protection 2 operation x PNC TECH i PAC T100 Transformer Protection and Control Unit cn 6G T6Tr 5 C CT 3 2 7 Circuit Breaker Fail Protection 50BF After circuit breaker fail protection passes fault exclusion expectation time after relay displays trip signal to circuit breaker for fault origination in case current passes continually it is the second protection element that do it so that may act circuit breaker of high position system by circuit breaker fail signal and does so that remove fault It operates when phase current W1 IA W1 IB W1 IC is over pickup after expectation trip delay time passes moving to set Trip point of contact relay acts Trip contact output setting is possible to CONTACT OUTPUT 1 CONTACT OUTPUT 6 Circuit breaker fail protection is applied only to transformer primary winding WLIA gt
31. 87 and current ratio differential element 87T and restraint current arithmetic 1 dl w 1 2 3 winding w w w w margin I w rated M w W reference winding ane T Phase Quantity Compensation example Transformer Setting Unit TYE 2 5 INTERNAL 12 D WIW3PHS eg Winding 1 5 GROUNDING Winding 2 E 3 PHS CT RATIO 4 GND CT RATIO 5 GROUNDING 1 Phase compensation Reference winding winding winding 1 X PNC TECH PAC T100 Transformer Protection and Control Unit Phase compensation value w1 0 0 0 Ow2 0 30 330 lag Ground current remove 0 0 reference Winding 1 phase compensation 14 Jis 15 ske 1 431 1 431 Winding 2 phase compensation I 1 431 B 1 ii 11431 1 31 2 Rated current arithmetic 60 60 I 224 944 2 1506 13A N3 e154kV 44 3 Rate of margin arithmetic Tou kabi eo I 224 94 1506 13 Secondary winding that rate of margin is less becomes standard winding W 4 Current compensation value arithmetic M 1 154240 4017 M 2 23 400 1 000 23 e 400 230400 5 Current magnitude phase compensation current 14 w 1 I c w 1 eM w Iw 1 eM w e M w SETTING SYSTEM POWER
32. C T100 Transformer Protection and Control Unit E In case of circuit breaker status is registered by Error 52a input and 52b input of circuit breaker were set by all None or when function of set digital input is set by DISABLED set according to circumstance in case of it is None because it is and must set function of relevant digital input through EasyLogic Editor of PACManagerTM by EANBLED in case digital input is set by DISABLED Must set normally after inspect catenate status of digital input and status of circuit breaker because mean that status of circuit breaker 52a digital input and 52b digital input has same cost in case of circuit breaker status is registered by trouble m8 In case of control authority must become local and controls circuit breaker in remote through communication in case of control circuit breaker on the spot control authority must become remote Press L R key in case of control authority setting differs and must change control authority Circuit breaker control authority change is as following key gt Control Password input gt ENTER key gt L R key Circuit breaker control authority change is possible in local When make control authority of circuit breaker by local to control circuit breaker on the spot I press SELECT key I press ENTER key after input control password moving particularly each position using down V left S right gt
33. E 5 100 Low current area ratio setting 20 20 High current area ratio setting 5 KNEE POINT 5 0 100 0 0 1 A Border current of low current area and high current area 2 harmonics differential current fundamental wave differential current 100 7 5 0 40 0 5 0 40 0 5 harmonics differential current fundamental wave differential current 100 DELAY 0 00 60 00 sec Operating delay time 0 BLOCK EasyLogic operand Protection blocking condition Whether event record or not 4 SLOPE2 6 H 2ND 5TH Harmonics restraint element selection 2ND 5TH NONE Harmonics restraint element not use 2ND 2 harmonics use 5TH 5 harmonics use 2ND 5TH 2 harmonics 5 harmonics use 8 15011 E sec 11 EVENT ENABLED DISABLED PAC T100 Transformer Protection and Control Unit ee Metering EasyLogic Operand LCD display Description WI C IA IB IC 27 Phase compensation current Secondary magnitude W2 C IB IC 2 Phase compensation current Secondary magnitude W3 C IA IB IC ae A B C Phase compensation current Secondary magnitude DIFF IA IB IC A B C Phase differential current Secondary magnitude DIFF2 IA IB IC A B C Phase 2 harmonics differential current Secondary magnitude DIFF5 IA IB IC A B C Phase 5 harmonics differential current Secondary magnitude R IA IB IC A B C Phase restraint current Secondary magnit
34. ER SET uqaaassassssqanqaqsswasqusssaqaqqussaqaqqassaqaqwaqsyapaysqaqsaqyaqaqtanyaqaqqawyaqayakaysass 2 29 2 5 6 LCD ICONIRAST ig ERREUR ed CR MEETS 2 30 3 KUNGION rtc 3 31 3 1 GENERAL AA AA AA AA 3 31 3 1 1 2 5 3 31 3 12 PASSWORD unu Sua au 3 31 3 1 3 POWER SYSTEM Jasa an eiae iiem euenit 3 31 3 1 4 PEGS AA 3 32 3 2 PROTECTION eio mieten 3 35 3 2 1 Instantaneous percent differential protection 50 87 87T 3 35 3 2 2 Phase Ground Overcurrent Protection 50 51 50 5 3 38 3 2 3 Negative Sequence Overcurrent Protection 46 46T 3 42 3 2 4 Restricted ground fault protection 87G essere 3 44 3 2 5 Overvoltage Protection 59 Undervoltage Protection 27 3 46 3 2 6 Overexcitation protection V Hz 24 3 49 3 2 7 Circuit Breaker Fail 50 3 50 3 2 8 Cold Load Pickup COLDLD u u u u 3 51 3 2 9 Tnr sh Detection ERR 3 52 3 3 SUBSIDIARY FUNCTION 1 2003030030 eter tiro eo eor te eere E n NGANGA 3 53 3 3 1 Record M Jana 3 53 3 3 2 Circuit breaker control KINANA KUNG AN
35. SYSTEM TRANSFORMER Setting item Range Step Unit Description Transformertype 2 5 INTERNAL EXTERNAL Phase compensation method INTERNAL Software EXTERNAL Compensation by outside CT wiring 3 W1 W2 PHS 0 30 60 270 300 330 o lag Winding 2 for winding 1 winding 3 for 4 W1 W3 PHS winding 1 lag phase angle SETTING SYSTEM POWER SYSTEM WINDING 1 3 Setting item Range Step Unit Description 5 GROUNDING YES NO Winding grounding selection Metering and EasyLogic Operand LCD display Item Description x PNC TECH i PAC T100 Transformer Protection and Control Unit Current magnitude compensation reference winding W Winding 1 current magnitude compensation factor M 1 Winding 2 current magnitude compensation factor M 2 Winding 3 current magnitude compensation factor M 3 3 2 Protection Protection element setting of relay is attained through SETTING PROTECT x Protection element 15 instantaneous percent differential protection 50 87 87T phase ground overcurrent protection by windings 50 51 50 51 negative sequence overcurrent protection by windings 46 46T restricted ground fault protection by windings 87G circuit breaker fail protection 50 cold load pickup inrush detection FUNCTION BLOCK EVENT There is setting item that select FUNCTION BLOCK EVENT to all protection elements commonly This setting item can run prote
36. TECH PAC T100 Transformer Protection and Control Unit Undervoltage Inverse T T Tue 1 5000 1000 PW Multiplie 1 6 1032 1 H 2 25775 1 0 1 0 1 0 01 L iit prex p 1 2 20 Woltage 24 PNCTECH 100 Transformer Protection and Control Unit Technologies Ltd Head of Office amp Factory Address 898 43 Hogye dong Dongahn gu Anyang Kyongki do 431 080 Korea Phone 82 314525791 82 314525793 Seoul Office Address SF Kwangmyong B D 115 3 Bangi dong Songpa gu Seoul 138 830 Korea Phone 82 2 22408106 Fax 822 22408188 Homepage http www pnctech co kr
37. Unit Description 1 FUNCTION ENABLED DISABLED Whether functionuseornot 2 CURVE NI Inverse curve setting IEC NI IEC Normal Inverse VI IEC Very Inverse IEC EI IEC Extremely Inverse LI IEC Long Inverse ANSI 1 ANSI Inverse ANSI SI ANSI Short Inverse ANSI LI ANSI Long Inverse ANSI MI ANSI Moderately Inverse ANSI VI ANSI Very Inverse ANSI EI ANSI Extremely Inverse ANSI DI ANSI Definite Inverse KNI KEPCO Normal Inverse KVI KEPCO Very Inverse KDNI KEPCO Definite Normal Inverse 4 MULTIPLIER 0 01 10 00 0 01 Time Multiplier 4 BLOCK Protection blocking condition S EVENT ENABLED DISABLED Whethereventrecordornot Metering and EasyLogic Operand LCD display Item Description Wx 50 51 PKP Winding x Phase overcurrent protection Pickup OR 50 51 Winding x Phase overcurrent protection Phase Pickup Wx 50 1 OP Winding x Instantaneous definite time phase overcurrent protection 1 operating OR Wx 50 1 OP B C Winding x Instantaneous definite time phase overcurrent protection 1 A B C Phase operating Wx 50 2 OP Winding x Instantaneous definite time phase overcurrent protection 2 eba operating OR Wx 50 2 Winding x Instantaneous definite time phase overcurrent protection 2 A B C Phase operating Wx 51 OP Winding x Time d
38. User Manual PAC T100 Transformer Protection and Control Unit P amp C Technologies Ltd 100 Transformer Protection and Control Unit Safety Caution It is contents to keep away user s safety and damage of property Use rightly after read manual attentively certainly Manual will be kept in place that a person who use product can see well In case of missed instructions user can die or wound severe wound Warning In case of missed instructions user injures or property damage can occur Caution TECH PAC T100 Transformer Protection and Control Unit 3 REVISIONS REV Date Description Reason 1 July10 2009 1 English translation 100 Transformer Protection and Control Unit Sa i Table of Contents 1 OVERVIEW 1 7 1 1 CHARACTERISTICS 1 8 12 APPLICATION 1 9 13 GENERAL SPECIFICATION 1 10 1 3 1 Rated Control Power sess enne trennen enn 1 10 1 3 2 M 1 10 1 3 3 CUNG In ABAD NN AN NAN AS ANA I ML 1 10 1 3 4 Binary 1 10 1 3 5 Binary put 1 10 1 3 6 Communication Interface eet ete tu E ee ere 1 11 1 3 7 AT AA 1 11 E
39. Y transformer that delta winding does not exist is standard winding PAC T100 removes ground current about transformer external grounding fault automatically by changing wye winding by delta connection via delta winding as software Y Y or Y Y Y wiring that consist of YES in GROUNDING setting of SETTING SYSTEM POWER SYSTEM WINDING 1 3 only in TECH PAC T100 Transformer Protection and Control Unit E ii ssr r occasion ground current compensation expression apply Setting and phase compensation expression refer attachment A phase compensation formula and attachment B transformer type and compensation angle in transformer type Current quantity compensation Current magnitude compensation does winding that rate of margin about rated current of each winding is the lessest by standard winding That is saturation margin of CT compensates current magnitude of modulo winding via the lessest winding Have NORM VOLT Vpoml w RATED LOAD Pratea w PHS RATIO CTratio of SETTING SYSTEM POWER SYSTEM WINDING 1 3 and relay calculates rated current Imargin W by winding Relay calculates CT margin Imargin w using rated current by winding that run arithmetic Choose winding that CT margin is less by standard winding Wer and calculates magnitude compensation value of each winding about standard winding Wer Magnitude compensation value is applied in differential current of high overcurrent element 50
40. ailed contents for property curve expect to refer to Appendix C Time Characteristics Curves Wx Winding x I2 Negitive sequence phase current Calculate Figure 3 9 Instantaneous definite time negative sequence overcurrent protection operating characteristic X PNC TECH dk PAC T100 Transformer Protection and Control Unit Wx Winding x 12 Negitive sequence phase current Wx 1 gt gt 2 Wx gt gt gt gt MULTIP Figure 3 10 Time delay negative sequence overcurrent protection operating characteristic TTING PROTECT 1 4 Winding 1 3 NSOC1 Wx 46 1 NSOC2 Wx 46 2 Setting Item Step Unit Description 1 FUNCTION ENABLED DISABLED Whetherfunctionuseornot 2 PICKUP 0 50 100 00 0 01 Negetive sequence current Pickup SE 3 DELAY 0 00 60 00 Operation delay time 4 BLOCK EasyLogic operand Protection blocking condition 5 EVENT ENABLED DISABLED Whether eventrecordornot SETTING PROTECT 1 4 Winding 1 3 TNSOC Wx 46T Setting Item Step Unit Description 1 FUNCTION ENABLED DISABLED Whetherfunctionuseornot 2 NI Inverse curve setting Is equal with phase overcurrent protection element 4 MULTIPLIER 0 01 10 00 001 Multiplier 4 BLOCK FasyLogic operand Protection blo
41. ansformer Protection and Control Unit 150 330 0 180 pa 210 330 0 120 EN 330 T 330 0 0 DYY 30 30 5 0 330 330 210 ja 0 330 150 150 150 3 0 210 210 N 330 0 210 30 N gt lt Db gt b 4H lt lt lt lt as H gt 210 30 1 0 150 330 23 210 1 0 150 150 330 150 H 0 30 210 330 5 0 30 30 DYD 30 60 1 0 330 300 5 76 PAC T100 Transformer Protection and Control Unit 2 240 3 330 120 150 0 5 210 0 FY 120 x 210 240 IN 180 lt 210 180 23 300 210 60 Zu X 210 0 7 1 150 0 N 60 150 300 240 A 4 150 120 330 0 3 2 30 0 120 A 30 240 180 1 NZ 30 180 N 300 n 30 60 5 77 PAC T100 Transformer Protection and Control Unit DD Y 0 30 T 4 0 0 300 150 A 2i 0 0 210 N N 210 1 0 0 150 25 2 330 t 1 0 0 30 60 30 1 1 0 300 330 210 n 1 0 300 150 x 120 150 pa 0 240 210 IN 330 3 0 240 30 A gt gt 180 150 1 0 180 210 J 330 NZ 0 180 30 N gt 240 30 x 4 0 120 330 210 0 120 150 N T 100 Transformer Protection and Control Unit
42. ation by winding together recording Even if control power is lost data is kept Waveform Recording Maximum recording number Maximum eight according to setting Sample number per cycle 32 samples cycle Record Type Block x Cycle 2x320 4x160 8x80 Trigger Position 0 99 1 step Trigger Condition Setting by Logic operand Sample Data Current Voltage Protection Status Pickup Operation Contact Input Output Status Features COMTRADE IEEE C37 111 File Format Even if control power 15 lost data is kept 1 7 3 Sequence Logic EasyLogic Operand Circuit Breaker Open Close Control Protection Operation Status Self diagnosis Status Monitoring Operation Status Contact Input Status Logic Operation Status Operator AND 2 8 inputs OR 2 8 inputs NAND 2 8 inputs NOR 2 8 inputs NOT 5 8 Timer On Off Pulse Features Up to 48 operators can be used Sequence logic is composed using Operand Operator 174 Control Circuit Breaker Number 2 CB Interlocking Through EasyLogic freely composition possibility Local Control Control because use KeyPad for control Malfunction prevention by password input Remote Control Control through rear RS 485 communication port or contact input Setting Group Number 4 Setting Group Local Control Through KeyPad change in Setting System Power System Remote Control Change through rear RS 485 communication port X PNC TECH 100 Transformer Protection
43. ation value Ow 0 30 30 lag Ow2 0 0 0 Ground current remove 0 0 Compensation Table reference P UN31 1 3l 1 43 1 v3i E Winding 1 phase compensation 21 431 1 431 ar Winding 2 phase compensation Reference winding magnitude compensation value Rated current calculate 60 60MVA 224 94 I 4 2 2 1506 13A 43 e154kV 42 CT margin ratio calculate magnitude reference winding winding 2 80 400 Inagin ll 0 35 pee P 0 27 224 94 1506 13 Magnitude compensation value calculate 2304 mm Cia az 2100 230400 23 400 current Secondary If apply phase and magnitude compensation value compensating current by winding is following m Winding 1 1 N3 14 0 1 7 120 1 34 1 34 A 330 0 Winding 1 B Phase 1 V3 12240 12Z 0 1 34 1 34 A 210 0 Winding 1 C Phase 1 V3 1 Z 120 1 Z 240 1 34 1 34 A 90 09 Winding 2 1 1 1 00 1 00 A 150 0 m Winding 2 B Phase 1 1 1 00 1 00 A 30 07 Winding 2 C Phase 1 1 1 00 1 00 A 270 0 Differential current Restraint current m A Phase differential current 0 34 A a B Phase differential current 0 34 A PNC TECH PAC T100 Transformer Protection and Control Unit NO EIER gr m C Phase differential current 0 34 A A Phase restraint current 1 17
44. cking condition S EVENT ENABLED DISABLED Whether eventrecordornot Metering and EasyLogic Operand LCD display Item Description Winding x Negative sequence Secondary current magnitude angle 46 Winding x Negative sequence overcurrent protection Pickup Wx 46 1 OP Winding x Instantaneous definite time negative sequence overcurrent protection 1 operation Winding x Instantaneous definite time negative sequence overcurrent Wx 46 2 OP protection 2 operation Wx 46T OP Winding x Time delay negative sequence overcurrent protection oe operation x PNC TECH PAC T100 Transformer Protection and Control Unit p 3 24 Restricted ground fault protection 87G Because restricted ground fault protection element is small magnitude of fault current can not detect by percent differential protection element 87T Near these occasion transformer grounding point winding more between to microscopic grounding fault detection such as short circuit apply Differential current used to restricted ground fault protection element is difference of three phase current vector sum 310 by winding and CT current Ig placed in GND Restraint current uses maximum value of three phase current Restricted ground fault protection element is acting definite time element according to ratio setting of restraint current Imax and differential current Ied Res
45. ction function in particular condition if connect with EasyLogic When FUNCTION is enabled and input of BLOCK setting is logic l function of protection element 15 suspended Protection function does not act if FUNCTION 15 disabled and event 15 not recorded If EVENT is disabled even if FUNCTION 15 enabled event is not recorded 3 2 1 Instantaneous percent differential protection 50 87 87T Current differential protection is consisted of percent differential protection 87T that have instantaneous differential protection 50 87 that act by difference current magnitude regardless of magnitude of restraint current and acts according to ratio property of restraint current and differential current magnitude Differential current Restraint current calcurate 3 1 4 Relay calculates differential current DIFF IA DIFF IB DIFF IC and restraint current R IA R IB R IC by compensating current of each winding that phase compensation expression explaining in transformer magnitude compensation by CT ratio difference ground current compensation etc are applied Differential current by each phase is vector sum of each winding compensating current and restraint current is 1 2 of scholar sum DIFF I 2 IS 3 Differential current DIFF IB I 1 1 2 iS 3 DIFF 1 1211 412 21 123 IA in 1221 11 213 2 Restraint current R B is 1 In 2 4 15 2 Mw 1 1 Winding R die 15 2 NG 2 co
46. d ES 1 11 1 4 1 Insulation Vests 555 easet tte teh oet 1 11 14 2 NISL m 1 12 1 4 3 Macha ical 8825 us 1 13 1 4 4 Temperature and Humidity esee rennen nennen nre 1 13 1 5 EAE RESER 1 14 1 6 PROTECTION DETECTION 1 14 1 6 1 Current Differential Protection 50 87 87 1 14 1 6 2 Phase Ground Neutral Overcurrent Protection 50 51 S0N 51N 1 15 1 6 3 Negative Sequence Overcurrent Protection 46 467 1 15 1 6 4 Restricted Ground Differential Protection 87G a 1 15 1 6 5 Overvoltage 59 Undervoltage 27 Protection sss 1 15 1 6 6 Overexitation V Hz 24 1 15 1 6 7 Circuit Breaker Failure Protection SOBF 1 15 1 6 8 Cold Load Pick up COLDLD 1 16 1 6 9 Inrush 4 1 1 16 1 6 10 Protection Elements 1 16 127 ADDITIONAL FUNCTIONS 1 16 1 7 1 NUES siasa aswa 1 16 1 7 2 Recor
47. d does not ask Relay escapes in test display if press left S key in case of do not want test for contact output more 2 5 4 PANEL TEST It is menu to test 16 LEDs and LCD in front panel If test front panel all LEDs are turned during 1 second and 100 character is expressed to LCD And these tests are repeated 3 times Panel test 1 Press right gt key after find PANEL TEST in COMMAND menu 2 Press key after input SET password using down V key moving by each position using 1 lt key in case of ask password in last line of screen 3 After input right password test is executed if press gt key Relay is converted in COMMAND menu screen after test is executed 3 times 2 5 5 TRIP COUNTER SET It is menu to change trip counter of two circuit breakers When change relay singleness must set circuit breaker trip counter ago relay replace for circuit breaker supervision TRIP COUNTER SET change 1 Press gt key after find TRIP COUNTER SET in COMMAND menu 2 Circuit breaker that want change in circuit breaker trip counter setting display presses up A down V key and selects Press right gt key after select circu
48. dary magnitude m Winding 2 current Phase Secondary magnitude m Winding 3 current Phase Secondary magnitude m A B C Phase differential current Secondary magnitude m A B C Phase restraint current Secondary magnitude Winding 1 3 N Phase current Secondary magnitude Winding 1 3 current magnitude compensation Factor Recorded events are listed up in LCD and uploaded to PACManager locally or by SCADA remotely Event recording is kept even if power of relay is lost Be PAC P110 ppj PACP110Set D xj File F Group Help H x TECH System Protection Easylogic 2007 04 18 17 14 49 629 2007 04 18 17 15 28 311 2007 04 18 17 15 28 910 2007 04 18 17 15 28 910 2007 04 18 17 15 58 320 2007 04 18 17 15 58 388 2007 04 18 17 15 58 479 2007 04 18 17 15 59 550 2007 04 18 17 15 59 694 2007 04 18 17 15 59 696 2007 04 18 17 15 59 850 2007 04 18 17 16 04 213 2007 04 18 17 16 04 222 2007 04 18 17 16 04 359 2007 04 18 17 16 05 518 2007204718 17 16 07 3NG Event Waveform Monitoring Event Data CLEAR orm Captured CAP CTRL 4 On System Reset Power Breaker 1 Trouble Breaker 1 Trouble ProtPkp OCR f 0 00 2 109 94 0 0 la 10 004 258 9 Vb 110 14 240 67 Ib 9 994 148 7 Vc 109 88 120 4 9 994 28 7 ProtPkp OCR C ProtPkp OCR B ProtOp IOCR A Prot Relse OCR B C Prot Relse OCR
49. diagram a choice circuit breaker name system time setting group of present are registered to early screen 100 1 1 2 007 02 04 14 49 Figure2 2 LCD Karly screen 2 2 1 Measured data Early measurement screen of PAC T100 is consisted of total 6 and each item can confirm using up and down direction key Composition contents of early measurement screen are same lower part Table 2 3 LCD Early measurement screen item LCD display item Description 2 2 2 Circuit breaker status display and control Control authority of circuit breaker and present state of circuit breaker are registered by LED though circuit breaker sets function of SETTING SYSTEM BREAKER BREAKER ZI by EANBLED and picture of circuit breaker is expressed on LCD screen Circuit breaker is not expressed and must set function of SETTING SYSTEM BREAKER BREAKER 1 by EANBLED in case of LED of circuit breaker controlling means have turned off on LCD screen Circuit breaker is not expressed even if BREAKERZI s function is set by DISABLED and BREAKER 2 s function was set by EANBLED In case of circuit breaker was set normally status is registered by open or close in LCD BREAKERZI s function is set by EANBLED and circuit breaker was expressed LCD screen must set circuit breaker setting again after it is rapidly if the subroutine appears as absurd 4 m and circuit breaker status LED open close flickers x PNC TECH PA
50. ding uns tn sus S MH ease aoe EU I E 1 17 1 7 3 Sequence Logic HasSyLO gic UB 1 17 1 7 4 1 17 2 OPERATIONAL DESCRIPTION 2 18 2 1 FRONT PANEL 2 18 2 2 AREY SCREEN 2 20 2 2 1 Measured uuu uu 2 20 2 2 2 Circuit breaker status display and 2 20 2 2 3 The other display css Rt br n E ahha 2 21 2 2 4 Display switchover 2 2 21 2 2 5 LED Latched Status Cleat AA ala 2 22 23 MENU SIRUCFUREDISPEAY 2 22 DISPLAY N 2 24 2 41 STATUS 2 24 2 4 2 METERING S am E 2 25 2 4 3 RECORD AT UU 2 27 2 4 4 2 28 2 5 COMMIAND assent rst m BADA ANING BARIL aha 2 28 2 5 1 CLEAR EVEN Dresnae a a AS T 2 28 2 5 2 CLEAR WAVEFORM 2 28 x PNCTECH us PAC T100 Transformer Protection and Control Unit N 2 5 3 CONTACT OUT TEST uuu 2 29 2 5 4 PANEL TEST eiecit nere EDO EO RU PSI nias TRIES HORE EFE NO EM 2 29 2 5 5 TRIP COUNT
51. ds fault informations winding 1 3 current voltage differential current restrain current and Magnification by winding Event record is shown through LCD and confirmed in local or remote through PACManager DISPLAY RECORD WAVEFORM shows total number of recorded fault waveform trigger time and trigger data stored in memory Trigger source and block element simple explanation is included in fault contents Relay does record possibility to block of maximum eight according to waveform recording setting Resolution is 32 samples per cycle and maximum write time per block is 6 4 seconds 50 2 2 block standards Waveform recording have Current voltage contact input output status sample data of protection element operation status and is confirmed in local or remote through PACManager to upload Waveform recording is recorded to COMTRADE file This file can do fault analysis and use in fault reappearance through protection relay tester 2 4 4 SYS INFO DISPLAY SYS INFO shows version Information of MPU and DSP 2 5 COMMAND This menu has several command as follows power energy delete event delete waveform record delete thermal data clear MIN MA X data clear contact output test front panel test circuit breaker counter setting and LCD contrast setting 2 5 1 CLEAR EVENT This menu clear event data stored to PAC T100 If run Clear Event all of the stored event data are initialized Event clear 1 Press gt key afte
52. e j ER js ma REAR VIEW Table 5 1 Terminal arrangement com so E WA cou Jerse xo sro wo loa 155 8 ja ons e n NC 8716 NC o sr poe psp IN 1287 Bier 020208088 120228 12813 ps wana 157 69 12 cows awa l misser puer W2 8 W2 IN To wa hos ma xo sr pus 16COM ia nsass 10 27 ws 12 W3 IN 2 8 Biv mw nses 20 nsesicowpo a m suncE eo Rsass acowas sumce bol is SURGE 100 Transformer Protection and Control Unit pm HM M H x 5 3 External Connections 5 31 PAC T100 three windings transformer CT connection PAC T100 151 152 Wi 153 C W1_IB 20 W1 IC TS5 TS6 _ lt 1757 TS8 59 12551810 W2_IA 3 21011 512 z T8138 1514 0 0
53. e protection operating characteristic PNC TECH PAC T100 Transformer Protection and Control Unit 27 PKP INVERSE FUNC MULTIP Figure 3 16 Inverse time undervoltage protection operating characteristic SETTING PROTECT 1 4 59 OV1 59 1 SETTING PROTECT 1 4 UV 27 UV1 27 1 Setting Item Step Unit Description 1 FUNCTION ENABLED DISABLED Whetherfunctionuseornot 2 PICKUP 5 170 1 Voltage Pickup 4 DELAY 0 00 60 00 Operation delay time 5 BLOCK operand _ Protection blocking condition 6 EVENT ENABLED DISABLED Whether eventrecordornot TECH PAC T100 Transformer Protection and Control Unit SETTING PROTECT 1 4 59 2 59 2 SETTING PROTECT 1 4 UV 27 UV2 27 2 Setting Item Step Unit Description 1 FUNCTION ENABLED DISABLED Whetherfunctionuseornot 2 MODE DT INVERSE Operating Mode setting DT Definite time INVERSE Inverse time 4 MULTIPLIER 001 10 00 000 00000000 5 __ Protection blocking condition 6 EVENT ENABLED DISABLED Whether event record or not Metering and EasyLogic LCD display Description Single phase primary voltage magnitude angle 59 PKP Single phase Overvoltage
54. ecognition Time Less than 10ms PAC T100 Transformer Protection and Control Unit 1 3 6 Communication Interface Front Panel RS 232 for 19200bps fixed 8bit No parity 1 stop ModBus Protocol Rear Panel 2 Galvanic Isolated for SCADA Communication is ModBus exclusive use 300 38400bps 8bit No parity 1 stop Modbus DNP3 0 IEC60870 5 103 Protocol 1 3 7 Case Structure Draw out type Quality of the material Fe Weight 6 5kg Terminal U spade Ring lug Inside diameter 5mm Maximum outside diameter 12mm 1 4 Test 1 4 1 Insulation Tests Insulation Resistance Standard IEC60255 5 ANSI IEEE 37 90 0 Detail Contents 500 V DC Circuit Case 10 Circuit Circuit 5 Contact Contact 5 Insulation Withstand Test Standard IEC60255 5 ANSI IEEE 37 90 0 Detail Contents For 1 minute 50 60 Hz Circuit Case 4kV Circuit Circuit 4kV Contact Contact 2 kV Impulse Voltage Withstand Test Standard 1 60255 5 ANSI IEEE 37 90 0 Detail Contents Waveform 1 2x50us Permission Counter 3th each Positive Negative Polarity Circuit Case 5 Transformer Transformer 5 Transformer Control Circuit 5 Control Circuit Control Circuit 3 Contact Contact 3kV 100 Transformer Protection and Control Unit usnm mc sme m c MEME Du C IE M LI C HR 1 4 2 Noise Test 1
55. elay phase overcurrent protection operating OR Wx 51 OP A B C Winding x Time delay phase overcurrent protection A B C Phase operating Wx 50 51 PKP Winding x Ground overcurrent protection Pickup OR 50N 1 OP Winding x Instantaneous definite time ground overcurrent protection 1 PNCTECH di PAC T100 Transformer Protection and Control Unit Pp operating Winding x Instantaneous definite time ground overcurrent protection 2 Wx 50N 2 OP PE operating Wx 51N OP Winding x Time delay ground overcurrent protection operating 3 2 3 Negative Sequence Overcurrent Protection 46 46T Negative sequence overcurrent protection element is applied to detect unbalance fault that ground overcurrent protection element does not detect Negative sequence overcurrent protection element have same protection elements of instantaneous definite time 2 inverse time 1 as phase ground overcurrent protection 50 51 50N 51N element Pickup current I2 of negative sequence overcurrent protection is im 12 3 a I alc ABC phase rotation Negative sequence overcurrent protection that TRANSFORMER PHS COMP setting 15 INTERNAL transformer only in occasion negative sequence current metering and negative sequence overcurrent protection runs Minimum operating time of instantaneous definite time element is below 40msec Inverse time element property curve is consisted of IEC class 4 IEEE ANSI class 7 KEPCO class 3 Det
56. er menu if press 1 22 key after choose protection group which wish to change setting pressing up A down V key Details item of menu configuration item wants to refer menu composition screen X PNC TECH E PAC T100 Transformer Protection and Control Unit a Early screen DISPLAY Table2 4 Menu composition screen CONTACT INPUT Contact input status CONTACT Contact output status LED s LOGIC COMPONENT Programmable LED status EasyLogic Component status SELF DIAGNOSIS PROTECTION Self diagnosis status Protection operation status METERING METERING Power quantity metering RECORD Event occur data WAVEFORM Fault waveform data SYS INFO MPU and DSP version SETTING PASSWORD Password setting POWER SYSTEM RTC Power system and wiring setting System time setting SYSTEM WAVEFORM RECORD Waveform record setting BREAKER Circuit breaker status and setting COMMUNICATION 2 setting TCS Trip Circuit Supervision setting CONTACT INPUT Contact input setting display CONTACT OUTPUT Contact output setting display LED Programmable LED setting display LOGIC COMPONENT EasyLogic Component setting display 50 87 PHS DIFF 87T Instanta
57. ge magnitude reflects CT and PT Ratio setting by transformer winding and marks by primary current voltage Phase metering marks via winding 1 A phase current Voltage 154000 110 110 154000 V 0 0 H Winding 1 A phase current 400 5 1 80 A 0 0 E Winding 1 B phase current 400 5 2 160 240 0 a Winding 1 C phase current 400 5 3 240 A 120 0 Winding 1 N phase current 200 5 1 40 0 0 Winding 2 A phase current 2000 5 1 400 180 0 m Winding 2 B phase current 2000 5 2 800 60 0 T Winding 2 C phase current 2000 5 3 1200 A 300 0 PAC T100 Transformer Protection and Control Unit Referencce Angle Referencce Angle Current Input Component Figure 4 2 Sequence current l 10 1 1 16 Winding 1 zero sequence current 3 45 6 A 150 0 400 5 0 57 t al a lc Winding 1 positive sequence current 400 5 2 160 A 0 1 I2 i E Winding 1 negative sequence current 3 400 5 0 57 45 6 A 210 4 3 Current differential measurement Current Voltage input Terminal Input value 60Hz WI IA WI IB WI 1 WLIN 1 W2 IA 1 00 A 150 0 W2 IB 100A 30 0 1 00 A 270 0 PAC T100 Transformer Protection and Control Unit Phase and ground current compensation Phase compensation reference winding winding Winding 2 Phase compens
58. gnitude DIFF2 IA A Phase 2 harmonics secondary differential current magnitude DIFF2 IB B Phase 2 harmonics secondary differential current T magnitude C Phase 2 harmonics secondary differential current magnitude DIFF2 IC DIFFS IA A Phase 5 harmonics secondary differential current magnitude DIFF5 B Phase 5 harmonics secondary differential current magnitude DIFFS IC C Phase 5 harmonics secondary differential current magnitude RIA A Phase fundamental wave secondary restraint current magnitude RESTRAINT CURRENT B Phase fundamental wave secondary restraint current magnitude A C Phase fundamental wave secondary restraint current magnitude Winding 1 A Phase primary current magnitude angle WI Standard angle W2 IA Winding 2 A Phase primary current magnitude angle W3 IA Winding 3 A Phase primary current magnitude angle WI CIA Winding 1 A Phase secondary compensation current magnitude angle W2 CIA Winding 2 A Phase secondary compensation current magnitude angle PHASEA CURRENT W3 CIA Winding 3 A Phase secondary compensation current magnitude angle DIFF IA A Phase fundamental wave secondary differential current magnitude DIFF2 IA A Phase 2 harmonics secondary differential current magnitude DIFFS A Phase 5 harmonics secondary differential current magnitude RI A Phase fundamental wave secondary restraint current magnitude Winding 1 B Phase primary current magnitude angle IB
59. hat do not appear screen can confirm using up A down V key Protection element is registered element that function is set by ENABLED CONTACT INPUT DISPLAY STATUS CONTACT INPUT can confirm present state of 16 digital inputs Digital input that function is set by EANBLED is registered as OFF in case of it is logic 0 ON in case of input is logic 1 Digital input that function is set by DISABLED is registered as OFF regardless of input state CONTACT OUTPUT DISPLAY STATUS CONTACT OUTPUT can confirm present output state of 16 contact output Contact output that function is set by EANBLED is registered as ENERGIZED in case of was displayed and is registered as DEENERGIZED in case of output was not made Contact output that function is set by DISABLED is registered as DEENERGIZED LED DISPLAY STATUS LED can confirm output state of 8 user appointment LED LED that function is set by EANBLED 15 registered as OFF in case of ON output was not made in case of output was made LED output that function is set by DISABLED is registered as OFF LOGIC COMPONENT DISPLAY STATUS LOGIC COMPONENT can confirm present state of 48 logic component Logic component that function 15 set by EANBLED is registered as OFF in case of it is logic 0 as ON in case of input is logic 1 Logic component that function is set by DISABLED is registered as OFF SELF DIAGNOSIS DISPLAY STATUS SELF DIAGNOSIS can confirm self diagnosis statu
60. ircuit breaker is open status CLOSE LED 11 Control Lighting LED when circuit breaker is close status 12 Programmable LED RED eight Through EasyLogic Editor function set Table 2 2 Key Function O A The first measurement item change 7 Direction V Menu change Setting value range change Key gt Menu change Menu item select lt Menu change Escape A high position menu move Item cancel ERROR LED and TRIP LED reset EasyLogic ANN RESET Operand operation 9 MENU From early screen to Menu Tree screen move 10 ENTER Setting value input and Command Menu Yes No Confirm Local Remote control position change SELEC ircuit ker choice t trol 11 Control Circuit breaker choice to contro Choice circuit breaker open control Choice circuit breaker close control 13 PACManager connection RS 232 communication port LCD screen of PAC T100 is separated into greatly early screen and menu composition screen Early screen can see information of various measured data system time information event number fault waveform number setting group etc to use direction key PNC TECH PAC T100 Transformer Protection and Control Unit Mn 2 2 Early screen Product model communication status six measure display event and waveform recording save number single
61. it breaker 3 Press ENTER key after input SET password using 5 down key moving by each position using 1 gt key in case of ask password in last line of screen 4 After input right password trip counter digit blinks if press right gt key Relay stores TECH PAC T100 Transformer Protection and Control Unit automatically if press ENTER key after make into value to set pressing down V key Relay escapes in trip counter setting display if press left key after setting ends 2 56 LCD CONTRAST It is menu to control LCD screen brightness There is the possibility of difference for brightness of screen according to position or ambient temperature installed relay User can control screen brightness according to environment of placed relay LCD CONTRAST settin 1 Press gt key after find LCD CONTRAST in COMMAND menu 2 Press gt key in LCD CONTRAST change display 3 Press ENTER key after input SET password using down V key moving by each position using left lt gt key in case of ask password in last line of screen 4 After input right password LCD CONTRAST ratio blinks if press right gt key 5 Press ENTER key after press down V key and finds wanted screen brightness Because brightness ratio changes between 80 0 99 9 when change from 99 9 to 80 observe because
62. itude angle 87G Winding x restricted ground fault protection Pickup Wx 87G OP Winding x restricted ground fault protection operation x PNC TECH PAC T100 Transformer Protection and Control Unit aaa 3 2 5 5 Overvoltage Protection 59 Undervoltage Protection 27 Overvoltage protection element is single phase protection element that is consisted of OV1 59 1 and OV2 59 2 acting by definite inverse time element that act by definite time element Inverse time dynamic characteristic is equal with property of induction type overvoltage relay Relay acts in case of inputted phase voltage is more than pickup Detailed contents for property curve expect to refer to Appendix C Time Characteristics Curves Undervoltage protection element is single phase protection element that is consisted of UV1 27 1 and UV2 27 2 acting by definite inverse time element that act by definite time element Inverse time dynamic characteristic is equal with property of induction type overvoltage relay Relay acts in case of inputted phase voltage is below than pickup Detailed contents for property curve expect to refer to Appendix C Time Characteristics Curves Figure 3 13 Definite time overvoltage protection operating characteristic INVERSE FUNC MULTIP Figure 3 14 Inverse time overvoltag
63. l Setting change Event inquiry Fault waveform analysis Graphic LCD 240 128 16line 30character Single line diagram tree structure menu 16 LEDs 11 Keypad button Communication port Front interface RS232 port 1 ModBus Protocol Setting change Event Fault waveform transmission measuring monitor Rear interface RS485 port 2 SCADA communication DNP3 0 ModBus IEC60870 5 103 protocol Self diagnosis function DC power supply Memory CPU Setting range DSP A D converter Analog input circuit inside logic element and digital input output circuit Trip circuit TCS monitoring function Eight user setting LEDs Panel design easiness in sequence logic structure through EasyLogic Editor Test function Output relay and front display department Software upgrade easiness by flash memory use Flexible control source option AC 110 240 V DC 19 130 V Access Security by password for settings and CB control PAC T100 Transformer Protection and Control Unit 12 Application Two windings or three winding transformer protection Current differential protection of generator and motor winding Winding 1 Ic WINDING 1 Winding 2 C T Winding 3 T w NAA NA WINDING 2 WINDING 3 PAC T100 Figure 1 1 Function Single Line Diagram Table 1 1 Device Function Device Function Instantaneous Definite Time Phase Overcurrent Protection Inverse Phase Overcurrent Pr
64. mpensation current Instantaneous differential protection 50 87 Instantaneous differential protection acts instantaneous if magnitude of differential current becomes more than setting value Differential current is magnitude of vector difference of calculated compensating current through compensation expression and not difference of current magnitude that pass to winding PNC TECH PAC T100 Transformer Protection and Control Unit Percent differential protection 87T Current percent differential protection acts by instantaneous definite time according to ratio setting of restraint current and differential current Ratio property can do second stage setting by low current area and high current area Percent differential protection element has 2 harmonics 5 harmonics constraint element to prevent malfunction by inrush or overexcitation of transformer Also when it is wye grounded system outside grounding fault relay is equiping function that correct ground current that occur Current percent differential protection element uses wye connection CT basically but already can accommodate CT for placed phase compensation Differential Current 50 87 Pickup TRIPPING AREA SLOPE2 SLOPE1 87 Restrain Current Figure 3 1 Current instantaneous percent differential protection operating characteristic 10 comp 1 Differential Calculate
65. neous Differential setting Percent Differential setting OC 50 51 Overcurrent setting OCG 50N WINDING EN Ground overcurrent setting NSOC 46 46 Negative sequence overcurrent setting PROTECT N HI 4 GND DIFF Restricted Ground Percent Differential setting OV 59 Overvoltage setting UV 27 Undervoltage setting 50 V Hz 24 1 Circuit breaker fail setting Overexcitation V Hz 1 setting V Hz 24 2 Overexcitation V Hz 2 setting COLD LD Cold Load Pickup setting INRUSH Inrush detection setting COMMAN D CLEAR EVENT Event data clear CLEAR WAVEFORM Waveform data clear CONTACT OUT TEST PANEL TEST Contect output test Front panel LCD LED tedt TRIP COUNTER SET LCD CONTRAST Circuit breaker trip counter setting LCD contrast setting PAC T100 Transformer Protection and Control Unit E 2 4 DISPLAY This menu show digital input and contact output status user appointment LED status Logic Component status self diagnosis status monitoring element and protection element operation status firmware s version information in DISPLAY 2 41 STATUS This menu show operation status of digital input and contact output user appointment LED operation status EasyLogic component status self diagnosis status operation availability of TCS and protection element in DISPLAY STATUS Status information t
66. ng 1 A Phase primary current magnitude angle IA Standard angle IB 7 Winding 1 B Phase primary current magnitude angle WINDING 1 CURRENT IB Winding 2 B Phase primary current magnitude angle WINDING CURRENT IN Winding 2 N Phase primary current magnitude angle IB Winding 3 B Phase primary current magnitude angle WINDINGSS CURRENT IN Winding 3 N Phase primary current magnitude angle Winding 1 A Phase secondary compensation current WI C IA REM magnitude angle Winding 1 A Phase secondary compensation current WI C IB magnitude angle Winding 1 A Phase secondary compensation current W1 C IC nium magnitude angle W2 C IA Winding 2 A Phase secondary compensation current magnitude angle COMPENSATED W2 C IB Winding 2 B Phase secondary compensation current CURRENT magnitude angle W2 C IC Winding 2 C Phase secondary compensation current magnitude angle W3 CIA Winding 3 A Phase secondary compensation current magnitude angle W3 C IB Winding 3 B Phase secondary compensation current magnitude angle W3 C IC Winding 3 C Phase secondary compensation current magnitude angle DIFFERENTIAL CURRENT DIFF IA A Phase fundamental wave secondary differential current magnitude PAC T100 Transformer Protection and Control Unit DIFF IB B Phase fundamental wave secondary differential T current magnitude DIFF IC C Phase fundamental wave secondary differential current ma
67. otection Restricted Ground Percent Differential Protection 59 1 59 2 Overvoltage Protection overvoltage Protection 271 272 24 1 242 COLDLD PAC T100 Transformer Protection and Control Unit 1 3 General Specification 131 Rated Control Power Input AC 110 220 V 20 50 60 Hz DC 80 300V DC 19 130 Normal operation duration in short term power interruption is 100ms Power consumption Below 30VA Actually 15W 1 3 2 Voltage Rated Voltage AC 50 240 0V 50 60Hz Input Range 1 450V Overload Capability Continuous 450V Power Consumption Below 0 5VA Phase 133 Current Rated Current AC 5 1A 50 60Hz Input Range 0 1 250A In 5A 0 02 50A In 1A Overload Capability 100xInom for 15 20xInom for 4s 15A Continuous Power Consumption Below 0 5VA Phase 1 3 4 Binary Output Trip Contact 6 Points 6A Configurable Closed Circuit Capacity 16 Continuous AC 250V 30 0 3sec DC 125V Resistive load Opened Circuit Capacity5A 0 1 PF AC 250V 5A 0 1 PF AC 250V Signal Contact 10 Points 8A 2C Configurable Closed Circuit Capacity 5A Continuous AC 250V 5A 0 3sec DC 125V Resistive Opened Circuit Capacity LA 0 1 PF AC 250V 25ms L R Time Constants DC 125V 1 3 5 Binary Input Number 16 Configurable Input Range Maximum DC 250V On Off Threshold Voltage DC 19 130 Von 219V Voff lt 14V DC 80 300V gt 80 Voff lt 60V R
68. pe PAC T100 supports type of 2 windings transformer Y Y Y A A Y 2 2 and three winding transformer Y Y Y Y Y A Y A Y Y A A A Y Y A Y A A A Y A A A For example transformer that transformer primary winding is wye Y and secondary winding is delta sets by Y A Phase Compensation Ground current compensation when is outside grounding fault PAC T100 regardless of transformer winding basically CT Y connection use and corrects phase difference by transformer winding as software in inside In this case TRANSFORMER PHS COMP should sets by INTERNAL When install CT for phase compensation on outside must set TRANSFORMER PHS COMP by EXTERNAL Divide N3 times current that grow into N3 again when PAC T100 does not phase correction if set by EXTERNAL and current quantity compensation by difference of CT ratio and CT wiring are delta and corrects current quantity difference by CT wiring In INTERNAL phase compensation setting phase difference of transformer winding sets lag phase angle of secondary winding about primary winding through W1 W2 PHS and W1 W3 PHS By example must set WI W2 PHS by 307 in case of secondary winding of transformer is 30 to primary winding Standard winding of phase compensation does via delta winding Delta winding that transformer that have delta winding more than 1 is first in the third winding order in primary becomes standard winding of phase compensation Primary winding of Y Y or Y Y
69. r Protection and Control Unit Appendix B Transformer type and compensation Transformer setting Vector diagram Compensation angle lag WI1 W1 W1 W2 W2 W1 W2 W3 W2 W3 PHS PHS YY 0 j j 0 0 0 180 Y 180 0 0 pu Y YD 30 j 30 0 0 150 T lt 150 0 0 pa N 210 b gt 210 0 0 pu 330 j 330 0 0 DY 30 pi d 0 330 0 150 1 0 210 0 TAN 210 e 0 150 0 211 330 t gt 0 30 0 PAC T100 Transformer Protection and Control Unit 210 30 5 73 PAC T100 Transformer Protection and Control Unit 150 150 330 0 pa 210 210 30 0 A 330 T 330 150 0 pa 30 0 5 30 0 30 pa 180 1 30 0 210 A 150 0 150 0 150 pa 180 150 0 330 A Y T lt lt M M gt gt lt 210 0 4 210 0 210 180 1 210 0 30 330 0 d 330 0 330 180 d 330 0 150 YDD 30 30 j 30 0 0 100 Transformer Protection and Control Unit 150 T k lt 30 0 240 210 5 gt 30 0 180 330 d 5 30 0 60 150 30 lt 4 150 0 120 150 lt lt 150 0 0 210 lt gt 150 0 300 pa N y 330 ra lt 150 0 180 210 30 a 4 210 0 180 150 5 gt lt 210 0 60 210 gt gt 210 0 0 330 gt 210 0 240 YDD 330 30 j 330 0 300 PAC T100 Tr
70. r find CLEAR Event in COMMAND menu 2 Press key after input SET password using down V key moving by each position using left lt right gt key in case of ask password in last line of screen 3 After input right password contents to erase if press right gt key are published and phrase blinks This time come out menu pressing left S key in case of does not want delete or presses ENTER key in phrase 4 Press ENTER key if phrase YES is expressed after use down V key Relay is converted in COMMAND screen after phrase CLEAREI is expressed for screen last line 2 52 CLEAR WAVEFORM This menu clear waveform data stored to PAC T100 If run Clear Waveform all of the stored waveform data are initialized Waveform clear 1 Press 2 gt key after find CLEAR Waveform in COMMAND menu 2 Press ENTER key after input SET password using up down V key moving by each position using right gt key in case of ask password in last line of screen 3 After input right password contents to erase if press gt key are published and phrase blinks This time come out menu pressing left S key in case of does not want x PNCTECH adi 100 Transformer Protection and Control Unit aaa fg fi eee dele
71. racteristic nn eene 3 37 Phase Ground Neutral Overcurrent Protection Characteristic 3 40 Intantaneous Definite Time Phase Overcurrent Protection Characteristic 3 39 Inverse Phase Overcurrent Protection Characteristic eese 3 40 Instantaneous Definite Time Ground Neutral Overcurrent Protection Characteristic 3 40 Inverse Ground Neutral Overcurrent Protection Characteristic 3 40 Instantaneous Definite Time Negative Sequence Overcurrent Protection Characteristic 3 42 Inverse Negative Sequence Overcurrent Protection Characteristic 3 43 Restricted Ground Percent Differential Protection Characteristic 3 45 Restricted Ground Percent Differential Protection Characteristic 3 45 Definite Time Overvoltage Protection Characteristic eese 3 46 Inverse Overvoltage Protection Characteristic esses 3 46 Definite Time Undervoltage Protection Characteristic sse 3 47 Inverse Undervoltage Protection Characteristic 3 47 Overexcitation Protection Characteristic esses enne 3 49 Circuit Breaker Failure Protection Characteristic asss 3 50 Cold Load Pickup Current 3 51 Cold Load Pickup Characteri
72. rmission Time Interval 30 sec Control Power Circuit Common Mode 4 0 kV Differential Mode 2 0 kV Transformer Circuit Common Mode 4 0 kV Differential Mode 2 0 kV Contact Circuit Common Mode 4 0 kV Differential Mode 2 0 kV Radiated Susceptibility Standard IEC60255 22 3 class ANSI IEEE C37 90 2 Detail Contents Electric Field Intensity 10 V m Permission Frequency 830MHz 1GHz Frequency Modulation IKHz Sine Wave 80 AM Permission Direction Front Rear Antenna Direction Verticality Horizontality Dwell time 1sec Line Conducted HF Standard IEC 61000 4 6 class III Detail Contents Permission Frequency 150kHz 80MHz Electric Field Intensity 10 V 80 AM IkHz 1 4 3 Mechanical Test Vibration Standard IEC60255 21 1 class Detail Contents Vibration Frequency 16 7Hz Amplitude of Vibration 0 4mm Vibration Direction Front Rear Left Right Up Down Test Time 600sec 10min Shock Standard IEC60255 21 2 class Detail Contents Impulse 30g g Acceleration of Gravity Permission Method Front Rear Left Right Up Down 144 Temperature and Humidity Test Standard 60068 2 1 2 Operating Temperature 25 70 C Storage Temperature 30 759 Humidity RH 30 95 PAC T100 Transformer Protection and Control Unit 1 5 Use Environment Altitude Less than 1000m The others Status of do not exist abnormal vibration shock slope and magnetic field Status of do not exist explosi
73. s Relay is registered as in case of it is particularly normally each item Relay is registered as FAIL in case of is absurd and SYSTEM ERROR LED is lighted up Self diagnosis item is memory setting range AD converter DC power CPU exception DSP analog input circuit Easylogic setting contact input circuit contact output circuit There is trip circuit supervision TCS by monitoring function If set TCS function by DISABLED relay is always registered as PROTECTION Protection element set by DISABLED is not shown in DISPLAY STATUS PROTECTION and pickup of protection element and operation status set by EANBLED is confirmed only Operation status 15 displayed by the phase when it 15 3 phase protection element relay is registered as if A phase is operated Relay is registered as in case it is single phase X PNC TECH d PAC T100 Transformer Protection and Control Unit a N protection element When there is no used protection element phrase PROTECTION ENABLED is registered Relay is switched over in DISPLAY STATUS PROTECTION screen at pickup and operation occurrence of protection element in early measurement screen 2 4 22 METERING Various metering value are confirmed in DISPLAY METERING Standard of phase display is winding 1 A phase current W1 IA Refer to below table 2 5 for details contents about metering display Table 2 5 Measurement display LCD Title Item Description Windi
74. setting save availability This time relay is stored by changed setting value if press down V key and press ENTER key after selects YES 7 In case of selected NO set value is canceled In case of change several items at the same time password does not require several times if do not escape SYSTEM or PROTECT block If use PACManager setting is possible conveniently 3 1 1 SYSTEM System setting item have password power system RTC waveform recording circuit breaker communication TCS 3 1 22 PASSWORD Password used in relay is SET PASS and CTRL PASS SET PASS is used when change setting value CTRL PASS 1s used when control circuit breaker by keypad Two passwords are four figures that are consisted of 0 9 and initial value at product shipping is all 0000 If forget it after change password setting value is not changed or control by key handling 3 1 3 POWER SYSTEM There is POWER SYSTEM for analog circuit composition setting TRANSFORMER for transformer setting and WINDING 3 for analog circuit composition by each winding in SETTING SYSTEM POWER SYSTEM Setting group applied present according to SET GROUPN s setting in POWER SYSTEM is decided Rated frequency Rated frequency should sets equally with frequency of power system beca
75. stic nineteenth 3 51 Intush Detection Characteristics piesiniai esea anaE 3 52 Event Fault Recording 3 53 Waveform Analysis tette 3 54 TCS Circuit Composition Ga t Pee 3 56 Application Example Two Winding Transformer External Connection 4 59 Sequence 4 61 Dimensioned 155 5 64 Current Transformer CT Connection for Three Winding Transformer 5 66 Current Transformer CT Connection for Two Winding Transformer 5 67 Current Transformer CT Connection for External Phase Compensation 5 68 Contact Input Output 5 69 R5232 Port Connection eei diee erre iem pa 5 69 RS485 Port 5 70 Device Function a decepta Gh eon ahh aise Aas 1 9 LE ED LCD EUBDcOH aeos OO eases id 2 19 ey auci 2 19 LCD Early measurement screen 2 20 Menu composition 54 EE P eL e DER tution 2 23 Measurement display n c
76. te or presses ENTER key in phrase 4 Press ENTER key if phrase YES is expressed after use down V key Relay is converted in COMMAND screen after phrase ALL CLEARED is expressed for screen last line 2 53 CONTACT OUT TEST It is menu to test 16 points of output contacts If convert in test screen done output contact turns into Enegized by all De enegizeds If test is preceded LED RUN TEST blinks Contact out test 1 Press gt key after find CONTACT OUT TEST in COMMAND menu 2 Press gt key after output point of contact to test uses and selects down V key 3 Press ENTER key after input SET password using up key moving by each position using 1 lt 2 gt key in case of ask password last line of screen 4 After input right password contents to RESET MIN MAX if press right gt key are published and phrase NO blinks After input right password phrase of contact output that is expressed by DEENERGIZED if press right key blinks 5 Status of point of contact toggles by ENERGIZED and DEENERGIZED whenever press up down IV key And sound that RELAY sticks or drops sounds LED RUN TEST blinks during test 6 Relay escapes in test of contact output that select if press left S key Repeat 2 6 in case of want test of other contact output When test again passwor
77. tricted ground fault protection phase CT ratio and ground ground CT ratio slipway when differ correct should CT Ratio setting wants to refer PHS CT RATIO GND CT RATIO by winding of transformer 3Phase current vector sum 310 I aF 1 Ground point CT compensation ee Ig Ground point CT current Differential current 104 BI 0 1 gl Restraint current Imax 1 1 16 Igd Tripping Area SLOPE Blocking Area Pickup Imax Figure 3 11 Restricted ground fault protection characteristic TECH PAC T100 Transformer Protection and Control Unit Wx Winding x 10 Zero sequence phase current lg Wx IN Imax Max Wx IA Wx IB Wx IC 30 181041 Calculate detect Figure 3 12 Restricted ground fault protection operation characteristic SETTING PROTECT 1 4 Winding 1 3 GND DIFF Wx 87G Setting Item Step Unit Description 1 FUNCTION ENABLED DISABLED Whetherfunctionuseornot 2 PICKUP 0 50 100 00 0 01 Ground differential current Pickup 3 SLOPE 5 100 1 Vo Operating ratio Igd Imax 100 4 DELAY 0 00 60 00 Operation delay time 5 BLOCK operand _ Protection blocking condition 6 EVENT ENABLED DISABLED Whethereventrecordornot 00 Metering and EasyLogic Operand LCD display Item Description Winding x zero sequence Primary current magn
78. ub Connector D sub Connector Female Figure 5 6 RS232 Port Connection PAC T100 Transformer Protection and Control Unit 5 36 RS485 Port Connection PAC T100 1 Twisted 57 SHIELD Chassis 1 Grounded only 83485 1 Zr 120 Q 100 RS485 10 RS485 10 RS485 1 Figure 5 7 5485 port connection PAC T100 Transformer Protection and Control Unit Appendix A Phase compensation formula Compensation Phase compensation angle lag GROUND NO GROUND YES L 2 3 k 1 3 Ig 1 3 Ic Ij 2 155 1 3 Ic 1 3 TA 2 3 Ic 1 3 I4 1 3 Ig 30 1 83 L 1 83 Ic Ip 1 43 Ip 1 3 I4 113 Ic 1 13 Ip I 2 3 Ic Is 2 31 lo 2 3 Ig IA 1 3 Ip 1 13 Ic Ip 51 93 Ic 1 3 IA 51 3 I4 1 83 Ip I 2 3 Ig 1 3 Ic 1 3 IA ie 2 314 1 3 Ig 1 3 Ic I 15 3 Ig 1 3 IA Ig 143 Ic 143 15 lc S1 314 1 43 Ic IA 2 3 lj 2 3 2 3 Ic I 1 83 Ic 1 83 IA 1 83 I4 1 3 Ip 1 83 Ip 1 3 Ic 2 3 Ie 1 3 Ia 1 3 Ig Ip 2 3 1 1 3 Ip 1 3 Ic 2 3 Ip 1 3 1 41 31 I 1 3 Ic 1 3 Ip 1 1 1 Ic Ic 51 3 Ip 1 3 IA hi 2 3 Ig Ip 2 3 Ic le 2 3 L 1 3 1 43 5 Ig 1 43 1 83 Ic 1 3 Ic 1 43 I PAC T100 Transforme
79. ude 50 87 PKP Current instantaneous percent differential protection Pickup OR 50 87 12 instantaneous percent differential protection Phase 3 22 Phase Ground Overcurrent Protection 50 51 50N 51N Phase Ground overcurrent protection is consisted of instantaneous definite time phase 50 1 50 2 inverse time phase overcurrent 51 instantaneous definite time ground overcurrent 50N 1 50 2 inverse time ground overcurrent 51N Can embody 3 steps protection property if mix independent 3 elements by phase ground element Minimum operating time of instantaneous definite time element is below 40msec Inverse time element property curve is consisted of IEC class 4 IEEE ANSI class 7 KEPCO class 3 Detection current of phase overcurrent protection uses CT secondary current that is inputted to relay independently of compensating current that use in percent differential protection Input current of ground overcurrent protection element can get from ground protection CT or residual connection of 3phase CT Detailed contents for property curve expect to refer to Appendix C Time Characteristics Curves PNC TECH 100 Transformer Protection and Control Unit p M H F Curve 0 8 07 N Time sec U 8 07 N 2 2 5 2 Current 35 Figure 3 4 Phase Gro
80. und overcurrent protection operating characteristic Winding x x SETTING Figure 3 5 Instantaneous definite time phase overcurrent protection operating characteristic PNC TECH PAC T100 Transformer Protection and Control Unit Wx Winding x rf sss Figure3 6 Time delay phase overcurrent protection operating characteristic Wx Winding x Figure3 7 Instantaneous definite time ground overcurrent protection operating characteristic Wx Winding x FUNC MULTIP Figure 3 8 Time delay ground overcurrent protection operating characteristic TECH PAC T100 Transformer Protection and Control Unit SETTING PROTECT 1 4 Winding 1 3 IOC1 Wx 50 1 IOC2 Wx 50 2 SETTING PROTECT 1 4 Winding 1 3 IOCG1 Wx 50N 1 IOCG2 Wx 50N 2 Setting Item Step Unit Description 1 FUNCTION ENABLED DISABLED Whetherfunctionuseornot Pickup current 3 DELAY 0 00 60 00 Operating delay time 4 BLOCK EasyLogic operand Protection blocking condition 5 EVENT ENABLED DISABLED Whethereventrecordornot SETTING PROTECT 1 4 Winding 1 3 TOC Wx 51 SETTING PROTECT 1 4 Winding 1 3 TOCG Wx 51N Setting Item Step
81. use it is important element that is used in metering of relay and protection arithmetic When power system frequency differs with set frequency measured data is shaken extremely or causes error in operaing characteristic of protection element Rated frequency setting through keypad or PACManger possible Should do control power of relay OFF ON in case rated frequency X PNC TECH m PAC T100 Transformer Protection and Control Unit setting is changed PT Ratio Relay is 1 voltage inputs This voltage is source of overexcitation V Hz overvoltage undervoltage protection elements that use voltage Should set PT secondary by the rated voltage inputted to relay considering wiring line to line voltage or phase voltage of PT primary in case use overexcitation V Hz protection element PT ratio setting can set using keypad or PACManager Metering display voltage value PHS PT PRI PHS voltage V Protection element setting group Relay has 4 different groups about protection element Setting group can set using SETTING SYSTEM POWER SYSTEM POWER SYSTEM menu or remote communication SETTING SYSTEM POWER SYSTEM POWER Setting item Range Step Unit Description 1 FREQUENCY 60Hz 50Hz Rated frequency 3 50 0 250 0 0 1 PT Secondary 4 SET GROUP GROUPZI Protection group setting 3 1 4 Transformer Transformer ty
82. veness dust inflammable dust inflammable corrosiveness dust and salt 1 6 Protection Detection Elements 1 6 1 Current Differential Protection 50 87 87T Transformer Setting Type YYYD DDD Phase Compensation Internal software External Phase difference between winding 0 30 330 lag Winding Setting Rated VA 0 01 600 00 0 01 step Rated Voltage 0 01 600 00 0 01 step CT Ratio 5 10000 5 step Ground Yes No Instantaneous Differential 50 87 Setting Pickup Current 10 150 1 step Operating Delay 0 00 60 00sec 0 01 step Percent Differential 87T Setting Pickup Current 0 20 2 50 0 01 step Operating Delay 0 00 60 00sec 0 01 step Slopel 5 100 96 1 step Slope2 20 200 1 step Knee Point 5 0 100 0 0 1 step Harmonic Restraint Mode None 2 Harm 5 Harm 2 or 5 Harm 254 Harmonic Level I2d I1d 5 0 40 0 96 0 1 step 5 Harmonic Level I5d Ild 5 0 40 0 90 0 1 step 100 Transformer Protection and Control Unit 1 6 2 Phase Ground Neutral Overcurrent Protection 50 51 50N 51N Pickup Current 0 50 100 00 0 01 step Definite Time 0 00 60 00sec 0 01 step Time Multiplier TM 0 01 10 00 0 01 step TC Curve IEC Normal Inverse IEC NI Very Inverse IEC VI Extremely Inverse IEC Long Inverse IEC LI Inverse ANSI Short Inverse ANSI SI Long Inverse ANSI LI Moderately Inverse ANSI MI Very Inverse ANSI VI Extremely
83. ver automatically by PROTECTION item of DISPLAY STATUS menu if protection element operates in measurement screen Relay return by early screen if automatic switchover condition is returned and key operation does not occur more than 3 minutes LCD returns by early screen as backlight turns off if do not handle key for 3 minutes X PNC TECH PAC T100 Transformer Protection and Control Unit a av e i r i r W 2 2 5 LED Latched Status Clear TRIP LED Clear TRIP LED is lighted up in case of protection element more than one operates by representative LED of protection element action TRIP LED Clear presses RESET key 2 times when all protection elements are reset First if show protection element that operate because is converted automatically by DISPLAY STATUS PROTECTION menu if presses IRESET key and presses the second RESET key status is initialized ERROR LED Clear ERROR LED is lighted up in case of self diagnosis element more than one operates by representative LED of self diagnosis status display ERROR LED Clear presses key 2 times when all self diagnosis elements are returned First if show self diagnosis element that operate because is converted automatically by DISPLAY STATUS SELF_DIAGNOSIS menu if presses key and the second key status is initialized

Download Pdf Manuals

Related Search

Related Contents

Istruzioni per l`uso Loganova EN20  Leia atentamente este Manual. MANUAL DE INSTRUÇÕES  GE JVM2052SNSS User's Manual  Indesit DI 67 Dishwasher User Manual  StarTech.com 10m Coax High Resolution Monitor VGA Cable - HD15 M/M    KHT600D, KHT750D, KHT600S, KHT750S CORTA  Winleads™ Auto Dialer Software User Manual  Eglo SINTRA  

Copyright © All rights reserved. Failed to retrieve file