Home

Fitmate Pro only

1. e Show details 138 Fitmate User Manual 5 Windows 7 only If you didn t log in as Administrator enter the Administrator s password This is a Windows 7 protection system and it cannot be bypassed C d Please select a language K 6 Select the installation language The software language can be choosen later EM Choose Components 5 Choose which features of Cosmed Fitmate you want to install Check the components you want to install and uncheck the components you don t want to install Click Next to continue Select components to install Fitmate Program Ese iil Gen Cosmed USB Drivers C Shared archives Start Menu Shortcuts C Visual C Runtime Libra USB Drivers C Lifecorder PLUS Drivers Space required 0 0KB 7 Select the components to be installed Fitmate Program it cannot be deselected and it must be installed in any case Shared Archives to install the shared archives They will need a shared folder by means of the standard Windows function If you don t select this option the archives will not be shared This option can be modified form the Fitmate settings See later Installing and using shared archives for further details Start Menu Shortcuts to create links in the Windows Start menu Visual C Runtime Library if needed it is automatically selected USB Drivers to install the Cosmed USB drivers not needed if a USB dongle is used Lifecorder PLUS Drivers to install the Lifecorde
2. Cancel Contirm 4 Program goal Time Weight Weight change per week in grams weeks fkg Recommended value is 500 and Today 0 Op no more than 1000 gramsfweek Next check amp al Goal 22 35 Enter the goals e Desired weight change per week Recommended value is 500 grams 1 pound and to 1000 grams 2 pounds per week e Goal weight e Date of the next check time in weeks Press OK to confirm or X to cancel The program will automatically be updated James BOND Lifestyle 3 Exercise RMR SE 4 Program goal Lifestyle L O Enxit amp save Exercise a i d Balance EI Time Weight 36 Estimated Ideal Today Mext check 8 g1 Goal 20 The graph to the right shows the ideal body weight change in blue with a weight loss of 1 pound 454 g per week and the desired body change in green following the parameters entered previously If the subject s goal is to gain weight set the desired weight greater than the present weight and the title will be Gaining Weight Viewing the program If pressing O Exit amp save the new weight management program will be displayed on the screen From here you can print the weight management program Exit 1 Test 2 Print 3Print all D Energy Balance Date mm dd yyyy 12 22 2005 RMR BODY COMP STD MEAS E EN BALANCE Time Weight weeks kg Today T 35 Net
3. h 500 kcal The RMR value can be entered manually or calculated starting from the Harris Benedict formula Click OK to confirm The windows will update considering the information entered Lifestyle Click Lifestyle to enter the information about the activities performed during the day Complete the information required and click OK to confirm User can 1 Set the type of physical activity performed during the day Forced Rest Sedentary Normal Very Active Personal Weight Management Activities My Lifestyle do not include planned exercise sessions Std Classification User def d Activity Monitor Pedometer Physical Activity Level Sedentary xi Information Seated work with no option of moving around and little or mo strenuous daily physical activity Close this window El Planning for a weight loss of 0 45 Kg per week Weight Plan Graph i Estimated weight 100 Ideal weight loss Physical Activity Level Sedentary pore teal 1775 kcal 12 05 2009 16 03 2010 19 01 2011 24 11 2011 26 09 2012 h 500 kcal 2 Define the amount of hours are spent for specific activities 174 Fitmate User Manual Personal Weight Management i x Information A e ge My Litestyle do not include p anned exercise sessions Std Classification User df d Activity Monitor Pedometer Rest hours per day very light hours per day Light hours per day Moderate hours
4. Maintenance 111 5 Adequate ventilation is required in the disinfection area to evacuate the chemical vapors from glutaraldehyde if used Use lidded containers for the disinfectant solution when appropriate The inhalation of fumes from disinfectant solutions or skin contact with liquid disinfectants can be hazardous to personnel 3 Warning Particular precautions should be taken when testing patients with high risk communicable diseases i e Tuberculosis Multidrug Resistant Staphylococcus infections etc When such conditions are present the clinical need When performing the disinfection e Do not use alcohol or other liquids containing Gluteraldehyde on the exterior surface of the equipment e Do not use abrasive powders or glass cleaners containing alcohol or ammonia on the plexiglas component mixing chamber or canopy of the equipment e Do not steam autoclave any component other then rubber reusable masks plastic adapter and clips should be removed Warning Do not immerse any parts in liquid unless indicated see following sections gt Introduction Decontamination is a multi step process that includes preparation at point of use thorough cleaning and rinsing and a microbicidal process Thorough cleaning and rinsing are the first and most important steps in the reprocessing of any reusable medical device Without thorough cleaning and rinsing it might not be possible to achieve high level disinfection or sterilizati
5. 4 Enter the amount of extra calories burned in a day not including the RMR measured by an activity monitor 74 Fitmate User Manual Annulla Conferma Activity monitor Time Weight weeks ikg Enter here the extra daily calories Today LU 33 burnt ina day on top of your RMP Next check amp al measured by means of an activity Goal 22 DO montor 5 Press OK to confirm or X to cancel The program will automatically be updated Exercise To estimate the energy expenditure during exercise press 3 Exercise and complete the information requested for the specific type of exercise see table Press OK to confirm or X to cancel Walking Time Weight The weekly Frequency of the specified exercise expenditure number of sessions per week Today 0 35 Mext check amp g1 Goal 2 as Exercise Required information Walking Sessions duration speed grade Running Sessions duration speed grade Leg cycling Sessions duration watt Arm cycling Sessions duration watt Stepping Sessions duration rate step height Other Sessions calories If more than one exercise is performed or the exercise performed is not included in the above list it is possible to select other and manually enter the energy expenditure of the specific activity The program will automatically be updated Goals To define the goals of a weight management program select 4 Program goal Fitmate Operation 75
6. 4 check symbol on the left of the question means jw YES Has Your doctor ever said you have a heart condition and you should only do physical activity recommended by a doctor Do vou Feel pain in your chest when you do physical activity gim the past month have you had chest pain when you were nok doing physical activity rps you lose your balance because of dizziness or do you lose consciousness Do you have a bone or joint problem that may be made worse by a change in your physical activity Is your doctor currently prescribing drugs for example water pills For your blood pressure or heart condition Do wou know of any other reason why you should not do physical activity D YOU CONFIRM ALL THE ABOVE QUESTIONS cence Answer precisely to every questions thick the check box to answer yes leave it as it is to answer no Click OK to confirm or Cancel to exit The Par Q assessment will be displayed on the screen Fitmate James BOND Risk stratification of Session Opened on 12 05 2009 E let xi SO Eile Edit View Options Window Help 8 x KK a B FTF a Ki Back to test list Al Risks Summary 3 dh AHA ACC CHD Risk gaong p o v ParQ RiskFact Body Comp Diet Han Weight Mgmt Cardio Fit Std Meas Muscular Flexi A Goal Ex Prescr ARM gt No Has your doctor ever said you have a heart condition and you should only do physical activity recom
7. Grade Treadmills Time Phase Watt I 1 0000 Rest O 0 Z O O lt Oo 00 00 Rest T 2 01 00 Rest T A 02 00 Warmup 50 d 03 00 Warmup 50 5 04 00 Warmu 50 Pas o Load Rest D D D D Bikes 52 Fitmate User Manual Select the phase and the load for bikes or the phase the speed and the grade for treadmills and press OK to confirm or X to cancel To print the protocol press 2 Exit from this dialog selecting the red X by means of the arrows Fitmate Operation 53 The RMR test with face mask gt Setting up and RMR test Preparing the Fitmate Connect the RMR mask to the RMR reader n a Connect the optoelectronic reader cable to the connection labelled Turb on the rear panel of the Fitmate 1 Connect the permapure sampling line to the socket labelled Sampling located on the rear panel of the Fitmate 2 If you are monitoring the subject s HR only Fitmate Pro Med place the HR belt on the subject s chest and connect the HR probe to the proper outlet located on the rear panel of the Fitmate 3 HR measurement at rest is useful in order in determining if the subject is relaxed during the test Preparing the Subject Ensure the subject is healthy enough to perform the test according to the guidelines Have the subject relax in a chair or lay down on a bed Attach the mask to the subject as illustrated in the picture below Pull the ela
8. How would you like to receive the Activation Codes LJ e mail O fax O voice telephone Notes cccccccccccecceccceccceccccccecauenauescuescenauenauesueesueestensuesuuesuuesuecatenauesuuesueesuensuessntgas After having read the privacy information express my permission to my personal data treatment according to Privacy Law 196 2003 in order to place an order register a product request a service answer a survey enter a contest correspond with you and to define my commercial profile for your marketing and advertising purposes The data can be provided to selected business partners and companies which carry on business for Cosmed Srl am aware that denying the consent Cosmed cannot supply the requested service O accept O don t accept Goaignaiure cece ceecceeeeceeeeeeeeees Serial Number has the following format YY Y YMM and it is reported on the bottom of the instrument Key Code is composed with two numbers of 10 characters prompted by the Fitmate Unit during the activation process Appendix 197 Privacy Information Dear Customer we inform you that your personal data are gathered and will be used by Cosmed Srl in conformity with the requirements of the Italian privacy law Decreto Legislativo 196 2003 We believe it is important for you to know how we treat your personal data gt Personal data treatment and purposes We request and process your personal data for the following purposes a To place an
9. Supramax Customisable by the user Elite AT based See Elite Limits are calculated from the measured AT Rehabilitation Labelled Very light Light Moderate and Heavy Calculated starting from the VO Reserve e Interpretation Results 84 Fitmate User Manual Fitness Results are compared with ACSM standard Rehabilitation Results are compared with AHA recommendations gt Performing a field test Press 2 Cardiorespiratory fitness Field Test to start this test Cancel Confirm ei Rockport 1 Mile mm s W Rockport 1 Mile bpr bn 15 Mile Run Test mms Cooper 12 minute im Insert duration time to cover khe distance and Heart Rate taken at the end of the Test The results of one of the following tests can be entered in the respective field e Rockport Walking Test e 1 5 mile run e Cooper test Press OK to confirm The manually entered results will appear on the screen Exit iTest 2Print 3 Print all a RMR BODY COMP STD MEAS E EN BALANCE S FIELD TEST e Field tests Date mm dd y yyw l2fe2 2005 Im 1 5 Mile Run Test VO2mectmdfkofmip 42 Fitmate Operation 85 Muscular Fitness Fitmate Pro only gt Test execution and data entry Select Muscular Fitness from the test menu to start the test Execute the test as illustrated by the picture on the left side of the screen and described at the bottom
10. Warning All the data contained in the memory will be deleted and will no longer be retrievable Thus it is recommended to back up all data gt Firmware update To update the firmware to a new release connect the unit to the PC be sure that the proper communication port is selected on the unit 3 Options 1 Settings and select Options Update firmware on the PC software Cancel Confirm Option Setting Date fronm dd yyyy aa 2006 Time hh mm po fja Language English dh Unik of meas crn kg M Turn off LED min 0 Mever E Update Firmware Ei Fitmate Backlight LED Low P DC communication USB dh Unit PC Select the communication port the device model and press OK to confirm Note if the unit displays a warning message check that the selected device is correct and in case ignore the message and continue the operation Note in case of downloading the wrong firmware on the unit e g a Fitmate Med firmware on a Fitmate Pro unit the device gets stuck In this case repeat the downloading procedure for the correct version x pP 7 _ Please DISCONNECT device From USB port x E s WI Please RECONNECT the device to the USB port Please connect the Fitmate to the PC and press OK Fitmate Operation 105 106 Fitmate User Manual Maintenance System maintenance Maintenance and repair procedures which are not described in this manual must be performed by qualifi
11. E Activate E 50 gt Training zones settings Only Fitmate Pro Med sssssssssssssosssosssossesssesosesosseosesosseosseossesosesosseosseosseosssesseessesssseoss 50 Pess Ura Haal 50 Rehabilitation training zones Fitmate Med on 51 4 Fitmate User Manual Elite training zones Fitmate e E e EE 51 gt Customize protocols only FitmMate Pro Med cccssscccsscccssscccessccssscecessccsscecesscecssceccececsssecsesececseseceseneseseusess 52 The RMR test with face Mask EEN 54 gt Setting up and RMR COSC EE 54 Bee gl ee EN 54 Bee IS CG UDE CE E 54 P TESU GXOCUUION EE 55 Automatic detection of the start end of the test cccccccescccccscccccesececcesececcsececceseccscncecersseseacaceseseneeeeseseseneuees 57 Problems during the E A le 57 Average interval Selecto E 58 E EgtoEIREGEOEGTaE Eege 59 TERNIR EC EE ENEE 60 gt Warnings and RE aal E Ed Le CN 60 gt Setting up and RMR COS sesianuantese vita tonerenewesseionucisnoantrenn ain younbaiaweeesvosusastuinuiin tin baiabiiaeeeeteseeesben yh r Vrha K ea srE Urs kabs 60 Meet gie H Gg E 60 Warnings on batteries geg 62 Bee gl De SUID IOC EE 62 P TeSt EXECUTION E 63 Summary On ESE OX CCULION EE 66 Automatic detection of the start end of the test cece cceeccccsseccccsecececccccesececauccecceececaecececauceeecaueceeauecesaueeeeeaes 67 Problems during the test execution ccccccccsssseeccceesseceeceesseceeceaesececssaeseceeesaeseceessuaueceess
12. E FoF m i ES Sampling Pump 740 Press mmHg CH Sampling Enabled Ge F Si E OH CH calib Valve e O HR thom G22 Trimmer 0 511 256 Embedded Friniter Heads Paper Thermistor rny blisrnrn 5 a le F Joan EI The control panel allows the user to check all the electrical signals as well as other equipment functions It is divided in 4 sections Signals You will find information from built in sensors The temperature sensor indicates the temperature inside the Fitmate the operating temperature of the O sensor The battery charge sensor detects the total charge of the battery in mV The O sensor detects the analyzer pressure and the O readings The HR sensor detects the heart rate if the probe is connected Controls In this section each component can be activated for troubleshooting Built in printer The icon heads indicates whether the green printer lever is opened or closed The icon Paper indicates whether the paper is ok or not The value in the field Thermistor indicates the temperature of the printer Turbine This section shows the turbine connected to the Fitmate and the volume and measured flow values gt LCD contrast Cancel Contirm LCD Contrast 4 goum This utility allows you to adjust the contrast of the display 1 Use the left and right arrows to roughly adjust the contrast 2 Use the up and down arrows to finely adjust the contrast 3 Press OK to co
13. E POWwer SUPPI ernia S 216 Old models till S N XXXXXX0999 eeeeeeessessessessessesseeseeeseseesereeeeerrerererereeereeereerrererereeererererererereeereereereereerreeereee 216 New models from S N SNNXNNIOO0 216 SE e eg 216 e AUTONO a EE S 216 Old models till S N OXKK XK OS 99 RE 216 New models from S N SNNXNNIOO0O 216 Eege 216 gt DIMENSIONS and NEIES Zeene Eege 217 EE 217 P CAO aac EN E ENEE E E E EA R ys 217 BAG RON TO PS CS E E EE EE EE 217 Kleren E 217 TC e EE 218 Zell 218 A e 218 d d EH le eap OAE 218 D CANE ON e wegisc cares ce enteuc E E EE E vedi cane se qnscuevespaeesseasaeeeteveseesausacedueastencseuseuness 218 F e ET 218 ST E vena senu esate uate syste cise siieh anise te uu ysuia eae AOA OAE EA OOO 218 d CONMODY wiccsnsscvsscnscevesuccannsacoaducsceanssewsnsns snneaunsaseenenb E E E E A E E E 218 P TE E TC 219 ebe 220 dal SSCS SI E LE 220 Sall ein tee EE 220 Cardiopulmonary exercise testing VO MAX cccccccsssssseccceccceeesecccceeeeeeeesececceeeeuaesseceeeeessueeeeeeeeeesaeegseeeeeeteeeegees 220 indirect e Meet on d EE 220 SUA er ET E 220 BR USI IM AY SUS A ce center east ars esac es dene ea A vc EE need parca wane nee E eas see ea eaves ence E E E EA 220 Ee 220 TST eege 221 Table of contents 11 12 Fitmate User Manual Getting started Important notes gt Intended use Fitmate is an electronic device developed for performing the following test types Fitmate Fitmate PRO Fitmate MED Fit
14. Enter the measured value here Flexibility crn 23 For the sit and reach test a yardstick is placed on A the floor and tape is placed across it at a right angle to the 15 inch mark The participant sits with the yardstick between the legs with legs extended at right angles to the taped line on the floor Heels of the feet should touch the edge of the taped line and be about 10 to 12 inches apart If a standard sit and reach box is available heels should be placed against the edge of the box The participant should slowly reach forward with both hands as far as possible holding this position momentarily Be sure that the participant keeps the hands parallel and does not lead with one hand xl cence _ Execute the test as illustrated in the picture and described on the left side of the screen Then enter the test result in the proper field Click OK to confirm The evaluation of the flexibility will display on the screen Fitmate James BOND Tests of Session Opened on 12 05 2009 200 laj sl File Edit view Options Window Help 18 x KE EE esienlek EE CS aka v ParQ y RiskFact y Body Comp Diet Plan y Weight Mgmt y Cardio Et y Std Meas yy Muscular y Eed Goal Ex Prescr 4 RMI ack to test lis _ gt i d Summary gt Notes Gei Session Information a Risk stratification a Nutritional Assessment a Cardio respiratory Fitness w Standard Measurements Flex
15. P TNE turbine TOW MELEN sanonnan a upon vosevnesssvanyas connnnnsvaesusonsoanvnesesvansesconneenavoesuoenvosnuiestevenseseunnes 113 Cleaning the Did te scesae ae vecatanensee eroracartnaarndan irase risann raa IE aAA EEEE EAEE AEE asuutadandite Tai 113 Weigel T d Ed 113 Disinfecting the turbine for CANOPY option 114 Precautions to take when cleaning disinfecting and drying the turbine esssessssessesesresersrrerrererrererrererrerererreree 114 gt VO max mask and mixing Chamber Mask scssccsccsscsscceccesccscceccesccscceccesccscceccescescceccescesccnccescesccsccescsccsccecees 114 VIG SS MO Bl EV WAG I sorters E N E ecu yn ca E E A E E A E E E TE 114 Cleaning themask ttres ttt setetest t sste rrtt rete ert ers sterse renret enseteesrteeeererereeeent 114 DEIENE ANE E 114 Senne MeT E e E E 115 Reassembling the mask and components sessssessssesseseseeresrersrrrrerrrreserresrereseereseeresetresreresetreseereseeresrereseereseereseee 115 gt Cleaning the headcap assembly sessssesessesessecssseosesecsesecsesecsesecssseosesecseseosssecseseosesecesseosesecsesecsesecsesecsesecsesecesseoe 116 gt Cleaning and disinfecting the RMR canopy hood and veil Option ssessessessessesseoseoseoseoesoessessesseoseoseoseossossosssee 116 Cl aninge hood and KC UE 116 DISCUS IO OG Ee KEE 116 Sampling line Maintenance PErMaPULe ccsseccssccsseccescccssccnscccsscccscccescccscccescccscccescccssccuscccesccuseccuscccssccusc
16. Std Meas Muscular Flexi Goal Ex Prescr ARM ack to test lis El R Risks Summary wi Par O amp You HDL Cholesterol mg dl 50 00 HAa ACC CHD Risk Risk Factor 1 0 Below average risk Average risk Moder above aver risk High risk 2 3 2 5 2 6 4 2 gt Duke Treadmill score Fitmate Med only To perform the Duke Treadmill score test double click on the icon Duke Treadmill score Enter the requested data and press OK to confirm or Cancel to cancel Duke Treadmill Score Functional Capacity METS e ST Segment Deviation ron 1 Angina during exercise None D Cancel The test report will appear on the screen Fitmate James BOND Risk stratification of Session Opened on 12 05 2009 Eile Edit View Options Window Help l x PAE mmr eN Be a v ParQ y RiskFact Body Comp Diet Plan A Weight Mgmt Cardio Fit A Std Meas A Goal gRMR y Duke A EuroCYD A Bode Inde ack CO Eest Ils Gre gt Al Risks Summary Functional Capacity METS 8 0 S Par Q amp You Seet Devistion immi 0 w AHAJACC CHD Risk esoe Duke Treadmill Score 9 leg dien eeen Aea deeg deng cp Treadmill Score dh European CVD Risk A BODE Index gt European CVD Risk Fitmate Med only To perform the European CVD Risk test double click on the icon European CVD Risk Performing tests with the PC Software 167 En
17. This wizard helps vou install software for Cosmed USB Device Le j IF your hardware came with an installation CD lt or floppy disk insert it now What do you want the wizard to do Install the software automatically Recommended Click Next to continue 4 Select Install from a list or a specific location and press Next gt Hardware Update Wizard Please choose your search and installation options eS 0 Search for the best driver in these locations Use the check boxes below to limit or expand the default search which includes local paths and removable media The best driver found will be installed Search removable media floppy CD ROM C Brother bretS cn Browse O Don t search will choose the driver to install Choose thie option to select the device driver from a list Windows does not guarantee that the driver you choose will be the best match for your hardware 5 Select Search removable media and press Next gt Installation and Activation of Software 141 Hardware Installation A The software you are installing for this hardware Cosmed All models USB Driver has not passed Windows Logo testing to very its compatibility with Windows SP Tell me why this testing iz important Continuing your installation of this software may impair or destabilize the correct operation of pour system either immediately or in the future Microsoft s
18. e Key Code This is a security number generated by the instrument and is necessary for the correct activation of the unit Abork End Version 2 2 2010010101 Fitmate PRO 470196790 a _ If you would like to skip the registration process press the E key and keep working with the unit 4 To obtain the activation code you will need to send a Fax to COSMED 39 069314580 or e mail register fitmate net including all the information in the Registration Form which can be found in the Appendix 5 COSMED will then send the activation codes which include the information referred to the enabled Software version 6 You will enter the activation code in the appropriate fields when turning on the Fitmate The activation code may also be entered by selecting 3 Options 6 Activate FITMATE from the main menu PC Software Registration The Fitmate PC Software is automatically activated when connecting a previously activated Fitmate This activation expires after 30 days without Fitmate being connected To renew the registration just connect a Fitmate For further details see the Software Installation and activation chapter For more information contact COSMED S r l Via dei Piani di Monte Savello 37 PO Box 3 00041 Pavona di Albano Rome Italy Ph 39 06 93 15 492 Fax 39 06 93 14 580 email customersupport cosmed it Internet http www cosmed it http www fitmate net Claims and suggestions Please send e
19. the green LED will be on during charging Plug the Fimtate in and let it charge the green LED will be on during charging Verify whether keys are depressed If necessary reset the unit by inserting the point of a pencil or a paper clip into the small RESET hole located in undersideof the unit Contact COSMED for an activation code following the instructions in this user manual Refer to the section on paper installation in this manual Maintenance 121 Archive Management To view more patients scroll using the up and down arrows of the navigator tool cannot view a patient that know isin The display can only show the first 8 the Archive patients entered at once If you don t want to terminate the The unit advises that the session will current session perform the tests be terminated when selecting a test One testing session cannot contain not yet executed before repeating a already performed in the current two tests of the same kind test However it is not required to session perform all the tests available for terminating a session Enter e new subject Subject data cannot be modified It is possible to delete a subject if cannot modify a subject s information y J once entered in the archive on the necessary in the Archive Fitmate You may modify information when downloaded to PC it is impossible to enter the subject s Fitmate manages both data format Be sure thet the proper format was
20. Body composition Ki Personalized weight management program lt S el S Daily nutritional needs C C C C C C C C Cardio Respiratory Fitness VO max Muscular Fitness Flexibility Assessment Ss S Fitness goals definition Energy Expenditure during exercise Exercise Prescription Ss e Basic spirometry Oximetry option RK Risk analysis test performed through PC only gt Description of Fitmate Fitmate consists of the following parts e Fitmate unit e Battery Charger e Optoelectronic reader mask and other accessories Below is a brief description of each part and how to connect them to the Fitmate unit gt Fitmate Unit The Fitmate unit is composed by e Colour display e Keyboard e Built in printer e Connectors on the rear panel The display The color display allows the user access to all the functions to visualize the tests performed and to navigate through the subject database Getting started 21 The Keyboard Fitmate has a built in numeric keyboard see below abe def a F 3 on off l The arrow keys to the left on the keyboard act as the navigator tool This allows the user to scroll through the windows and confirm their selections The 10 alphanumeric numbers to the right on the keyboard allow for input as well as powering the Fitmate For a better understanding of each single button functionality please refer to the C
21. COSMED to purchase a Lifecorder Plus compatible with Fitmate software In order to install the drivers please connect the Lifecorder Plus to the Pc through a mini B USB cable not included code A 362 315 004 and put the Fitmate software CD into the CD driver The guide to install the HW will open up Windows XP Please follow the same procedure as for the Fitmate drivers Windows Vista Windows 7 The installation of the drivers in Windows Vista or Windows 7 is fully automatic gt Verify the proper installation of the USB drivers In order to verify the proper installation of the USB drivers in the PC please connect the Fitmate to the PC and turn on the unit Windows XP Right click on the My computer icon and select Properties 142 Fitmate User Manual In the Hardware tab select Device manager and check among the USB controllers that the Cosmed All models USB driver is present and does not have a yellow marker In case the driver is not properly installed please uninstall and reinstall it Windows Vista Enter in the PC Control Panel and double click on the System icon Select Device Manager and check among the USB controllers that the Cosmed All models USB driver is present and does not have a yellow marker In case the driver is not properly installed please uninstall and reinstall it gt Installing and using shared archives PCs can share the archives over a network Shared archives are
22. RMR It is possible to enter a different RMR value other than the measured value by selecting 1 RMR Press OK to confirm or X to cancel Cancel Contirm Time Weight Get RMP value Kcaliday weeks kg D 95 Today Next check amp g1 Goal 22 as The weight management program will be automatically updated If the current session contains an RMR test the RMR value is preset to the measured value even if you have modified this value Lifestyle The energy expenditure influenced by your Lifestyle can be estimated by pressing 2 Lifestyle You can 1 Select lifestyle Sedentary normal active Fitmate Operation 73 Annulla Conferma Select Sedentary D Time Weight weeks kg Ma physical activity at all Today 0 35 Net check amp al Goal 22 35 2 Define how much time is dedicated to a specific physical activity Cancel Contirm Time Weight Remaining hours weeks L Define lifestyle describing your Today 0 tipical day excluding planned Next check 6 71 lexercise sessions Goal 2 as 3 Enter the steps counted with a pedometer during an entire day Annulla Cont erma Select Fedometer dh Steps 18500 Time Weight weeks kg Enter here the daily steps count Today 0 33 measured with a pedometer Next check amp 71 Together with your body weight Goal ee 273 height and age it will allow an estimation of the number of calories burnt every day on top of your RMR
23. Speed set to mph Trackmaster Kph Trackmaster treadmills speed set to Kph Woodway Woodway Treadmills Monark Monark Bikes Warning COSMED tested compatibility between Fitmate and the ergometers included in the above list Interfacing Fitmate with other ergometers can be dangerous The safety in connecting Fitmate and ergometers depends on many parameters e g the protocol the connectors the ergometer software version 3 Cosmed does not support customers for connecting ergometers not included in the above list and does not assume any 3 liability for damages caused by i erroneous connections ii use of not original cables accessories iii connection with ergometers not included in the above list or iv other unauthorized operation Important note Software and hardware changes made by ergometer manufacturers aimed at device improvement and legislative changes can make the above list not trustworthy Therefore the above list is only reported just as an indication COSMED guarantees compatibility only with ergometers purchased at COSMED together with the Fitmate COSMED does not assume responsibility for incompatibility with an ergometer even if included in the above list if it is purchased by the customer independently from Fitmate PEC eee 214 Fitmate User Manual Integration with GE Cardiosoft Fitmate Pro Med only Starting from 2 0 PC software release Fitmate software can be synchroniz
24. Wl WwW WwW Ww WH WW DM IDN IT MT W w w w w wl w w w w w Wl WwW Ww WO WH WW DM IDN IT WwW W NIN ele lel lelelele LO el O WO ONIA O A Ww O N N NIN N O Ae 27 u ajajaja anaana LA UIU UIU UU UUU UW w w w w w w w w w w LA UIU UIU UU UUU UW N LA O recovery The protocol can terminate before the end if the end of test condition is reached or you stop it manually Appendix 205 Modified Balke 5 30 mm mm rm mm mm mm mm mm mm mm mm mm mm mm mm mm mm mm mm mm mm mm mm mm mm mm mmm mi Time mm ss Speed km h Speed mph Incline 4 3 2 6 4 3 2 6 03 00 04 00 05 00 06 00 07 00 08 00 09 00 10 00 11 00 12 00 13 00 14 00 15 00 16 00 17 00 18 00 19 00 20 00 21 00 22 00 23 00 24 00 25 00 26 00 27 00 The protocol can terminate before the end if the end of test condition is reached or you stop it manually W N LP AAAI A A A Wi UIU ww W NIN NIN IN Ov a7 0 OD O en gt N 4 3 2 6 8 WO e o st eel Ee ee S E S E S e eS wlw WwW WwW Di Di Ww ww Ww Ww Ww Ww Di ww D n o Be Be E 7 E a 9 7 eee eee DIDIHIAIHA ALD AIA ALA Ala Ala al ala O recovery 206 Fitmate User Manual Run 10 Kmh 6 2 mph Incl Time mm ss Speed km h Speed mph JI 6 03 00 04 00 05 00 06 00 10 0 07 00 10 0 08 00 10 0 09 00 10 0 10 00 10 0 11 00 10 0 12 00 10 0 13 00 10 0 14 00 10 0 15 00 10 0 16 00 10
25. one starts at E z of VO2max Threshold one starts at jar 2 of O2max RacePace one starts at E 2 of VU Amau VO2max Zone starts at 36 of YO2max Anaerobic one starts ak i D 2 of VU Amau Anaerobic Zone ends at i 05 2 of VU Amau Jh Print Training Zones Elite Zones nd Annulla Applica The Training Zones Setup section is different depending on the device and the Training Zones set selected It is possible to configure e the unit of measurement kg meter or inch pound e the cholesterol units of measurement e the background e the spirometry predicteds set Fitmate Med only e ifthe printing of the diagnosis is enabled disabled Fitmate Med only e if the printing of a report on the nutrition facts in the Weekly Diet Planner test is enabled disabled e if the printing of the warnings is enabled disabled e the training zones this part is different depending on the device and the Training Zones set selected e if the printing of the training zones is enabled disabled JE CS 3 Note changing the Training Zones will modify these values in all the new subjects Training zones for each subject can 3 then be changed for their limiting values but not for the set selected 150 Fitmate User Manual Archive pplica Type the path where all the data will be will memorized Thick the check box Shared Archive if wishing to share the archive in a network gt Language of the software
26. 0 17 00 10 0 18 00 10 0 19 00 10 0 20 00 10 0 LO LP LP LA E U O d Un DIN HD u A HIM wo zl Lol uo k slutairateieteiekeie LD 0 Appendix 207 Run 12 Kmh 7 5 mph 14 00 12 00 10 00 8 00 8 00 Incl E x lt 4 00 2 00 0 00 Time mm ss Speed km h Speed mph Incline 6 03 00 10 0 6 2 04 00 11 0 05 00 12 0 06 00 12 0 07 00 12 0 08 00 12 0 09 00 12 0 10 00 12 0 11 00 12 0 12 00 12 0 13 00 12 0 14 00 12 0 7 5 18 7 5 28 7 9 30 o olia N OIOI oO OC O 19 00 12 0 20 00 12 0 208 Fitmate User Manual Run 14 Kmh 8 7 mph l l I PS Time mm ss Speed km h Speed mph Incline 00 00 5 0 01 00 02 00 03 00 04 00 05 00 06 00 07 00 08 00 09 00 10 00 11 00 12 00 13 00 14 00 15 00 16 00 17 00 18 00 19 00 20 00 LD DI NIAI UW BR WIN F O O O0 0 0 OH Appendix 209 Run 16 Kmh 10 mph l l I z Time mm ss Speed km h Speed mph Tae atom 69 00 00 0 01 00 02 00 03 00 04 00 05 00 06 00 07 00 08 00 09 00 10 00 11 00 12 00 13 00 14 00 15 00 16 00 17 00 18 00 19 00 20 00 HOI CON DM OT BLE WINTRY OoO o o o oOo OF 210 Fitmate User Manual Run 18 Kmh 11 2 mph l l I z Time mm ss Speed km h Speed mph Incline 00 00 10 0 0 01 00 11 0 02 00 12 0 03 00 13 0 04 00 14 0 05
27. 350 m sl MMRC dyspnoea scale Irroubled by shortness of breath when hurrying on the level OR when walking Cancel The test report will appear on the screen Fitmate James BOND Risk stratification of Session Opened on 12 05 2009 l File Edit view Options Window Help l x w S oO HDF ta E Ge v ParQ y RiskFact Body Comp A Det Han Weight Mgmt Cardio Fit A StdMeas A Goal RMR y Duke y EuroCvD y Bode Inde ack CO Cest lis SE gt R Risks Summary Body Mass Index Kg m 2 24 7 kee Ti as of predicted 744 Bi BHAJACC CHD Risk JJ tuueerE BODE Index 1 O ECH E SE EC E CL wi Duke Treadmill Score w European CVD Risk CODE Index gt Risks Summary Ree To review the Risks Summary click on the icon Risks Summary A summary of the information entered during the Risk Analysis phase is shown as well as the tests results 168 Fitmate User Manual Fitmate James BOND Risk stratification of Session Opened on 12 05 2009 Eile Edit view Options Window Help l x g gt qy a GUE ea ParQ y Risk Fact Body Comp Diet Plan Weight Mgmt Cardio Fit y Std Meas Goal RMR y Duke y EuroCYD y Bode Inde Back to test list Qj v y Body Comp A A Weight Mgmt A A E E w w w gt Al tisks Summary Be y HDL Cholesterol mg dl Par Q amp You AHASACC CHD Risk Duke Treadmill Score European C
28. 387 A and 387 M e are CE marked according to the Medical Device Directive 93 42 EEC and certified by CERMET certificate nr MED 9811 The equipment conform with the following specifications Safety CEI 62 5 IEC 60601 1 EN 60601 1 EMC EN 60601 1 2 194 Fitmate User Manual Service Warranty gt Warranty and limitation of liability COSMED provides a one 1 year limited warranty from the date of the original sale of COSMED products All COSMED products are guaranteed to be free from defect upon shipment COSMED s liability for products covered by this warranty is limited exclusively to replacement repair or issuance of a credit for the cost of a defective product at the sole discretion of COSMED COSMED shall not be liable under the foregoing warranty unless i COSMED is promptly notified in writing by Buyer upon discovery of defect ii the defective product is returned to COSMED transportation charges prepaid by Buyer iii the defective product is received by COSMED no later than four weeks after the last day of the one 1 year limited warranty period and iv COSMED s examination of the defective product establishes to COSMED s exclusive satisfaction that such defect was not caused by misuse neglect improper installation unauthorised repair or alteration or accident If the product is manufactured by a third party COSMED shall make available for the Buyer s benefit only those warranties which COSMED has receiv
29. EE 170 PEEL Nd AN AS Ss E 171 A BOOY COMI OS OOM EE 171 Case A the percentage Of FAT is known 171 Case B The percentage of Fat is unknown and it is required its measurement cccccesecceeeseceeeesececeeeeeeeenees 171 Ee e EE 172 Eesebuer 172 D EMGLEV UE E 173 RIR ageet 173 BE 174 ge E 176 EE E 177 ISUZU OMG in Fe SIS nra vio sacaciendpadan seonaedioesuncneatabscasuuiandewhedondadae E Sonuadstes 178 SE diet En TE 179 De ACHIV TNO VANE ON sea a E relevent uaaanyeos uses ea cseca une aee ven pag nuanyagguse A 181 initialize the Activity IV OMI e 182 Read data from the Activity Monitor 182 Cardiorespiratory Fitness Fitmate Pro Med Only ccccssscccssssecccsssecccssseccceescccceesecccseseccceesecccesececsesececeesececeesecceeess 184 P EXGCUTE a VO EE CSE EEN 184 Muscular Fitness Fitmate Pro only seseesecsesscsnesscssessesseseoseoseoscosesnessessessessessoseosscsessessessessessessoseoseosecssssesneseessessoseeseo 186 gt Test execution and data entry EN 186 Flexibility Assessment Fitmate Pro only scccssccsssccsseccsscccscccesccseccnscccssccescccesccscccescccscccescccssccuscccssccuscccesccsccoesses 187 gt Test execution REENEN 187 EEGEN 188 r Setthe goal trea hca a aa 188 Table of contents 9 Exercise prescription Fitmate Pro Detten EERSTEN EEN 190 gt Prescribing an exercise program ssessessessessecsecsecsecsssecsecsecsecsecsecsecsecsececsecsecsecsecsessecseosecsesecseesessec
30. Expiratory Volume in 1 sec FEV1 FVC FEV1 as a percentage of FVC PEF I sec Peak Expiratory Flow FEVO 5 Forced Expiratory Volume in 0 5 sec FEV6 Forced Expiratory Volume in 6 sec FEV1 FEV6 FEV1 as a percentage of FEV6 FEV6 FVC FEV6 as a percentage of FVC Best FVC Best Forced Expiratory Vital Capacity Best FEV1 Best Forced Expiratory Volume in 1 sec Best PEF I sec Best Peak Expiratory Flow Vmax25 sec Expiratory Flow when 75 of the FVC remains to be exhaled Vmax50 I sec Expiratory Flow when 50 of the FVC remains to be exhaled Vmax75 sec Expiratory Flow when 25 of the FVC remains to be exhaled FEF25 75 I sec Mid exp flow between 25 75 FVC FET100 sec Forced expiratory time FEV2 Forced Expiratory Volume in 2 sec FEV3 Forced Expiratory Volume in 3 sec FEV2 FVC FEV2 as a percentage of FVC FEV3 FVC FEV3 as a percentage of FVC FEV1 VC Tiffenau index FEF50 75 I sec Mid exp flow between 50 75 FVC FEF75 85 I sec Mid exp flow between 75 85 FVC 92 Fitmate User Manual FEFO 2 1 2 l sec Mid exp flow between 0 2 1 2 FIVC L Inspiratory Forced Vital Capacity FiF25 75 I sec Forced mid inspiratory flow FiV1 I sec Forced Inspiratory Volume in 1 sec PIF I sec Peak Inspiratory Flow VEXT ml Extrapolated Volume back extrapolation PEFT msec Time to PEF 10 90 Performing the test 1 Explain the manoeuvre to the patient breathe at rest for several breaths perform a maximal inhalati
31. Lung and Blood Institute European Guidelines on CVD Prevention Third Joint European Societies Task Force on Cardiovascular Disease Prevention in Clinical Practice De Becker G Ambrosini E Barch Johnsen K et al Eur J Cardiovasc Prev Rehabil 2003 10 Suppl 1 S1 S78 AHA ACC Scientific Statement Assessment of Cardiovascular Risk by Use of Multiple Risk Factor Assessment Equations A Statement for Healthcare Professionals From the American Heart Association and the American College of Cardiology Scott M Grundy Richard Pasternak Philip Greenland Sidney Smith Jr and Valentin Fuster Circulation 1999 100 1481 1492 Frammingham Study Wilson PW D Agostino RB Levy D Belanger AM Silbershatz H Kannel WB Prediction of coronary heart disease using risk factor categories Circulation 1998 97 1837 1847 DeLong Frank E Harrell Jr Lawrence H Muhlbaier and Daniel B Mark Leslee J Shaw Eric D Peterson Linda K Shaw Karen L Kesler Elizabeth R Use of a Prognostic Treadmill Score in Identifying Diagnostic Coronary Disease 1998 98 1622 1630 Circulation Celli BR Cote CG et al The Body Mass Index Airflow Obstruction Dyspnoea and Exercise Capacity Index in Chronic Obstructive Pulmonary Disease N Engl J Med 2004 350 1005 1012 gt Data presentation The values measured and or entered are presented in the 4 following modes e Value e Rank e Horizontal bar e Class Some tests have different data presenta
32. OK to continue or X to abort Press Any Key When this second message is shown turn on the canopy unit 4 The red led 1 on the front panel of the unit should flash for few seconds followed by an alarm beep If the led does not flash and or the alarm does not beep the test cannot be performed because either the backup batteries are exhausted or there are no backup batteries iis EE rAcmate Canopy If the yellow led 2 turns on the backup batteries are exhausted Do not perform the test Instead please turn off the canopy unit and replace the backup batteries Fitmate Operation 63 When the green led 3 turns on you may begin the test If the green led does not turn on the test cannot be performed because the pump does not work the system is not powered the blower is not properly placed the turbine is damaged or not properly inserted the ventilation holes are obstructed or another problem exists Place the hood with the veil on the patient s head The canopy blower must be placed near the patient s top head 3 Warning Do not place the canopy hood over a patient s head before the blower is on powered a continuous flow has 3 been applied from the canopy blower and the green led is on After having confirmed the second prompt the equipment will automatically calibrate the analyzer The test will start immediately after the calibration is over During the first phase no data is stored Use this time to check whet
33. RestO2 to store the rest value with inspired oxygen supplement e 3 Exer to store the exercise value e 4 ExerO2 to store the exercise value with inspired oxygen supplement 6 It is not necessary to store all three values during a single test 96 Fitmate User Manual Risk analysis Fitmate Med only By selecting risk analysis it is possible to calculate the future cardiovascular disease risk based on different international standards Select Risk analysis from the test menu to start the test There are four 4 main test types to choose from gt European risk Enter the data requested and press OK to confirm or X to cancel Abort OK End European Risk HISH RISK Albania Algeria Armenia Austria Belarus Bulgaria Croatia Cyprus Czech Republic Denmark Egypt Estonia Finland Germany Georgia Hungary Iceland Ireland Israel Latvia Libanon Libya Lithuania Former Yugoslav Macedonia Maldowa Morocco Horway Romania San Marino Serbia Montenegro Slowakia Metherlands Tunisia Turkey Ukraine United Kingdom Mode Gender Age Total cholesterol immoli Systolic Blood Pressure mmHg Smoker 10 years CYD Risk O Mode Low risk for Belgium France Italy Luxembourg Spain Switzerland and Portugal High risk for the other Countries Total cholesterol The measurement unit can be modified in Option Advanced Systolic Blood Pressure Already entered if measured in Standard Measurements in the current session The report
34. Selecting Options Language a windows listing the alternative languages available will pop up Select the desired one Select Language B Cinese RPC Olandese Paesi Bassi nglese Stati Uniti Tedesco Germania Greco RH italiano italia L Giapponese Coreano ER Portoghese Portogallo gt Change Fitmate language unit To change the language of the Fitmate unit select Options Change Fitmate language User Interface and settings 151 Change Fitmate Language X Fitmate Le Ke Fitmate PRO Available languages Spanish Castilian Turkish Upload Close Select the communication port the Fitmate model and the language Press Upload to transfer the language Close to cancel the operation Note Besides English only one more language can be uploaded in the Fitmate gt Printout Header The page heading may be modified selecting Options Printout header Printout Header Ei Fitmate Wellness Technology D Remove logo Font Page Cancel Press Remove logo to remove the selected logo To add a new logo click on the logo Press Font to select the font of the printout header and Page to set the page size margins gt Pdf file name The Fitmate software allows to set the predefined pdf file name in case of pdf printing by selecting Options PDF file name PDF File Name I X File Mame Format Use these but
35. Show the information of the tests Modify the information of the tests performed performed Show a test not yet performed Execute the test Display a test performed Modify the test data Show the test results of the session Open up the folder containing other test to perform and the respective goals gt Show a trend j Click the icon Trend to display the trend of results for tests performed in different sessions Software features 159 Download tests from Fitmate unit Ce To download data stored in the memory of the Fitmate proceed as follows K 1 Connect the Fitmate to the PC through USB or RS232 link 2 Check if both the unit and the PC SW have been set to operate with the chosen interface RS232 or USB 3 Select File Download Test from Fitmate or press the corresponding icon on the Toolbar 4 Press the Load Refresh to activate the communication between Fitmate and PC 5 The following dialog box will be prompted Download a test from Fitmate E Fitmate PRO Destination Jh SutoSearch 0 Aa BOND JAMES New Subject HH MC LANE JOHN BOND James Fd PENNY MONEY The left side of the dialog box contains the list of subjects stored in the memory of the Fitmate while the right side the one of the subjects already present in the archive of the PC Press the button Download all new tests in order to download only the tests not in the PC archive Alternatively it is possible to operate as follows
36. User Manual Sampling line maintenance Permapure e Do not bend squash or deform the sampling line Any kink in the sample line will reduce the internal lumen of the line and affect accuracy of measurement e Do not keep the sampling line open to the atmosphere particularly in crowded or smoky environments Keep the sampling line in sealed plastic bag in a dark cool and dry place e If saliva enters the tube it should be replaced immediately e Periodically grease the O ring on the connector to ease fitting to optical flowmeter e Replace the sampling line every 100 exercise tests or 200 PFT test or every 6 months In any case sampling line will become discoloured brown with age and may cause calibration to fail Pee Maintenance 117 The equipment requires regular inspections to be carried out in order to ensure proper electrical and mechanical safety These inspections are highly recommended after rough use of the equipment or after a period of storage in unfavourable environmental conditions Referring to the electrical safety it is important to check the conditions of insulation of the cables plugs and any other visible part by means of visual inspection when the equipment is switched off and adapters or electrical feeders are disconnected from the power Mechanical parts to check are the turbine and breathing circuits Follow these instructions e Verify by visual inspection that the turbine axis fits corre
37. Warmup 25 Te Fest EE A i4 timefmin By pressing 2 Marker it is possible to mark a particular event such as change of exercise phase or symptom It is possible to manually change the exercise phase pressing 1 Phase and then 1 Recovery 2 Warm up or 3 Exercise Every change in phase is marked by an audible and graphical signal Fitmate Operation 89 Abort Phase d EI End HR bpm 6 il Phase has 33 0 HRmax been changed Keal Kcalfrmin omit oli I Dun ne sot Ds 14 tire minj Phase V02 We RE HR FeO2METS BO wel Wetter Wepkeeb e g UU T Rest 12 1 16 7 6l 19 97 5 A if not activated before the recovery phase will start when indicated by the selected exercise protocol Cancel the test To cancel the test by pressing X All the data will be lost To end atest To end a test press OK The test ends automatically when reaching the HR capacity set before starting the test At the end of the test a window with all the results will appear Exit 1Test 2 Print 3 Print all Caloric cost Date rim dd yyyy 12 23 2005 Expenditure Kcal 120 BODY COMP e STD MEAS E EN BALANCE Tei FIELD TEST MUSC FIT FLEXIB CALORIC COST Di gt Printout interpretation Below the header and the subject s data each row of the Caloric cost data is reported as a summary of each test phase The Fitmate considers a test phase a whole phase re
38. a VO Max test use the VO max reader 28 mm not the RMR reader 18mm is required The O sensor might not be installed properly or it is totally exhausted The RMR test does not start until the unit detects the first valid breaths The first minute of the test is used to check whether the equipment has been properly initiated and whether all the accessories are working properly This minute is also used to wash out the sampling tube It is thus normal to detect FeO values different from what expected at the beginning of the test The mask is most probably loose The optoelectronic reader might be connected backwards the sampling tube is loose or oxygen sensor was not properly installed The HR belt might be not attached properly or the electrodes of the HR Belt might have lost their conductivity affecting the HR detection In case the test in Maxima modality is interrupted before the exercise reaches maximum then VO Max cannot be extrapolated This option is only available in the sub maximal test Press X remove the small reader and connect the big one Check the O sensor position and if it is properly installed as indicated in this chapter Check the efficiency in the menu of the O cell If the analyzer is exhausted replace it Check if the optoelectronic reader is properly connected in the proper socket of the rear panel indicated by the symbol Turb and if the arrow near the mask in
39. be achieved with steam sterilization Type of Cycle Gravity Displacement Type of Load Wrapped Method Temperature 132 135 c Cycle Time 10 15 minutes Special Notes 1 Follow cleaning procedures as instructed prior to steam sterilization Since the degree of sterility assurance depends on the amount of contamination of items to be sterilized thorough cleaning procedures are essential 2 All lubricants should be removed from components because this will interfere with steam contact 3 Dry devices components reduce the potential for wet device packs after sterilization Sterilization container systems should be cleaned after each use Reassembling the mask and components Reassemble mask and components Use appropriate personal protective clothing to assure that you do not recontaminate the components Maintenance 115 gt Cleaning the headcap assembly Clean the head cap assembly with strap clips by hand washing with a mild detergent Do not use bleach Remove the head cap from the mask leaving the strap clips attached to the straps Machine or line dry Do not iron the head cap assembly gt Cleaning and disinfecting the RMR canopy hood and veil option Cleaning hood and veil The Canopy hood and the veil must be cleaned after every use by wiping with a soft cloth and a alcohol free solution Disinfecting hood and veil Disinfect the parts following the instructions for turbine disinfection 116 Fitmate
40. check 8 gl Goal z0 SIS 76 Fitmate User Manual Cardiorespiratory Fitness Fitmate Pro Med only Select Cardio Respiratory Fitness from the test menu User may choose between the VO max or field tests gt Setting up of a Cardio Respiratory fitness test Fitmate Preparation Connect the VO max mask to the VO max reader as illustrated by the picture below Connect the reader cable to the input labelled Turb located on the rear panel of Fitmate 1 Connect the sampling tube to the socket labelled Sampling located on the rear panel of the Fitmate 2 If HR is being monitored attach the HR belt to the subject and connect the HR probe to the proper socket located in the rear panel of the Fitmate 3 The Fitmate also has the ability to control an ergometer through a serial connection Connect the ergometer cable to the RS232 port located in the rear panel of the unit 4 and to the PC cable of the ergometer it should be supplied with the ergometer Before starting the test select the proper ergometer see after nitialization of the unit Subject preparation Make sure that the subject is in a good health Position the subject properly on the ergometer Attach the mask as illustrated in the picture below pull the velcro straps of the head cap in order to eliminate leaks The mask must be sealed to the face of the subject Fitmate Operation 77 Use the HR belt following these guidelines 1 Atta
41. di dispositivo Nome Suzuken Autore SUZUKEN CO LTD E Considera sempre attendibile il software Installa Non installare proveniente da SUZUKEN CO LTD L consigliabile installare solo driver provenienti da autori considerati attendibili Come determinare quale software di dispositivo pu essere Installato senza pericoli 10 Install if needed the USB drivers Installation Complete Setup was completed successfully Cosmed Software Installation The software is now installed Reboot the PC Note the software is protected Perform the installation always with the original CD 140 Fitmate User Manual gt Installation of the Fitmate USB driver Windows XP 1 Insert the Installation CD in the proper driver 2 Connect Fitmate to the PC through the USB cable The guide to install the HW will open up Hardware Update Wizard Welcome to the Hardware Update Wizard Windows wll search for curent and updated software by looking op your computer on the hardware installation CD or on the Windows Update Web site with your permission Read our privacy policy Can Windows connect to Windows Update to search for software Yes this time only es now and every time connect a device No not this time Click Next to continue 3 Answer No to the question Allow the connection to Windows update to look for new software Hardware Update Wizard Welcome to the Hardware Update Wizard
42. in it Read data from the Activity Monitor 3 Note The Lifecorder Plus can store data for up to 60 days After this period it begins to delete the first days to replace their data with the current ones 182 Fitmate User Manual Fitmate James BOND Weight Management Tests of Session Opened on 12 05 2009 File Edit View Options Window Help l amp x 7S onOne 12 L P SF IGG F E SES v ParQ y RiskFact y Body Comp A Det Plan e Weight Mont Cardio Et y Std Meas A Goal RMR y Duke e EuroCVD y Bode Index p ActivityMon ACK CO Test We 4 eliz nd f Body Composition Daily Avg Daly Target Total P Weekly Diet Planner 3 s WEE Eeer ER TT Te N Recorded Period 09 03 2009 07 05 2009 Activity Time min ttts 10 20 eu P Personal Weight Management 9 Activity Energy Expenditure cal 348 c D acts Ce L I E EE dh Resting Metabolic Rate Distance km pa Z mm emm eeh Level very Light hh mm E ctivity Monitor 00 18 18 01 Intensity Level Moderate hh mm D LT Intensity Level Heavy hh mm DIS E Functional Capacity METS LE dall Energy Expenditure Kcal 5000 4000 3000 2000 1000 0 lun mar mer gio ven sab dom lun mar mer gio ven sab dom lun mar mer gio ven sab dom lun mar mer gio ven sab dom lun mar mer gio ven sab dom lun mar mer gio ven sab dom lun mar mer gio ven sab dom lun mar mer agivity Energy Expenditure Kcal 500 D o AN e A i W 0 lun mar mer gio ven s
43. of one digit Small letters are put after the sequence of capital letters and before the number for example the gt key has in order the characters AB Ca bc 2 e g To enter Ba4 it will be necessary to press the following buttons abc abc abc abc abc abc ghi ghi ghi ghi ghi ghi ghi lt pause gt The order of the sequence of each single button is always letters and figures figure and symbols for the button Pressing the Left key one or more times the cursor will move to left deleting one or more digits For the fields that must be mandatory filled in the left key allows to scroll the entry options from the list Pressing the Right key one or more times the cursor will move to right adding blank spaces For the fields that must be mandatory filled in the right key allows to scroll the entry options from the list gt Acoustic signals An acoustic alarm indicates an event once you hear this check the display for warning messages Fitmate Operation 43 The main menu and the toolbar OK Contirm Yiew Search Options Utilities FitmatePROviSbi2 07 05 2009 1623 2 Bax Fi aco As soon as the Fitmate is turned on the main menu appears on the display Select the desired item to access to the Fitmate s functions The toolbar in the lower part of the screen shows the following information e The Fitmate model in the above example Fitmate PRO e The firmware version in the above example 1 5 b12 e T
44. order register a product request a service answer a survey enter a contest allow communication with us and to supply necessary authorities with the required information b To define your commercial profile c To use your commercial profile for marketing or advertising purposes d For necessary accounting procedures such as emailing commercial invoices e To provide information to the selected business partners needed to supply your service gt How your personal data are treated Your personal data will be stored in electronic format and protected at the best from destruction loss even accidental not authorized accesses not allowed treatment or use not in conformity with the purposes above listed gt The consent is optional but If you deny the consent we regret we cannot supply the service gt Holder of the treatment The holder of the treatment is Cosmed Srl Via dei Piani di Monte Savello 37 Pavona di Albano Laziale RM The responsible of the personal data treatment is indicated in the documentation stored by Cosmed Srl itself gt Customer rights In accordance with Art 7 you may a Obtain confirmation of the existence and sharing of your personal data b Obtain information on the e updating correction or integration of your data e deletion or transformation of your personal data c Deny your consent to treatment of your personal data These rights can be exercised by a request in writing to th
45. per day Heavy hours per day E Close this window D hours left Planning for a weight loss of 0 45 Kg per week Weight Plan Graph Plan reminder i Estimated weight Physical Activity Level Sedentary tuw Ideal weight loss Exercise 0 Food o te kcal 1775 kcal 12 05 2009 16 03 2010 19 01 2011 24 11 2011 28 09 2012 h 500 kcal 3 Enter the amount of extra calories consumed in a day exceeding the RMR and measured with an activity monitor Personal Weight Management g l x Activities My Lifestyle do not include planned exercise sessions _Std Classification User def d Activity Monitor Pedometer AMR Kcalt E Enter here the extra daily calories burnt in a day on top of vour RMR measured by means of an activity monitor Cancel E Close this window Planning for a weight loss of 0 45 Kg per week Plan reminder i Estimated weight Physical Activity Level Sedentary wat Ideal weight loss Weight Plan Graph Exercise 0 Food o CSF kcal 1775 kcal 12 05 2009 16 03 2010 19 01 2011 24 11 2011 28 09 2012 r 500 kcal 4 Indicate the steps walked in a day and counted by a step counter Performing tests with the PC Software 175 Personal Weight Management x Activities My Lifestyle do not include planned exercise sessions _Std Classification User def d Activity Monitor Pedometer Number of steps per day 1 Enter here the daily steps count measur
46. phones Maintenance 135 The equipment displays some zero values during the execution of the test The green light located in the bottom right part of the display turns on from time to time during the test and the indicator in ex near the small mask no longer matches the breathing rate In the printout the energy expenditure for each test phase is not reported The maximum HR for each phase is not the one measured 136 Fitmate User Manual The equipment discards all the invalid steps e g when a calibration is being automatically executed during the test the breaths are discarded from the final averaged calculation An air calibration is being automatically performed every 6 minutes The frequency of the automatic calibration can be set from the menu options advanced For each test phase METS values are reported The energy expenditure reported is relative to the entire test The maximum HR reported in the printout for each phase is the peak for the whole test For each phase is HR reported the mean Ignore these values which will be reported on the printout however they will be marked as an invalid step and discarded from the final calculation Ignore this event and keep perfroming the test The algorithm that manages the test will discard these steps form the final calculation Do not remove the sampling tube from its position during the automatic calibration Installation and A
47. session to another session Views the description of each parameter Views the summary in an alternate format Refreshes the screen Prints the notes Edits the notes Software features 157 Open in a new window Opens the notes in a new window Refresh Refreshes the screen Right click on Session Information Edit Edits the information Open in a new window Opens the information in a new window Refresh Refreshes the screen Right click on a test folder Open test group Open up the folder containing the tests Refresh Refreshes the screen Right click on a performed test Print Prints the selected test Edit Edits the selected test Open in a new window Opens the selected test in a new window Move to another session Moves the selected test to another session Delete Deletes the selected test from the archive Gauge text Views the description of each parameter Refresh Refreshes the screen Right click on a not performed test Execute Performs the selected test Refresh Refreshes the screen 158 Fitmate User Manual Managing test results To display the test results of a subject select the subject from the list and chose a testing session gt Show and modify the test results of a session Use the icons below indicated to display and modify every test data Icon Click Double click L Get back to the previous menu Show the summary of session Modify the information of the session Show the notes Type or modify the notes
48. stored on a PC the server while the other PCs enter into it in order to read and store tests PC server The software must be installed first on the server PC and then on the other PCs In order to install the Fitmate software with the archives shared it is necessary to select the checkbox Shared archives during the installation procedure Cosmed Fitmate Installation _ Of x Choose Components Choose which Features of Cosmed Fitmate you want to install Check the components you want to install and uncheck the components you don t wank bo install Click Next to continue Shared archives Start Menu Shortcuts Visual C Runtime Libra C USB Drivers Description Position vour mouse over a component to seg its description Select components ta install Space required 0 0KB Gosmed Software Installation Choose Install Location Choose the Folder in which to install Cosmed Fitmate Choose Archive path Archive Path C Documents and Settings All Users Cosmed Fitmate archive Browse Space required 0 0KB Space available 6 866 Gosmed Software Installation lt Back Install Cancel When the software is installed in the server PC please share the Archive folder in the folder where you stored the archives with the other PCs giving both reading and writing rights Since the sharing procedure depends on the used Installation and Activati
49. to enter the menus There are two ways to access the menus e Press the number on the keyboard which corresponds to the menu that you would like to enter e Use the arrow keys to navigate to the menu Press OK to enter a menu when the menu you want is highlighted These methods are interchangeable gt Keyboard Hereunder is a brief description of the functionality of each single button of the keyboard Button Description Ka Turn on off button Navigator tool to scroll up a menu and or get back to the previous field when entering data Navigator tool to scroll down a menu and or pass to the next field when entering data 42 Fitmate User Manual 1 Navigator tool to move right through the menu To space right when entering data and or to select an entry in case of multi options fields Navigator tool to move left through the menu To cancel the last digit when entering the data and or to select an entry in case of multi options fields To enter the number 1 or one of the symbols 5 amp OK To confirm the selected entry Functioning principles of the keyboard Hereunder are the rules that regulate the data entry If pressing repeatedly the same button a sequence of letters figures and symbols will display in the screen The sequence will stop if leaving the button for more than one second or if pressing a different button The valid digit will be the last of the sequence and the cursor will right shift
50. to test list Summary gt Notes Dear James SP EK Unsupervised I would like to thank you for participating in our recent fitness screening The results of your assessment based IA l Session Information upon norms for your age and sex are attached Following a thorough review of your health risk appraisal and fitness assessment we identified no cardiovascular risk factors based upon criteria from the American College of Sports Medicine Based upon your age family history and health status we find no reason to limit your participation in this exercise program In order to control reduce risk factors achieve a cardiovascular benefit and burn stored fat as a primary fuel it is important that you adhere to the following exercise guidelines Your exercise prescription as described to you at the time of the assessment is comprised of three stages Risk stratification Nutritional Assessment Cardio respiratory Fitness EE EE Nl go e Initial conditioning stage 6 8 weeks Standard Measurements e Improved conditioning stage 4 8 months e A maintenance conditioning stage lifetime Z Muscular Fitness _ _ __ __ _ o Flexibility Initial Improvement Maintenance 7 k S In each of these phases the components of the program duration and intensity of cardiovascular training strength training and A Program Goal flexibility development will gradually change based upon your individual progress In this i
51. will appear on the screen Exit 1Test 2 Print 3 Print all ZS BODY COMP European Risk SI EN Date dd mm yyyy S0 01f2008 S C Mode LOW RISK Total cholesterol Commoifl 2 3 Systolic Blood Pressure mmHg 120 Smoker VIe 10 years CND Risk o Oo gt Frammingham CHD Enter the data required and press OK to confirm or X to cancel Fitmate Operation 97 Abork End Frammingharnm CH LS Gender J Age Eis Total cholesterol mmol l M HEL cholesterol rimalsli F Systolic Blood Pressure rimHg Diabetes WM 4h Smoker WM Wk I Absolute Risk 2 Z Relative Risk 1 0 Total cholesterol The measurement unit can be modified in Option Advanced Systolic Blood Pressure If you have already entered this in Standard Measurements it will automatically appear on the current screen The report will appear on the screen Exit 1Test 2 Print 3 Print all BODY COMP Frammingham CHD a F YC Date dd mm yyyy 30 01 2008 Ep S C EF EUHODEAN El FRAMMINGHAM Total cholesterol mmol 5 1 HEL cholesterol immoli 4 0 Systolic Blood Pressure mmHg 130 Diabetes VIe Smoker MHO Absolute Risk in A Relative Risk 1 0 2 gt Duke Treadmill Score Enter the data requested and press OK to confirm or X to cancel Abork End Duke Treadmill Scor Ip ST Deviation during Exercise mm a GH Duration of Exercise METS E Angina during Exercise Mane i D
52. with the test The algorithm that manages the test will discard those steps form the final calculation Do not remove the sampling tube from its position during the automatic calibration Ignore the signal and continue with the test Scroll through the data using the navigator tool Up and down arrows Activate the The print tabular results option in the Menu Options adavanced Select the exercise protocol keeping in view the subject s exercise limitation Muscular Fitness Fitmate Pro only If it is possible to perform more than 10 reps the test is not at the maximal intensity invalid Increase the weight to lift up to the weight which allow up to 10 reps It is not possible to enter more than 10 It is only possible to enter up to 10 reps for the test of muscular strength reps Maintenance 133 Flexibility Fitmate Pro only The assessment of flexibility is performed based solely on the best test performed If performing more than one test enter the best result achieved only It is only possible to enter one measurement for the test of flexibility 134 Fitmate User Manual Activity caloric cost only Fitmate Pro Problem The message wrong reader appears on the screen after pressing OK to start a test The message impossible to calibrate appears during the automatic calibration phase before a test No values are displayed on the screen although the Fi
53. with the hot water for 30 minutes at temperatures set between 71 76 C Step 4 Drying To prevent the growth of waterborne organisms the mask and components should be thoroughly dried prior to reassembly and storage 1 Dry thoroughly using a soft cloth preferably sterile or disposable paper towels Step 5 Inspection All components should be visually inspected for cleanliness proper function and freedom of defects Visual inspection provides evidence of thorough cleaning and proper functioning of all mask and components Mask assemblies in poor working condition are hazardous to personnel and patients 1 Visually inspect all components for cleanliness If there are signs of residue from the detergent or disinfectant repeat the previous steps If there are any signs of remaining stains or organic debris repeat the previous steps If the cleaning and disinfection steps have been repeated with no improvement eliminating residual or stains etc then dispose of the components and replace 2 Visually inspect all components for defects Check the rubber parts for tears nicks hardening or stiffening deformation or distortion Check the plastic parts for crazing cracking or stripped threads Any defective parts should be discarded and replaced 3 Visually inspect all metal components for corrosion Replace any metal components showing rust or chipped plated surfaces Sterilizing the mask Sterilization of the silicone rubber face masks can
54. 0 EE ee 150 ein 151 gt Language of the SORE ai sssessssssessecsecsecsecsecsecsecssoessecsecsessecsecsecsecsecsesecseesecsessessecseosecsesecsecsecsessessecseesesssoe 151 gt Change dE RETTEN 151 P de TE 152 E PGE TNS AI asia sonscsice succemconcicsa neg tease onsanavapessuevaecsacweasygeeusionyaresapesenevancaewesa srsanasenssanesapessneva equine inseexsepisesnvapereaesaneane 152 supet archive Manage VSIA asserir AEAEE EAA 154 gt Enter a new subject in the archive sesessessssecsssecsesecsesecsesecseseceeseceosecsosecsoseceoseceosececsececseososececsecsoseceoseseesecseesee 154 gt Select an existing subject E 155 gt Modify the data of an existing subject sessessssecsssecsssecseseceeseceesecsosecsosecsoseceosecsesecseseceosecseseoeeseceosecsoseseeseseesee 155 gt Delete a subject from the archive ssesessessesecsssecsesecscsecsesecsoseceosecsosecsoseceoseceoseceosecsesecesseceoseceeseceoseceeseseeseceesee 155 TESTING SESSION MNAE GN eriari AEE O a e 156 e Create a NEW SCSS OWN aaiacisct cc cctcete scene ctececcnansaecexetnccuecescacuusetes cannes R S R 156 p ODE an existing testine SESSION EEN 156 USR 159 gt Show and modify the test results Of a SESSION ccsccsscsscceccesccscceccesccscceccesccscceccesccncceccsccncceccesccnccescessonccesees 159 P SNOW a Cl CNG ssccccassscavenssasasesnssawnarwansncenvasevsasasasnancanaiosdeeansqussesansadnacepencesanssieeasnaaananansans uae sasnsasnseetaeeanema
55. 0 build 15 Copyright CH 2004 2005 COSMED S r l Copyright CH 2004 2005 COSMED S r l http iiw Cosme it hero iiv Cosme it Installed Modules Licence Information Installed Modules Licence Information Comment Licence Backup Manager Authorized Model 2 FitMate PRO CUML32 Cosmed Universal Message Layer Authorized version 299 DCL i Device Communication Layer Serial Number 2009120509 FORMEDIT Formula Editor GRAPH Graphic Engine MATHUTIL Math Routines PARAMS i Parameters Database Manager HRC Multi language Resources Manager SEH Structured Exception Handler UTILS Program Utilities sl He Authorize Re Gucthorize Installed Modules shows information about the installed SW modules and their version Licence Information shows information about the SW activation Click on Re Authorize to reset to 30 the days remaining before new authorization request It will be necessary to connect a Fitmate User Interface and settings 149 gt Configuration Select Options Setup A window listing the possible device configurations will pop up select your settings Setup Te sl Setup Archive Unit of measurement e tari elie Cholesterol Units of meas moal D Background Mone sl Browse Spirometry Predicteds ERS J3 sl Jh Print Diagnosis Jh Print Nutrition Facts Report Jh Print Warnings Training ones Setup Fat Burning Recovery one starts ES of O2max Endurance
56. 00 15 0 06 00 16 0 07 00 17 0 08 00 18 0 09 00 18 0 10 00 18 0 11 00 18 0 12 00 18 0 13 00 18 0 14 00 18 0 15 00 18 0 16 00 18 0 17 00 18 0 18 00 18 0 19 00 18 0 20 00 18 0 Oo CO NIL Ds Un ti wi nyreit o yo o o o oo OF Appendix 211 Run 20 Kmh 12 4 mph l l I z K Time mm ss Speed km h Speed mph Incline 00 00 11 0 0 01 00 12 0 02 00 13 0 03 00 14 0 04 00 15 0 05 00 16 0 06 00 17 0 07 00 18 0 08 00 19 0 09 00 20 0 10 00 20 0 11 00 20 0 12 00 20 0 13 00 20 0 14 00 20 0 15 00 20 0 16 00 20 0 17 00 20 0 18 00 20 0 19 00 20 0 20 00 20 0 HOI CO NM DD Or BL WIT NTR O OoO o o o yo oOo OF 212 Fitmate User Manual Astrand 600 600 500 500 400 400 300 300 e c Ou ZS S 200 200 100 100 0 0 0 00 0 02 0 04 0 06 008 010 012 0 14 0 16 018 0 20 0 22 024 t Load men Load women Recovery will follow The protocol can terminate before the end if the end of test condition is reached or you stop it manually Appendix 213 List of compatible ergometers Model Type COSMED Treadmill COSMED HP Cosmos treadmills all models COSMED Bike COSMED Ergoline bikes all models C Safe bike Technogym Excite bikes only Bike Excite Med C Safe Treadmill Technogym Excite treadmills only Run Excite Med Excal Sport Dev1 Lode Excalibur Sport bike set as device 1 Marquette T2000 Marquette T2000 treadmill Trackmaster mph Trackmaster treadmills
57. 1 03 The diagram above describes the layout of the Fitmate s archive This archive contains numerous records one for each session for every subject which has been entered and saved It is possible to have multiple testing sessions for a single subject Every session may contain a single test or multiple tests and questionnaires all of which are not necessarily performed on the same day A test session cannot contain two tests of the same kind repeating a test will end a session no other tests can be performed and automatically start a new session A closed session does not have to contain all types of tests A warning message will prompt the user if the user attempts to perform a test which has already been performed in the current open session A new testing session will open up if the user presses OK the operation will be aborted if any other button is pressed gt Entering a new subject To enter a new subject select 1 New and fill in the blank fields Refer to the Guide lines for more details on the information requested Press OK to confirm or X to abort Abork End ID mp Last Name BOND First Mame Dames o Test conductedbylana Wood Birthiidd rarn yywy EA IG i962 Gender m H Height mm fi E Weight Kg 35 i gt View Search for a subject in the archive To search for a subject who is already in the archive select 2 View Search and move through the list of subjects using the navigator tool until you find the ap
58. 1h 50m about 20 each paper roll Mean battery autonomy normal use stand by tests and printouts 5h approx 4h with Canopy gt Display LCD 320x240 pixel at 16 colors backlighted 216 Fitmate User Manual gt Dimensions and weight 198x235x66 mm 1 4 Kg gt Interface USB Type A for PC communication USB Type B for direct printing on external printer or for ANT HR probe connection RS232 for ergometer control during VO max test or PC connection gt Canopy Backup batteries 4 AA alkaline batteries not rechargeable Dimensions and weight Unit 150x90x28 mm 170g without batteries Blower 128x55 mm 150g Hood 48x32x21 cm 0 5 kg Vail 120x140 cm 1 kg Appendix 217 gt Consumables C02580 01 05 A 196 056 001 C02748 01 11 C02807 01 08 A 182 300 004 C00568 01 98 C00441 01 98 C01805 01 98 C01814 01 98 gt Cables A 362 300 005 A 362 300 006 A 362 300 006 C02964 01 12 C01713 01 12 C01714 01 12 A 362 315 004 RMR disposable masks 50 pcs Thermal paper 10 pcs O replacement kit sensor and sampling line with filter Sampling line Permapure Fitmate Antibacterial filters 50 pcs Soft PTE mouthpiece 200 pcs Nose clips 5 pcs Adult paper mouthpieces 500 pcs Paediatric paper mouthpieces 500 pcs Serial cable Fitmate for PC communication USB cable 1 8 m Ergometer serial cable adapter Ergometer communication cable Technogym Excite Ergometer communication cable Cos
59. 2 Kg kaa Push Up 30 Curl Up ge Sit up ES Leg Strength a 2 25 DEET SR EE E SP Flexibility eer 34 4 D ery Poor Excellent Superior Mmf Performing tests with the PC Software 189 Exercise prescription Fitmate Pro only gt Prescribing an exercise program Double click on the icon Exercise Prescription to prescribe an exercise program A Wizard menu will open up guiding user to the exercise prescription Exercise Prescription x Exercise Prescription The Exercise prescription is based upon several information collected in the current session While some of them are MANDATORY Fitrate cannot elaborate an Exercise Prescription without Hem other one are RECOMMENDED thanks to these extra information Fitmate can elaborate an Exercise Prescription that perfectly suit the needs of the subject In the Following pages you see a list of the information collected and those that were not IF vou want you can fill and complete the missing ones and thus generate a good Exercise Prescription Indietro Press Next gt to open a window which shows the mandatory and the recommended tests in order to elaborate an exercise prescription If a test is not performed you can start it by double clicking the icon Exercise Prescription 5 Ei Exercise Prescription Mandatory bests that should be executed E Standard Measurements a AHAACE CHD Risk i Cardio respiratory Fitness
60. 2 Plunge the reader in a vessel containing the disinfectant solution for 20 minutes see picture below assuring that the sampling tube is not exposed to the solution the optical flowmeter and cable are waterproof Maintenance 113 NO OK 3 Rinse the turbine in a vessel filled with water and shake gently to remove the disinfectant do not place the turbine under running water or move the turbine while submerged 4 Allow the turbine to air dry 12 hours recommended depending on environmental conditions 5 After cleaning the turbine always calibrate prior to subsequent testing Disinfecting the turbine for Canopy option 1 Take out the turbine 2 Dip it in a disinfectant solution non alcoholic based for about 20 minutes 3 Rinse the turbine in a vessel filled of clean water shaking gently to remove the disinfectant do not clean the turbine by putting it under running water Let it dry to air 5 After cleaning the turbine check if the turbine propeller rotates freely even with a low speed air flow 6 Connect the turbine to the reader Precautions to take when cleaning disinfecting and drying the turbine e Do not expose the turbine to high heat or to a direct flow of water e Do not expose the sampling tube or the connector on the end of the cable to any liquids e Do not use alcoholic solutions to clean the turbine gt VO2 max mask and mixing chamber mask Note RMR masks used are disposable
61. 6 e SE d jj Test length mmi ss 10 00 Voump Feod2 0 5m 15 m Ss RMR Pred Discard Kcal day GI t No2 Feo2 SC as 2292 VLA LE 01 34 154 20 1 0 419 96 66 Fitmate User Manual Automatic detection of the start end of the test If selected by the user the unit can use the coefficient of variation of Ve and RMR in order to detect the start and the end of the test even if the predefined time interval is not elapsed In this case when a steady state is reached but not before 3 minutes the display shows the following RMR Pred Ecaliday 3o 1078 2 Ypump Feces bm ism Steady State Achived Skip to second phase Confirm Ignore 1 or Press to confirm the start of the data acquisition phase or to ignore and to continue with the first phase In the same way when the test can be ended but not before 5 minutes the display shows the following RMR Pred Ecaliday 3o 1955 113 oump Enough data collected Stop the test Confirm Ignore 1 l X l Press to confirm the end of the test or to ignore and to continue the test Problems during the test execution The equipment has internal sensors which detects potential problems during test execution e g ventilation not detected exhaled oxygen not detected high or low oxygen concentration If a problem arises a warning message will appear on the screen The steps where the errors occur will be marked as
62. COSMED does not assume any liability for end user interpretation of this user manual or for casual or consequential damages in connection with the provision representation or use of this documentation No parts of this manual may be reproduced or transmitted in any form without the expressed written permission of COSMED Srl Fitmate User manual XIII Edition 05 2012 Copyright 2005 2010 COSMED COSMED Srl Italy http www cosmed com http www fitmate net Part N CO2874 02 91 2 Fitmate User Manual Table of contents Maple OM EEN GETtINE StantCGrn creer EE IESSEN 14 EEN 14 bd TE 14 gt Contraindications for Exercise testing sessssessssecssscecsececseceoseceosececsececsscecseceosececsececsececsececsececsececssoeeseceeseseeseo 15 Abs l te ae tte Hl ele de E 15 Relative CONTLAINGICATIONS ccccccccsssssseeecceecsaeseseeeeeeeeaseeeeeeeeeeesaeeeseeeeeeeesaeeeseeeeeeeesaaeeseeeeeeeesaaaasseceeeessaaaseeeeeeeeeas 15 Emtee E EIERE 16 ENIC ae EE 17 ROESER 20 E EELER 20 Typographical e ele a EE 20 GLAD CalCONVEN TIONS EE 20 PE GO CURIS ur e EEN 21 Es DESCHIDUON OF FICIAL E opra 21 PVR ECHT sccec ras nescence ccisca cic tcss opacities coupe a senesdnsugaenececcusine yeccuwaaueseesasueetes 21 US e E 21 MNS Te ME 22 THE TOI VEC eebe tee 22 lee EE 22 E Banen Cm al eege 22 e FRACS AI NMa vais cacncosa snes neon count orconcuncuecsssis ony ves yecsinvateseeseernussoneenscapuasyecciu E E E E E N E 22 E
63. Fit 4 Std Meas A Muscular Flexi 4 Goal A Ex Prescr yw RMR A ActivityMon gt A dh Body Composition A Weekly Diet Planner Rest Metabolic Rate Kcal day x 1488 agp Eneray Balance Slow Normal Fast lt 1563 1563 2072 gt 2072 testing Metabolic Rate N Di Activity Monitor EE Kcal day 4000 3500 3000 2500 2000 1500 1000 500 0 00 00 01 00 02 00 03 00 04 00 05 00 06 00 07 00 08 00 09 00 10 00 11 00 12 00 13 00 14 00 15 00 t hh mm ss Ready mmf gt Energy balance To perform a RMR test and elaborate an energy balance double click on the icon Energy balance Personal Weight Management Please select an activity Close this window Planning for a weight loss of 0 45 Kg per week Weight Plan Graph weight kg Estimated weight 100 Ideal weight loss OU GU ZU 60 DU Plan reminder Physical Activity Level Sedentary 40 30 20 10 U 12 05 2009 16 03 2010 19 01 2011 24 11 2011 28 09 2012 h 500 kcal RMR Q Click on the RMR icon to fill in the information of the RMR test D Performing tests with the PC Software 173 Personal Weight Management i x Activities Cancel Planning for a weight loss of 0 45 Kg per week Weight Plan Graph Dan reminder weight Kol Estimated weight Physical Activity Level Sedentary wn Ideal weight loss a0 DU ZU 60 50 12 05 2009 16 03 2010 19 01 2011 24 11 2011 28 09 2012
64. If subject s demographics are not available in the PC archive it is possible to download automatically both subject s card and test into the PC archive To do that drag the Subject folder from the left side of the window to the New Subject folder on the right side of the window as shown in the following example Download a test from Fitmate EA gt Fitmate PRO Subjects and tests to download Destination Load Refresh Ca Download all new tests f aoea JAMES mE MC LANE JOHN cl New subject HGA Se 4 JAMES Bond H A PENNY MONEY If Subject s data are already present in the archive of the PC in order to avoid multiple creations of the same subject it is possible to drag single tests within the PC archive To identify and transfer a single test you may expand the list by double clicking on the Subject s name on the left side and then drag the desired test into the corresponding subject on the right side of the window as shown in the following example 160 Fitmate User Manual Download a test from Fitmate Fitmate PRO Subjects and tests to download Destination e LoadiHefrech Py Download all new bests E AutoSearch JAMES Ca JAMES Bond E Mew Subject en Muscular Fitness 15 05 2009 BOND James ibe z Flexibility 15 05 2009 as ve e Si MC LANE JOHN af Muscular Fithess 15 05 2009 ai D PENNY MONEY If the archive of the PC already contains in current session a
65. O max tests e Time interval before the automatic start of the test in minutes e The printout settings for the VO max test only Fitmate Med e The Training Zones Mode only Fitmate Pro e Enable disable all the steps in the report e The print quality low normal or high The battery will run out faster if the quality is increased e The date format dd mm yyyy or mm dd yyyy e Enable disable the printing of training zones only Fitmate Pro Med e The units for cholesterol only Fitmate Med gt Restore factory settings Select this entry to restore the manufacturer settings gt Activate Fitmate Abork End version 2 20 2010010101 Fitrnate PRO 470196730 a Select this entry to enter the activation code see the Registration procedure gt Training zones settings only Fitmate Pro Med Fitness training zones Cancel Contirm Min O2Maxn Max O2Max Fat Burning J Threshold Select this entry to set the training zones percentage of VO max to obtain e optimal fat burning 50 Fitmate User Manual e endurance training e anaerobic threshold improvement e VO max improvement Values to be entered are the minimum and maximum percentage of VO max for each zone Please note that the minimum values for the zones after the first zone are automatically calculated starting from the maximum value of the previous zone and cannot be modified Rehabilitation training zones Fitmate Med on
66. Options Window Help 8 x kt Ss e gt BE 8 gt qy ER Onga g e ere v ParQ y RiskFact y Body Comp Diet Plan y Weight Mont y Cardio Fit y Std Meas y Muscular Flexi Goal Ex Prescr RMI ack CO Test Is ae gt 4 D S Summary Al S Push up rep gt Notes Z Rank 100 Gei Session Information S18 Maximal force that can be generated by the upper body muscle group P You can improve it with muscular training Cl Risk stratification A Nutritional Assessment Curl up rep Rank 19 Ree Fares 20 Ability of the abdominal muscle group to execute repeated contractions over a period J i of time sufficient to cause muscular fatigue s You can improve it with muscular training of Standard Measurements Muscular Fitness Sit up rep Rank 56 O A Aerer 25 Timed 1 minute bent knee Sit Ups for evaluating endurance of the trunk muscles app Program Goal Exercise Prescription Leg Strength Kg ee 1 80 0 qP Repetitions 1 One Repetition Kg 180 0 Leg Strength max body weight gt 95 Maximal force that can be generated by the lower body muscle group You can improve it with muscular training legs Reported as maximal lifted joe a Upper Body Strength Kg 110 0 Repetitions 1 One Repetition Ka 110 0 w 4 atk Ready NUM 186 Fitmate User Manual Flexibility Assessment Fitmate Pro only gt Test execution and data entry To assess the flexibility double click on the icon Flexibility
67. Pump ventilation Vp heart rate if available HR and fraction of O diluted in the hood FeO are displayed in the bottom of the screen 4 e The bottom right corner of the screen shows 5 an icon which becomes green during the automatic calibration of the O sensor a bubblehood 6 indicating that the test is proceeding and 7 an icon which shows the O sensor status during the last calibration including the ones automatically performed during the test The bubblehood icon changes to Kal alternating to indicate that the ventilation is not detected If the user selects 3 Options see the related section of this manual the following settings can be modified e The duration of the test phase to discard 5 minutes by default e The duration of the data acquisition phase 10 minutes by default e Ifthe test is automatically printed at the end of the test e Ifthe RMR graph must be printed together with the test results e If enable disable the automatic detection of start end of the test e The interval time between two consecutive O sensor calibration 6 minutes by default e The respiratory quotient 0 85 by default e To print all steps after a test or none When the test is over 15 minutes by default a prompt warns the operator to remove the hood from the patient and to turn off the Canopy unit Remove the hood from the patient Turn off the Canopy unit Press OK to confirm A new window will automatically open showing the te
68. Q ven 06 00 286 106 167 68 17 75 1989 06 30 335 110 140 62 1734 2332 07 00 338 116 ei 66 1750 2351 07 30 429 131 138 67 17 08 2990 08 00 360 114 147 66 17 22 2507 08 30 299 an 205 69 17 02 2084 09 00 365 112 163 e 1709 2541 09 30 342 zm mm mm mm mm mm mm mm mm mm mm mm mm mm mm mm mm 1 2 0 9 15 8 Zl 17 24 2379 1 2 15 7 66 17 26 2430 If a wrong mode is selected i e it is selected Canopy mode and the RMR test is performed with the mask the following message will appear during the test the test must be stopped the proper option must be selected and the test must be restarted A TEST MODE ERROR Selected CANOPT In use MASK Please check it on RMR options Press Any key Average interval selection At the end of the test a graph is shown 58 Fitmate User Manual 2 gt OK Confirm Cancel RMR 1965 FAR RMR 5 4 tire noir The user can graphically modify the start and the end of the average interval 1 e Press and the arrows to move the start cursor abc e Press and the arrows to move the end cursor Press OK to confirm X to cancel Each time the cursor is moved the RMR value and the coefficients of variation are recalculated gt Printout interpretation Below the header and the subject s data in the Resting metabolic rate section is reported the RMR graph is the option is enabled all the test steps if the option is enabled the final result the coeffi
69. RM or est 1 1 RMEg 155 Upper Body Lifted Wweightikg ao Upper Body Reps CID or est 1 1 RMiKg a5 86 Fitmate User Manual Evaluation of flexibility Fitmate Pro only gt Test execution and data entry Select Flexibility from the test menu to start the test Execute the test as illustrated by the picture on the left side of the screen and described at the bottom of the screen Then enter the results in the respective fields Cancel Contirm Flexibility crn a Zeen O Sin The subject seats placing the soles flak against the seat and reach box The score is the most distal point reached in three trials with the Fingertips keeping the hands one over the other one Exhalation and head between the arms are recommended when reaching Press X to cancel or OK to confirm the report will appear on the screen Exit Liest 2Print 3Print all RMR Flexibility 3 BODY COMP Date rim dd yyyy 12 23 2005 ai STD MEAS Flexibility crn 15 EXM BALANCE FIELD TEST Si MUSC FIT Fitmate Operation 87 Energy expenditure during exercise Fitmate Pro only gt Set up Refer to the cardiorespiratory Fitness Fitmate Pro Med only gt Perform a test Initialization of the unit Select Activity Caloric Cost to start the test Test hype Caloric cost Ergometer Other not interfaced Exercise protocol Mone End of test HR SHR ria H max bp
70. Race Caucasian b 14 Brown Street Address E mail bond cosmed it Phone 0123 456789 Training Zones Setup Fat Burning Zone starts at Endurance fone starts at Threshold Zone starts at VWoetiax Zone starts at Voemax fone ends at Anaerobic Zone starts at Anaerobic Zone ends at 35 5 of Mama Fl a oF Woemax 76 2 of vWoemax 100 101 105 H gi oF Mama SG of YOZmax 5 of Mama 5 of Mama Enter the data requested If this subject must manage training zones different from the ones set in the general settings type their ranges in the lower part of the window To add a photo click on the squared located on the top right and then browse to select the photo 154 Fitmate User Manual gt Select an existing subject The list of the subject in the archive is displayed on the right side of the window to select a subject highlight one record and click on the icon Open subject s sessions or double left click on the selected subject Every subject can easily be traced through the navigator top side of the window by selecting the searching criteria and typing name or ID code in the field by side A subject card will show up all the subject information and test performed Fitmate James BOND Sessions and Trend SIE ODER IE Lgl New session fli Trends The following icons will appear in the left side of the window Icon Click Double click R Show the t
71. Recommended test For a better Exercise Prescription cab Flexibility w Muscular Fitness Hint to execute a test double click on it lt Indietro Annulla Press Next gt to open a window in which you can set the program goal the muscular fitness goal and the number of sessions per week 190 Fitmate User Manual Exercise Prescription Exercise Prescription Overall Fitness improvement Click Next gt to open a window in which you can set the exercise details Exercise Prescription a xi Exercise Prescription In order to do that you must enter the risk stratification low moderate high and the training duration in weeks You can indicate if the training must be supervised by selecting the check box and or enter default values clicking on Defaults In the lower part of the window for each exercise type cardio vascular muscular training or stretching you can enter the exercises and details about them Add adds an exercise to the list Del deletes the selected one Click Next gt to close the wizard The exercise prescription will display on the screen Performing tests with the PC Software 191 Fitmate James BOND Tests of Session Opened on 12 05 2009 Eile Edit view Options Window Help l x e E aO Ona o v ParQ y RiskFact y Body Comp A Det Plan y Weight Mgmt y Cardio Et y Std Meas y Muscular 4 Flexi y Goal y Ex Prescr RMI gt Back
72. The report will appear on the screen 98 Fitmate User Manual Exit 1 Test 2 Print 3 Print all BODY COMP Duke Treadmill Score a FYC Date dd mm yyyy 307012008 2 S C ST Deviation during Exercisefmmi Z EI EUROPEAN Duration of Exercise METS H FRAMMINGHAM Angina during Exercise Mone SBS Duke Score 3 gt Bode Index Enter the data requested and press OK to confirm or X to cancel Abort OKEnd eee End BODE r Ka BMI Kgs 24 6 FEI Eat Distance walked in mim MMRC dyspnoea scale Oli Not troubled with breathlessness except during strenous exercise Bode Index a 10 Probability of 4 year survival in FEV1 This value will be input via the Fitmate if you have performed spirometry during this test session The report will appear on the screen Exit 1Test 2 Print 3 Print all H Bond 3 30 01 2008 30 01 2008 E BODY COMP BODE Index SI EN Date dd mm wgstd S0 01f2008 S C EUROPEAN EI FRAMMISGHAM ex DUKE TREADM E BODE INDEX FeV fl 2a Distance walked in mm 1000 MMRC dyspnoea scale 1 4 year survival 0 gz Bode Index 0 10 1 Fitmate Operation 99 How to load paper in the printer compartment Fitmate can automatically print on rolls of thermal paper code A 196 056 001 set of 10 rolls To replace this paper 1 Open the paper compartment s orange or green cover 2 Lift up the green lever 3 Put the paper r
73. VD Risk BODE Index Risk Factor 1 0 Average risk KI Functional Capacity METS 4 0 Duke Treadmill Score a The food group code is already in use Please assign a UNIQUE cade to the new group Risk Zone Low risk European CYD Risk v 4 DIE ei Sep um Performing tests with the PC Software 169 Standard measurements To execute the standard measurement test double click on the icon Standard Measurements from an open session menu Standard Measurements E E Cancel Waist circumference crn 7 Hip circumference crn 0 Abdomen circumference crn D Resting Heart Rate bom With the abdomen relaxed horizontal measure taken at the level of the Systolic Blood Pressure mmHg 0 narrowest part of torso below bottom of rib cage and above umbilicus Diastolic Blood Pressure tamHg Medication for HR and or Bp Enter the necessary information in the blanks To execute a correct measurement follow the indications displayed on the screen If a zero is entered in a field this value won t be showed neither in the test results nor in the printout Click OK to confirm An updated window will display the report of the information entered Fitmate James BOND Tests of Session Opened on 12 05 2009 E laj sl File Edit View Options Window Help la x EE K gt 7 gt C E S ed BER oange o acetone v ParQ y RiskFact y Body Com
74. ab dom lun mar mer gio ven sab dom lun mar mer gio ven sab dom lun mar mer gio ven sab dom lun mar mer gio ven sab dom lun mar mer gio ven sab dom lun mar mer gio ven sab dom lun mar mer Activity Time min D 4 ap D Ready NUM After the data are read by the Fitmate software it displays statistical information and graphs showing the daily trend of the data The red line is the daily target set by the user Activity Monitor Comments From EE M ae Jo7 osj2009 All Data Export CV File Cancel It is possible by double clicking on the window to enter comments to modify the displayed period or to export data in CSV format for further analysis The printed report shows data week by week a page per week by means of histograms Performing tests with the PC Software 183 Cardiorespiratory Fitness Fitmate Pro Med only To perform Cardiorespiratory Fitness assessment enter the folder Cardiorespiratory fitness and double click on the correspondent icon The Cardiorespiratory Fitness test may be performed with a Fitmate Pro Med and then downloaded on the PC software for the assessment For the preparation of the subject and the test execution refer to Chapter IV Using Fitmate Warning Maximal exercise testing for the assessment of the cardiorespiratory fitness can be performed only in 3 presence of medical staff and under the supervision of a cardiologist Sub maximal exercise tests only are allowed i
75. acement 0z Analyzer check Last Calibration z 06 01 04 11 45 36 1 Calibrate sensor PatramHa 742 Trimmer 50 Print O Exit Sensor Efficiency The colour of the tank and the note at the bottom of the screen indicate the analyzer s efficiency The colour will change depending on the analyzer status e Green indicates normal efficiency e Yellow warns the user that the analyzer will need to be replaced soon e Red indicates that analyzer is about to expire and should be replaced before more tests are performed No colour indicates that the analyzer is completely exhausted Sensor x SL E Fair Please plan For sensor replacement Sensor a E too low Please replace sensor Please sensor I Sensor SL is impossible Information on date and time of the last O sensor calibration and other sensor data can be seen and printed by selecting one of the options displayed on the right hand side of the screen The sensor efficiency can also be monitored from the main menu The tank icon is located at the lower right corner of the screen the colour of the icon represents the same information as mentioned above 1 Calibrate sensor starts an O sensor calibration and prints automatically the calibration report at the end 2 Print prints the calibration report Fitmate Operation 101 gt Control panel Abort OF End ignals3 AA EDITOR 26 8 Internal Temp 0 Fast Charge 2 GC Power Circuitry
76. ad increment is 25 W min Bike Ramp 30W min men fit women athlete As the Bike Ramp 10W min protocol the load increment is 30 W min Bike Ramp 40W min men athlete As the Bike Ramp 10W min protocol the load increment is 40 W min 202 Fitmate User Manual gt Protocols for treadmills Bruce Time mmi ss Speed km h Speed mph Incline 00 00 2 7 1 7 10 03 00 4 0 2 5 12 06 00 5 5 3 4 14 09 00 6 8 4 2 16 12 00 8 0 5 0 18 15 00 8 9 5 5 20 18 00 97 6 0 22 21 00 10 5 6 5 24 24 00 11 3 7 0 26 27 00 2 7 1 7 O recovery The protocol can terminate before the end if the end of test condition is reached or you stop it manually Appendix 203 Modified Bruce Time mm ss Speed km h Speed mph Incline 00 00 27 1 7 03 00 2 1 7 06 00 De 1 7 10 09 00 4 0 2 5 12 12 00 5 5 3 4 14 15 00 6 8 4 2 16 18 00 8 0 5 0 18 21 00 8 9 5 5 20 24 00 g7 6 0 22 27 00 2 7 1 7 O recovery The protocol can terminate before the end if the end of test condition is reached or you stop it manually 204 Fitmate User Manual Time mm ss Speed km h Speed mph Incline 00 00 53 33 01 00 5 3 3 3 02 00 53 33 03 00 5 3 3 3 04 00 05 00 5 3 3 3 06 00 07 00 08 00 09 00 10 00 11 00 12 00 13 00 14 00 15 00 16 00 17 00 18 00 19 00 20 00 21 00 22 00 23 00 24 00 25 00 26 00 27 00 uo WM LP LA W LA w w w w W LA COIN Di Un Hi UNO GA m N e ajajajaja on on
77. al of residual organic soil without damaging the device cleaning agents should be used in the correct dilution concentration and at the correct temperature in accordance with the cleaning agents manufacturer s directions Cleaning supplies are very basic usually consisting of a surgical scrub brush chenille pipe cleaners cotton or foam tipped applicators soft brushes and soft cloths Cleaning supplies should be cleaned and disinfected or sterilized daily Water Quality tap water is acceptable for use in cleaning COSMED components COSMED components should be soaked and rinsed in tap water at 22 43 C to prevent the coagulation of solid substances onto the device and thus facilitate the removal of debris Enzymatic detergents with a neutral pH 7 are recommended when processing difficult to clean items with dried on matter Soaking mask and valve components in an enzymatic detergent solution can effectively remove visible debris except for lubricants thus providing an acceptable alternative to manual cleaning Rinsing is necessary to remove all traces of detergent and extraneous debris Standard cleaning procedure These steps are common to all the cleaning procedures Step 1 Preparation at Point of Use The cleaning of reusable items begins soon after use At the point of use personnel wearing gloves and other protective attire separate disposable items or components from reusable items and discard them in appropriate receptacles Soil is
78. aloric Intake kcal day not calculated Copy Day Paste Day waterig 0 00 0 00 0 00 0 00 0 00 0 00 0 00 0 00 Energy keal 0 00 0 00 0 00 0 00 0 00 0 00 0 00 0 00 Drot o 0 00 0 00 0 00 0 00 0 00 0 00 0 00 0 00 Fabio 0 00 0 00 0 00 0 00 0 00 0 00 0 00 0 00 Carb tg 0 00 0 00 0 00 0 00 0 00 0 00 0 00 0 00 Fibersig 0 00 0 00 0 00 0 00 0 00 0 00 0 00 0 00 Sugar g 0 00 0 00 0 00 0 00 0 00 0 00 0 00 0 00 Catmg 0 00 0 00 0 00 0 00 0 00 0 00 0 00 0 00 Si Cafe CH CC CH CC CH CC C OO CH CC CH CC CH CC CH CC Load template Save as template Cancel Select for each day and for each meal the foods and their quantities by clicking on the green arrow in the top box When you click on the green arrow a window showing the foods appears Food Search j i x kall groups f DK Cancel Butter salted o1002 Butter whipped with salt 01003 Butter oil anhydrous 01004 Cheese blue 01005 Cheese brick 01006 Cheese brie 01007 Cheese camembert 01008 Cheese caraway 01009 Cheese cheddar Cheese cheshire Add Food Edit Food pelete Food Nutritional Information Water ki lgide Energy keal 100g Drot ki lgide Fat OI 100g Carb g 100g Fibers g 100g Sugar 9 1009 Ca moll OOg Fe mgfioog Mo mgfioog In order to find the foods more easily it is possible to select the food group or search it by code or description also part of the name When a food is selecte
79. and for single subject use The face masks adapters and other components should be cleaned and disinfected prior to every test Sterilization can optionally be performed on the rubber mask only High level disinfection of mask and components ensures patient safety and minimizes the risk of infection Disassembling the mask Remove the round black turbine adapter held within mask and the clips that hold the headcap in place Cleaning the mask Follow the standard cleaning procedure reported above Disinfecting the mask Step 1 Disinfection Use only liquid glutaraldehyde disinfectant solutions approved as sterilants disinfectants by the National Authority Warnings The fumes of glutaraldehyde can irritate the mucous membranes of eyes nose and throat Some people develop allergic reactions to glutaraldehyde that can cause skin rashes headaches and breathing difficulties Containers of glutaraldehyde should be kept closed and in a well ventilated area 3 Gloves should be worn made of butyl or nitile rubber Do not use latex rubber gloves The concentration of glutaraldehyde in the air should not exceed 0 2 ppm For emergency safety or technical information about the glutaraldehyde solution contact the manifacturer 1 Determine the required soak temperature and time of the sterilant disinfectant and assure that these requirements are met 114 Fitmate User Manual 2 Activate the glutaraldehyde solution by mixi
80. ase Fitmate Med Tape meter Pedometer Appendix 219 References COSMED made reference to the following textbooks Fitness assessment ACSM s Guidelines for Exercise Testing and Prescription Seventh edition 2005 Frankenfield DC et al The Harris Benedict studies of human basal metabolism history and limitations J Am Diet Assoc 1998 98 439 445 Sixth Report of the Joint National Committee on Detection Evaluation and Treatment of High Blood Pressure NIH publication 1997 Clinical guidelines on the identification evaluation and treatment of overweight and obesity in adults National Institute of health National Heart Lung and Blood Institute Spirometry ATS ERS TASK FORCE STANDARDISATION OF LUNG FUNCTION TESTING Edited by V Brusasco R Crapo and G Viegi Standardisation of spirometry Eur Respir J 2005 26 319 338 Lung function LE Cotes Blackwell scientific publications Guidelines for Clinical Exercises Testing Laboratories L Pina G J Balady P Hanson A J Labovitz D W Madonna J Myers American Heart Association 1995 91 912 Cardiopulmonary exercise testing VO max Principles of exercise testing and interpretation 2nd edition Wasserman et Al 1994 ATS ACCP Statement on Cardiopulmonary Exercise Testing Am J Respir Crit Care Med Vol 167 pp 211 277 2003 ACC AHA 2002 Guideline Update for Exercise Testing Gibbons et a 2002 ACC AHA Practice Guidelines Indirect calorimetry Ener
81. ase Ventilation Ve Oxygen consumption VO Respiratory frequency Rf heart rate HR fraction of O expired FeO and METS In the bottom right corner of the screen 5 an icon which will become green during the O sensor calibration and change to a small face mask with arrows indicating the inspiration and expiration phases of each breath The icon becomes red when HR gt 90 of the HR selected as max HR this indicates that auto calibration has been disabled in order to avoid data loss 6 an icon which shows the O sensor status during the last calibration including the ones automatically performed during the test By selecting 3 Options user can configure The interval time between steps 15 seconds by default The interval time between automatic calibrations 6 minutes by default The interval time for averaging data 15 seconds by default Whether or not all data is to be printed at the end of the test Whether or not the training zones are to be printed see Options If the HR is activated in this case a warning message will appear if the heart rate is not detected Other parameters which can be displayed in the real time table by pressing the up and down arrows on the navigator tool load systolic pressure SBp diastolic pressure DBp and of rate of perceived exertion according to the Borg scale RPE Abort 1Phase 2Marker End HR SD bpr 46 HRmax Keal Kcalfrin past Rer Fotz we UI 7
82. at 23 E EE 23 DB FAC Ee CCIE AU TN ES sgt cae te este vnc ct wot vps ene op vet E a eee vo ca ecg eee neue ene eee ea 24 gt NOSE TIDS E 24 A The HR p ODO scone rash ran vues wievenceiudieisuanes easton eieseianeeuess 24 gt TAPONEN E 24 EEN 25 Thecanopy hood Kg EU 25 CAO OW ie ait Ke EE 25 Data presentation and values sssrinin a einde anna sta eRe Oi 28 Data presentatiON ses ouneusosvaaieaisssesestcossapsesansusesvaaueaasaaesperseseasses ennnssneweanmmnsaiaaaausesees 28 VEH 28 FR e LEE 28 HOPI ZOMG ANA EE 29 EEN 29 Table of contents 3 Bee 32 gt Checking the contents Of the Ela 32 Pimate standard Pac TE 32 FtmateProstindard hee EE 32 Fitmate Med Standard Pa CKAP ING sississcssevsrcsnscrssnvantdasssrenwassatsacsessanenssgusancaeceevarsascdseaseceeasvieeanservansaetasssstanesrsarsanseseas 33 Fitmate GS standard OIC Ee 33 Canopy module option for Fitmate Fitmate PRO Fitmate MED 33 Minimum PC d TT ECH d LN 34 Rm Power plug replacement E 34 e a ES e metalla d EE 34 E PROGUEE RECISCh Atl OM cicussatas S 34 REESEN 34 PGC EE 35 BOE more inio mation CONN AC E 35 SUIS I SSS d E 35 gt Care ile Tie atl Ol CS ccpncsectauacaesecexccnncaneceestarsccectenacaneseucsansscececsntageceussaneqcextcnncanssaucsaessccxecuntancedustansesextennceesseucsaneee 35 CONNECTING Ne Pimat EO SPC sassecscvnvintascticsnineehcoutaanvesnans EE FEE IEEE 37 Connecting the Fitmate to an ergometer s ssssesececessesesecececsesesecececse
83. ation 95 Oximetry test Fitmate Med only option gt Patient preparation Connect the oximeter probe to the patient s finger gt General warnings 1 The oximeter probe should be connected to the RS232 port on the back of the Fitmate Med 2 Ensure that the sensor is properly disinfected between patients 3 ONLY use COSMED oximeters 4 Measurement accuracy and operation may be affected by the following e intense ambient light e fingernail polish or artificial fingernails e excessive motion gt The oximetry test The oximetry test measures the percentage of hemoglobin saturated with oxygen in the blood The test can be performed at rest or during after a light exercise cycling jogging The parameters measured include the following Parameter Haemoglobin saturation Heart rate Performing the test Connect the sensor to the unit through the RS232 port on the back of the Fitmate Connect the probe to patient s index finger and affix with adhesive tape if necessary this will improve conductivity Select the patient enter in the test menu select Spirometry amp SpO2 and then SpO2 bunt vw During the initial part of the test the HR and SpO values together with a plethysmographic graph are displayed The graph monitors the quality of the signal 5 Wait for an acceptable quality of the real time signal and verify that the Perfusion indicator is green Press e 1 Rest to store the rest value e 2
84. ation syringe CO0600 01 11 e 2 Wrinkled tube A 108 300 012 e 31D18 turbine adapter C03047 01 20 e 4Conic adapter C00063 01 20 e 51D18 turbine C02500 01 04 e 61D28 turbine C02560 01 04 e 7 Canopy Blower C03784 01 04 2 If you are calibrating the flowmeter for the test with Canopy please connect the Canopy Bloweer to the turbine before starting the calibration selecting at least a medium ventilation on the flow selector in order to decrease the blower resistance During all the calibration keep the button near the turbine always pressed and turn off the Canopy Unit in order to disable the alarms Maintenance 109 From the main menu select 4 Utility 1 Calibration 4 In this menu you can select 1 Default to enter the factory settings 2 Calibration to perform a new calibration 3 Modify to modify the current data 4 Print to print calibration results O Exit to exit In the event that the data is modified the fields for date and time of the last calibration will no longer be reported Default 2 Calibration 3 Modify 4 Print 0 Exit Calibration Last Calibration Oi Go Go S000 5 If 2 Calibration has been selected start moving the piston of the syringe back and forth and perform 10 complete strokes all the way in and out If calibrating the turbine for a RMR test it is recommended that you perform the turbine calibration at the same rate that someone would breathe at rest 3 4 complete strokes per minute x Can
85. c calibrations 6 minutes by default e The interval time for averaging data 30 seconds by default e Whether or not all data is to be printed at the end of the test e Whether or not the training zones are to be printed see Options e Ifthe HR is activated in this case a warning message will appear if the heart rate is not detected Other parameters can be displayed in the real time table by using the up and down arrows on the navigator tool load systolic pressure SBp diastolic pressure DBp and of rate of perceived exertion according to the Borg scale RPE Abort iRecovery ZLoad 46p SRPE OF End HR bpm SD 46 HRmax VU rollkKoalrmip LeS 32 Gin Pred La i4 timelrmin t Phase Load 5Bp DBp BEE RO ez herberg dh we Ui ZC Warmups 0 0 0 d The values for SBp and DBp can be measured by an external monitor and manually entered by pressing 4 Bp the rate of perceived exertion can be determined and then entered by pressing 5 RPE according one of the following scales Category scale original Category Scale Borg 6 0 Nothing at all gt No intensity Very very light 0 3 0 5 Extremely weak gt Just noticeable NI Very light 10 11 Fairly light 12 Weak 13 Somewhat hard 14 15 Hard 16 17 Very hard 18 LA Very weak UI w N UI Moderate wm gt Strong N O Very strong DO 19 Very very hard 20 LD 10 Extremely strong gt Strongest intensity 1 Absol
86. cceecousceses 117 Leed corse natin rs tenis seen E E Rupa one A E E ana E E E E E E E EE 118 02 Sensor installation and RE EIN E E 119 RT Ed E E E E A E E 119 dE ossis aa aAa cuaheseccunengusuacwnsounseenacouseunes ibeeaeusatenauusannnans 120 Poun PONE o ATN EAT E A EEE inne annneanes 121 Table of contents 7 gt Installation of software EE 138 gt Installation of the Fitmate USB driver ssessssosessssoseesesoseosesossosecsssosessesoseosesossosecsssosessesossosesossosecsssosessessssoseee 141 EE e E 141 Windows Vista WING OW EE 142 gt Installation of the Lifecorder Plus Activity Monitor USB driver cccsccsccsscssccscccsccscceccesccscceccesccssceccesccnccesees 142 WINO E 142 Windows elef 6 E 142 gt Verify the proper installation Of the USB Crivers ccccssccsccssccscceccesccscceccesccscceccesccncceccesccncceccesccsccescesccsccesees 142 te Tele EE 142 WAONE IST EE 143 gt Installing and using Shared Archives ccccsccsccsscsscceccecccscceccesccscceccesccncceccesccscceccesccncceccesccscceccsccsccescescosccecees 143 gt Energie eege ee 144 Ed TEE 145 SE 148 kr 148 SOU TICS LV COON EE 148 gt Dialog wiNndOWS ssessessesseosecsecsecsecsscecsecsecsecsecsecsecsscsecesoecsessessecsecsecsessecsesecsecsecsecsessecseosessesecsessecsessessecsesseessoe 148 eege 148 SO NS iS egene 148 SET UNE 149 KREE 149 le EE 149 KE Version of the proprali nee 149 BEE 150 D COMTI ACI EE 15
87. cel Confirm Calibration Vol Expimi GAIN volInspim GAIN 3045 965 2959 1013 2970 DO J022 1009 2954 990 S006 LOU S001 969 2996 LUS 2994 990 2909 1009 2997 390 S000 LOU 2999 3003 Gart l 320 ainin 1006 a S003 990 S009 LO06 S004 990 S006 LOUE GE At the end the results are displayed and printed Press OK to accept or X to cancel The 3 litres calibration Syringe may be purchased directly from COSMED P N CO0600 01 11 110 Fitmate User Manual Cleaning and disinfecting The goal of infection control is to prevent the transmission of infection to patients subjects and staff during pulmonary function testing Cleaning and disinfecting instructions should be strictly followed to control infections and assure the safety of the patient Aspiration of residue particles and or contaminated agents could be life threatening The recommendations in the following section are retrieved from Miller MR Crapo R Hankinson J et al General considerations for lung function testing Eur Respir J 2005 26 153 162 gt Prevention of infection transmission Transmission to technicians Prevention of infection transmission to technicians exposed to contaminated spirometer surfaces can be accomplished through proper hand washing and use of barrier devices such as suitable gloves To avoid technician exposure and cross contamination hands should be washed immediately after direct handling of mouth
88. ch the Transmitter to the elastic strap 2 Adjust the strap to fit tightly and comfortably 3 Secure the strap around the subject s chest below the pectoral muscles and lock the buckle 4 Without detaching the elastic strap pull the transmitter away from the subject s body exposing the two grooved areas that are located on the underside of the transmitter Wet the grooved electrode areas with saliva contact lens solution or any other saline solution Return to its original position against the subject s skin 5 After wetting the electrodes do not slide the transmitter around on your body as this can dry out the electrodes It is recommended to wear the transmitter against bare skin to ensure proper operation If the transmitter is worn over a shirt the shirt has to be saturated with water where the electrodes sit to ensure proper conductivity In order to have good HR signal it is suggested that theHR receiver be placed as close to the HR belt as possible If the signal is poor search for the best position for the HR probe During a sub maximal test ventilation less than 100 l min it is possible to use a rubber mouthpiece and antibacterial filter along with nose clips instead of the Mask In this case assemble mouthpiece filter and reader as illustrated in the following picture Make sure that no leaks occur between mouth and mouthpiece 78 Fitmate User Manual Initialization of the unit Select 1 Cardiorespira
89. cients of variation for Ve and VO a graph showing the test result and its in comparison with the predicted value calculated by means of the Harris Benedict formula for age over 18 years or Schofield formula for age up to 18 years The test section is divided into three parts e Section one refers to the test data which will be discarded and not used in interpretation e Section two refers to the RMR test data considered in the calculation e Section three summarizes the test results The columns of the first and second part indicate Column Data t mmiss The time of the step VO2 ml min The average oxygen consumption in ml per minute during the last 30 seconds Ve l min The average ventilation in liters per minute during the last 30 seconds Rf 1 min The average respiratory frequency during the last 30 seconds HR bpm The average heart rate if measured during the last 30 seconds FeO2 The average oxygen concentration during the exhaled in the last 30 seconds RMR kcal day The RMR value calculated starting from the oxygen consumption during the last 30 seconds The columns of the third section indicate Column Data t mmiss The duration of the second phase of the test VO2 ml min The average oxygen consumption in ml per minute Ve l min The average ventilation in liters per minute Fitmate Operation 59 The RMR test with Canopy The ventilated bubblehood system allows a stream of air to
90. contraindications e Left main coronary stenosis or its equivalent Getting started 15 e Moderate stenotic valvular heart disease e Electrolyte abnormalities e Tachyarrhythmias or bradyarrhythmias e Atrial fibrillation with uncontrolled ventricular rate e Hypertrophic cardiomyopathy e Mental impairment leading to inability to cooperate e High degree AV block Note Relative contraindications can be superseded if benefits outweigh risks of exercise gt Environmental conditions COSMED units have been manufactured to operate in medically utilized rooms without potential explosion hazards The units should NOT be installed in the vicinity of x ray equipment motors or transformers with high power rating This may cause interference and may falsify the test results Fitmate is made of highly precise electrical and mechanical components COSMED equipment is not AP not APG devices according to EN 60601 1 they are not suitable for use in the presence of flammable anaesthetic mixtures with air oxygen or nitrogen protoxide If not otherwise stated in the accompanying documents COSMED equipment has been manufactured for operation under normal environmental temperatures and conditions IEC60601 1 EN60601 1 This device must be used under the following environmental conditions e Temperature 10 C 50 F to 40 C 104 F e Relative humidity 10 to 90 e Atmospheric Pressure 700 to 1060 mmHg e Do not use Fitmate in a dusty envir
91. ct an activity Close this window Planning for a weight loss of 0 50 Kg per week Weight Plan Graph weight kg Estimated weight 100 Ideal weight loss Plan reminder 14 hours a day of Very light activity 1 2 hours a day of Light activity 5 35 3 epes per week of 45 min each of Walking at Speed 6 00 kmh an 104 a0 55 GU TD ZU 65 RMR 1750 so ifestyle 730 s5 ss hed s0 12 05 2009 17 06 2009 24 07 2009 30 08 2003 06 10 2003 E h 552 kcal The graph on the right side shows the ideal body change in blue with a weight loss of 1 pound 454 g per week and the desired body change in black following the indications entered above If you desire a positive weight variation set a desired weight greater than the actual Visualization of the results E Closing the window Personal weight management the personalized program will display on the screen with the updated information Fitmate James BOND Weight Management Tests of Session Opened on 12 05 2009 S a sl Eile Edit view Options Window Help o x ER CS bk E 1 a gt gyae anpa p e ae v ParQ y RiskFact y Body Comp Diet Plan y Weight Mont Cardio Fit y Std Meas Goal RMR y Duke y EuroC D y Bode Inde ack CoO test IIs bt w S Body Composition N dh weekly Diet Planner Rest Metabolic Rate Kcal day E 1750 fab rp irra son Perma Fast no mortar vital bee b
92. cting tool O sensor PC software Fitmate Pro standard packaging Code C00966 02 04 C02580 01 05 C02500 01 04 A 362 315 001 A 196 056 001 C02383 01 05 A 662 150 002 A 201 500 027 C02522 01 20 A 558 250 005 C02560 01 04 C03612 01 10 A 661 200 040 A 661 200 039 A 800 900 023 A 182 300 004 C00269 01 20 A 662 100 001 A 362 300 006 C03494 00 11 Quantity Description 1 Fitmate Pro unit 10 RMR mask RMR reader USB cable Printer paper roll Battery charger power supply Extensible meter Suit case O sensor extracting tool O sensor VO max reader Reusable mask for VO max Medium HR monitor HR probe Head cap Small medium Antibacterial filter Soft mouthpiece PTE ID25mm Nose clip Ergometer cable PC software 32 Fitmate User Manual Fitmate Med standard packaging Code Quantity Description C02500 01 04 1 RMR reader C03095 01 08 1 Handle for reader Fitmate GS standard packaging Code Quantity Description A 558 250 005 1 O sensor 1 C03494 00 11 PC software Canopy module option for Fitmate Fitmate PRO Fitmate MED Code Quantity Description C03784 01 04 1 Canopy Fitmate Unit C03886 01 10 1 Canopy veil Installation 33 C03880 02 10 Canopy hood C02235 01 05 Turbine T2 C03494 00 11 PC software gt Minimum PC configuration e Pentium Il 350 MHz e Windows XP Windows Vista Windows 7 e 256 Mb RAM e CD ROM drive e VGA or SVGA monitor e Available USB or Seria
93. ctivation of Software Installation of software 3 Note PC software can be installed only on Windows XP Windows Vista or Windows 7 gt Installation of software Warning in order to properly install the software the user must have full control of the PC with Administrator rights Otherwise the software doesn t work 1 If on the PC is installed a previous version of the software please remove it from Windows Control panel before installing the new version Warning Uninstalling the software PC will ask you if you want to delete the archives 2 Insert the Installation CD supplied with the equipment in the proper drive Unita DVD RW E3 Install COSMED Fitmate Esegui sempre questa operazione per software e Segu pre q P Pe giochi Installa o esegui programma dal supporto Install COSMED Fitmate J Autore non specificato Opzioni generali Apri cartella per visualizzare i file utilizzando Esplora risorse Visualizzare ulteriori opzioni di AutoPlay nel Pannello di controllo 3 A window will ask the user the action to be performed Select Install COSMED Fitmate Ia INSTALL FITMATE SOFTWARE oil px INSTALL ADOBE ACROBAT EXPLORE CD ROM EXTRA CONTENTS S USER MANUAL e User Account Control Program name Autorun exe Publisher Unknown File origin COYOVOE drive To continue type an administrator password and then click OR oo Administrator ie gem Password
94. ctly to its seats and the blade is strongly fastened on the axis itself it can be useful to shake slightly the turbine in order to note any movement Check if there are any torn or broken components in the breathing circuit remember that they can create a safety risk 118 Fitmate User Manual O2 Sensor installation and replacement 3 Note The unit is supplied without the Oz sensor installed Before using the device please install the O sensor according to the instructions below The included O sensor has an expiration date printed on the package as well as on the sensor itself indicating the latest date for the installation 6 x A 40 0 BO 3 2006 05 1 HI Serial Number 01 05397714 1505 Oxygen Cell Port Number A558250005 www cosmed it COSMED ai Oxygen Cell 1505 2006 06 01 05397714 Expected Sensor Lifespan is about 12 months after the package is opened COSMED offers a 6 month warranty on the O sensor from the date of purchase Important notice Recommended replacing interval for the sensor is 12 months the sensor should not be used after the expiry has elapsed Replace the permapure at the same time gt Installation To install the sensor follow the procedures below 1 Turn off the Fitmate and unplug it from mains 2 Remove the cover located on the right side of the Fitmate 4 Connect the 3 pin connector 5 Install the cover Maintena
95. cumference of the waist divided by the circumference of the hips Number of heart beats per minute measured at rest HR can be improved with aerobic training Highest value of blood pressure occurs when heart muscle contracts and pumps blood out into arteries BP can be controlled by reducing intake of salt performing adequate aerobic exercise reducing body weight avoiding smoking and stress r Nmf Description on the right can be hidden by deselecting View Gauge text Some icons are displayed in the left part of the window here below follows their respective meaning icon Click Double click gt Get back to the previous menu d Show the summary of session Modify the information of the session Show the notes Type or modify the notes BN a Show a test not yet performed Execute the test performed o Show the test results of the session and Show the information of the tests Display a test performed Modify the information of the tests performed Modify the test data Open up the folder containing other test to perform the respective goals By right clicking on the left icons descriptions a menu allowing different activities is displayed Right click on Summary Print Edit Open in a new window Move to another session Gauge text Alternate summary Refresh Right click on Notes Print Edit notes Prints the session summary Edits the session summary Opens the summary in a new window Moves the
96. d its nutrition facts appear in the lower part of the window Press OK or double click on the selected food to enter it in the list for the current meal Performing tests with the PC Software 179 Weekly Diet Planner Ei domenica re martedi mercoledi giovedi venerdi sabata Breakfast Smack Morning Lunch Snack Afternoon Dinner ES Quantity Description Pod Oranges raw navels 1 cup sections witho Click on the icon on the left to add or remove a meal YoFrot Breakfast 0 0 0 Snack Morning D D D Lunch D D D Snack Afternoon D D D Dinner D D Daily Caloric Intake kcal day not calculated Copy Day Paste Day waterig 0 00 0 00 0 00 0 00 0 00 0 00 0 00 0 00 Energe kcal 0 00 0 00 0 00 0 00 0 00 0 00 0 00 0 00 Drot o 0 00 0 00 0 00 0 00 0 00 0 00 0 00 0 00 Fabio 0 00 0 00 0 00 0 00 0 00 0 00 0 00 0 00 Carb ig 0 00 0 00 0 00 0 00 0 00 0 00 0 00 0 00 Fibersig 0 00 0 00 0 00 0 00 0 00 0 00 0 00 0 00 Sugar g 0 00 0 00 0 00 0 00 0 00 0 00 0 00 0 00 Catmg 0 00 0 00 0 00 0 00 0 00 0 00 0 00 0 00 Si Cafe CH CC CH CC CH CC CH CC CH CC CH CC CH CC CH CC Load template Save as template Cancel Now it is possible to enter its quantity by enter the quantity and the measurement unit The food can be deleted from the list by clicking on the red X near it Useful buttons on this dialog box are the following ones e Copy Day It copies all the foods and their qua
97. date of birth dd mm yyyy and mm dd yyyy selected 3 Options 4 Advanced 122 Fitmate User Manual PC interface Check in the Windows taskbar whether the Cosmed all models USB device has been detected If not or if an unknown device is listed re install the drivers from the CD supplied with Fitmate The PC does not communicate with The drivers necessary for the proper Fitmate when connected via a USB connection might not be installed cable properly Select the proper settings RS232 o USB in the menu Options Settings of the Fitmate unit and in the menu Options Setup of the PC SW The settings RS232 or USB ports PC cannot communicate with Fitmate might be incorrectly configured on the PC or in the Fitmate unit Maintenance 123 RMR Test with mask A message Impossible to calibrate appears during automatic calibration All the accessories have been properly connected the calibration passed but there is still nothing on the screen The RMR values displayed appear to be low lt 500 and the FeO values are high gt 19 00 when starting the test The message air leak detected check the face mask appears during the test The message Expired oxygen not detected check sampling line be sure flowmeter is not reversed appears during the test execution The message values of the respiratory frequency are too high low appears during the test No HR values appear on the screen a
98. e holder responsible for your personal data 198 Fitmate User Manual Waste of electrical and electronic equipment Fitmate is an electronic equipment and can not be disposed as unsorted municipal waste Electric and electronic equipment according to European Directive 2002 96 EEC must be collected separately Otherwise it can cause dangerous consequences for the environment and human health The crossed out wheeled bin means that the product must be taken to separate collection at the product end of life Appendix 199 Safety and conformity Safety IEC 60601 1 EN 60 601 1 Find reported below the complete classification of the device e Internally powered equipment type BF device used stand alone class II type BF device used connected to mains e Protection against water penetration IP41 e Non sterile device e Device not suitable in the presence of flammable anaesthetics e Continuous functioning equipment EMC The system meets the EMC Directive 89 336 and the norm IEC 60601 1 2 Quality Assurance UNI EN ISO 9001 2008 Registration n 387 A Cermet UNI EN ISO 13485 2003 Registration n 387 M Cermet Medical Device Directive CE mark MDD 93 42 EEC Notified Body 0476 Class lla 200 Fitmate User Manual Exercise protocols gt Protocols for cycloergometers Sub maximal protocol auto HR gt 100 bpm 0 00 0 01 0 02 0 03 004 005 006 007 008 009 010 011 012 013 014 0 15 t Warm up 3 m
99. e of the transmitter Wet the grooved electrode areas with saliva contact lens solution or any other saline solution Return to its original position against the subject s skin 5 After wetting the electrodes do not slide the transmitter around on your body as this can dry the electrodes 62 Fitmate User Manual 6 It is recommended that the subject wears the transmitter against bare skin to ensure accurate data acquisition If the transmitter is worn over a shirt the shirt needs to be wet under the electrode area to ensure proper conductivity 7 In order to have a good HR signal we suggest to put the HR receiver as close as possible to the HR belt If the signal is poor although the belt is properly positioned adjust the position of the HR probe gt Test execution Verify that in 3 Options 3 RMR Canopy is selected Cancel Confirm Initial discarded interwal Um Averaged interval im End test auto print Print RMR Diagram Start End auto detection Test Mode During this period data collected will not be used For evaluation of results Adjust the flow selector according to the subject s weight Select Resting Metabolic Rate from the test menu The equipment will prompt the following messages A WARNING A WARMING Operator supervision required during Turn ON blower the whole test Do not place hood on Place canopy hood Subject if blower not operating Adjust blower rate according to Subject s weight Press
100. e unit B 2 Place the turbine in the Canopy blower 2 3 Connect the Canopy blower 2 to the hood connector 3 paying attention to let the colored dots 4 coincide f Ss Fitmate Operation 61 The Canopy unit is powered only during a test If you try to turn on the Canopy unit when you are not running a RMR test the alarm will beep and the red led will blink If you are monitoring the subject s HR only Fitmate Pro Med place the HR belt on the subject s chest and connect the HR probe to the proper outlet located on the rear panel of the Fitmate E or F HR measurement at rest is useful in order in determining if the subject is relaxed during the test Warnings on batteries Please follow these warnings about the battery usage in the Canopy unit e Use 4 alkaline AA batteries e Do not use rechargeable batteries e Pay attection to respect polarity risk of short circuit e Do not try to recharge batteries e Use only alkaline batteries e When changing batteries replace all the batteries at the same time risk of liquid leakage e Do not use exhausted batteries together with new batteries or batteries of different brands together e Exhausted batteries should be immediately removed and properly disposed according to local regulations e Remove the batteries if the unit is not used for a long time e If exhausted batteries are left for a long time in the device they could leak and damage the device itself e Do not deform or dis
101. ecent cerebral vascular accident e Known arterial aneurysm e Inability to understand the test procedures and risks Relative contraindications e Bronchial obstruction caused by performing respiratory manoeuvres e Moderate to severe bronchial obstruction FEV1 lt 1 51 in men and FEV1 lt 1 21 in women e Recent respiratory infection e Recent Asthma exacerbation e Hypertension e Pregnancy e Epilepsy gt General warnings 1 FVC VC and MVV tests should be performed with the VO max flowmeter attached to the handle 2 The sampling line should be disconnected from the flowmeter 3 Either a paper mouthpiece or an antibacterial filter should be connected to the flowmeter prior to executing the tests Fitmate Operation 91 gt Patient preparation Pr BI Disconnect the sampling line from the flowmeter and attach flowmeter to the included handle Er Instruct the patient to apply the nose clips Calibrate the turbine as indicated in the chapter Calibration ATS recommends a daily calibration The use of an antibacterial filter is highly recommended gt Forced Vital Capacity pre FVC testing is used to verify obstructive and restrictive lung disorders Automatic quality control messages are designed to ensure acceptable manoeuvres are performed for accurate interpretation Parameters measured during FVC tests include the following Symbol UM Parameter FVC Forced Expiratory Vital Capacity FEV1 Forced
102. ed according to the following scale Criteria Low If the measured value is gt 14 lower than the predicted value Normal If the measured value is between 86 and 114 of the predicted value Fast If the measured value is gt 14 higher than the predicted value For the evaluation of Blood pressure BMI WHR and risk factors other norms and different scales are used Additional statements Some parameters e g Percentage of body fat and Blood pressure have additional statements associated with them to help better describe their status Examples of statements are Unhealthy range too low Acceptable range lower end Acceptable range higher end Unhealthy range too high etc Reading the results 29 30 Fitmate User Manual Installation Before starting Before operating Fitmate it is highly recommended you to inspect the equipment and register your equipment with COSMED gt Checking the contents of the package Make sure that the package contains all the items listed below If ther are missing or damaged parts contact your local COSMED distributor Fitmate standard packaging Code Quantity Description C00966 01 04 C02580 01 05 C02500 01 04 A 362 315 001 A 196 056 001 C02383 01 05 A 662 150 002 A 201 500 027 C02522 01 20 A 558 250 005 C03494 00 11 1 Fitmate unit 10 RMR mask RMR reader USB cable Printer paper roll Battery charger power supply Extensible meter Suit case O sensor extra
103. ed from the third party manufacturer s COSMED hereby specifically disclaims any and all warranties and or liabilities arising from defect s and or damage s to and or caused by products manufactured by third party manufacturers Buyer must obtain written authorisation from COSMED prior to the repair or alteration of COSMED products s Failure of Buyer to obtain such written authorisation shall void this warranty COSMED hereby specifically disclaims any and all other warranties of any kind whether express or implied in fact or by law including but without limitation any and all warranties of merchantability and or fitness for a particular purpose COSMED shall not be liable for special indirect and or consequential damages nor for damages of any kind arising from the use of any COSMED s products whether said products are used alone or in combination with other products or substances Determination of the suitability of any of COSMED s product s furnished hereunder for the use contemplated by Buyer is the sole risk and responsibility of Buyer and COSMED has no responsibility in connection therewith Buyer assumes all risks and liabilities for loss damage or injury to persons or property of Buyer or others arising out of the use or possession of COSMED s products The limited warranty as herein above set forth shall not be enlarged diminished modified or affected by and no obligation or liability shall arise or grow out of the rend
104. ed personnel in accordance with the service manual which the manufacturer may supply upon request Prior to the cleaning disinfection and inspection it is necessary to switch off the device and disconnect adapters from the outlet In order to guarantee the highest accuracy of the data we recommend that you periodically disinfect the turbine Use disposable anti bacterial filters or the RMR masks or disinfect each part of the Fitmate which has come in contact with the subject s expired air before testing a new subject 108 Fitmate User Manual Calibrating flows and volumes Regular calibration is necessary to enssure your system is acquiring reliabledata Flow volume calibrations must be performed with a 3 liter calibration syringe Flow and volume are measured by the digital bidirectional turbine which has a very low flow resistance Air passing through the helical conveyors cause the spiral rotation of the turbine s rotor The rotating blades interrupt an infrared light emitted by the three diodes on the optoelectronic reader The turbine flowmeter does not require daily calibration since it is not affected by pressure humidity and or temperature However regular calibrations should still be performed as well as following recommended maintenance procedures 1 Connect the syringe to the flowmeter of choice 18 mm or 28 mm as shown in the picture below GO SEH TZ e i ir l e 1 Calibr
105. ed with GE Cardiosoft ECG Fitmate Pro Med can 1 be automatically driven by the Cardiosoft protocol Start Exercise Recovery phases except than the Stop function see later End of the test 2 Heart Rate Blood Pressure Speed Grade Power and protocol Phase are automatically transferred to the Fitmate Treadmill Model ternal Treadmi Ergometer Model intemal Port Port com 1 Sp0 Monitor BP Monitor Part Gen Ambulatory Blood Pressure no Port pi Ambulatory BF Device Port CoM 2 Spiromet Device Type na e Spiromet Device Pot comz Path to Holter ECG Program Path to External Prograrn Use External Program for Spirametry Procedure Name for External Program TTL output Analog 1 none i Pulse Width ms Analog 2 hone E e hone Delay ma E a Analog A hone Polarity positive Help cancel _ To enable the communication between Cardiosoft and Fitmate it is necessary to specify in System Configuration gt Devices the option Metabolic Cart and the corresponding COM port where the cable is connected gt Interface Cable A null modem DROE DROE cable is required Cosmed code C01353 01 12 gt Fitmate configuration When starting the Cardiorespiratory fitness test specify in the list of available ergometers Case GE bike if you are going to use a bike or Case GE Treadmill if you are going to use a Treadmill gt End of the test End test is not automatically act
106. ed with a pedometer Together with your body weight height and age it will allow an Cancel estimation of the number of gt Planning for a weight loss of 0 45 Kg per week Weight Plan Graph 100 Ideal weight loss a GU ZU 60 DU 40 30 ZU 10 Plan reminder Physical Activity Level Sedentary Exercise 0 Food o Saree ical 1775 kcal 12 05 2009 16 03 2010 19 01 2011 24 11 2011 28 09 2012 h 500 kcal The windows will update with the latest information entered Exercise S Click on Exercise to complete the information about the exercise performed in a week Personal Weight Management k K xj Activities Exercise i Sessions per week ER K Duration minutes os Cancel activity Waking Speed 6 kmh Incline o U Use this value for Exercise frai Information Text to be defined Close this window Planning for a weight loss of 0 45 Kg per week Weight Plan Graph i Estimated weight 14 hours a day of very light activity 100 Ideal weight loss 2 hours a day of Light activity 5 Food _ 0 1600 kcal 12 05 2009 16 03 2010 19 01 2011 24 11 2011 28 09 2012 500 kcal Complete the information required see table Press OK to confirm or X to cancel Alternatively if known it is possible to enter directly the energy expenditure induced by exercise Exercise Required information Walking Sessions duration speed grade Running Sessi
107. eeeeeeeeeeeeeeeeeeeeeeeeecececeeeeeeeeeeeeeeeeeeeeeeeeeeees 202 Bike Ramp 15W min elderly people deconditioned ccccccceceeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeececeeeeeeeeeeeeeeeeeeeeeeees 202 Bike Ramp 20W min Ee De A EE 202 Bike Ramp 25W min men average condition women 202 Bike Ramp 30W min men fit Women athlete cccccccccceesseseeseeeeeeececccsseseeeeeeueeeessseeeeeeceesseeseuseueueeeeensees 202 Bike Ramp 40W min men El 202 gt Protocols TOF TLEAGININS aegegeeeeeseeeggeeeEE REENEN 203 BEE 203 Vue tele ue gd 204 DEER 205 mA Coe evo WT E 206 PRU e a 2 le BEE 207 HIE gr lee e EE 208 RUW IAKA S7 E 209 Peli 10 T E 210 eS del Ter rn EE 211 S IER Maler E Bir e E 212 ge a EE 213 Listof compatible CLEOMECTE S EN 214 Integration with GE Cardiosoft Fitmate Pro Med Only ccccsssecccsssecccssscccccessccccessccccessccccessecccssccccessesceeseescsessesees 215 gt Enabling Cardiosoft for the communication with a Metabolic Cart ccsscssccsccssccscceccesccscceccesccsccescesccsccesees 215 aert 215 D PILI ACE configurati EN 215 b EMG OF TNE COSE soxacsisanssdsnsicusdswaegendicoateinesaanny a a danausivadeananiaessaesuadeaausenueasusvasanontae sees 215 10 Fitmate User Manual Sheet 216 d CT 216 DE recrereecpcen ct A E AE eater cere plana eames anaes A wins seaman EE E A ES 216 Flow and volume flowmeter RMR 18 mm 216 Flow and volume flowmeter VO max 28 mm 216 Bai OUT TS EE eege 216
108. eg l called maximal aerobic power provides information concerning the level of very Poor Poor ra Good Excellent endurance training High YO2 max values minimize CVD risks lt 33 0 33 0 36 7 36 7 39 9 39 9 44 1 44 1 50 4 O2 Kg ml Kg min HR bpm orig K min pm 47 04 95 42 04 90 37 07 85 32 07 80 vO2z Kg 22 04 70 17 04 65 12 04 mme el 60 a Jo e 4 AE eat Num Fitmate James BOND Cardio respiratory Endurance Tests of Session Opened on 12 05 2009 S Eile Edit view Options Window Help 8 x SAS aonwbie er wv ParQ y RiskFact y Body Comp Diet Plan gt Weight Mont y Cardio Fit y Std Meas 4 Goal RMR y Duke y EuroC D y Bode Inde ack CO test IIs S Se ardio respiratory Fitness Cardio respiratory Fitness ml Kg min 45 0 Cardio respiratory Fitness ml Kg min Rank 84 Inputed value The highest value of oxygen consumption of which a person is capable Also 45 0 i kee called maximal aerobic power provides information concerning the level of very Poor Poor Tra Good Excellent endurance training High YO2 max values minimize CYD risks lt 33 0 33 0 36 7 36 7 39 9 39 9 44 1 44 1 50 4 Ready Mmf Performing tests with the PC Software 185 Muscular Fitness Fitmate Pro only gt Test execution and data entry Double click on the icon Muscular Endurance and Strength If a zero is entered in a field this val
109. electing the menu item Help Reauthorize and on the unit selecting the menu item 3 Options 1 Settings x wv This software must be authorized f IcCcmate N Please connect Fitmate to E USB A Fitmate Change Fitmate Language Fitmate Model IMPORTANT NOTICE You will be requested to authorize this software again if the Fitmate is kept off line For more than 30 days lt Indietro f i Annulla Cancel Confirm Option Setting Date m dd yyyy P 2006 Time b mpm SG Ia Language English dh Unit of meas konbko Wi Turn off LOD fmin O Never cE Backlight LCD Low DC Communication USE dh GE The first time the Fitmate and PC are connected via USB you will be required to install the USB drivers from the included CD For more information see the nstallation and activation of Software chapter When the Fitmate and PC are connected and the Fitmate is being used as a medical device as fixed by the EN 60601 1 1 then all of the equipment must be compliant with EN 60601 1 by means of an isolation transformer Installation 37 Connecting the Fitmate to an ergometer Fitmate communicates and controls a variety of ergometers through the RS232 port on the rear panel of the unit In order to connect the Fitmate to an ergometer it is required to use two cables the Fitmate ergometer cable A 362 300 006 in the Fitmate standard packaging and the RS232 cable for the speci
110. er diameter as well as a reusable mask VO mask specifically used for cardio respiratory fitness assessment testing For information on cleaning the VO mask please refer to the Maintenance chapter gt Paper mouthpieces Je Fitmate Med also includes disposable paper mouthpieces for basic spirometry FVC VC and MVV gt Soft mouthpieces The PTE soft mouthpieces can be used during cardio respiratory fitness assessment in subjects whose ventilation is less than 100 l min It should be used in conjunction with an antibacterial filter and nose clip in place of the VO Mask Getting started 23 gt Antibacterial filters Antibacterial filters are recommended for infection control Regular cleaning and decontamination of equipment should always be performed Note The use of antibacterial filters is recommended even when using disposable mouthpieces to prevent cross contamination gt Nose clips Ss Nose clips should be used while performing spirometry tests in order to prevent respiration through the nasal passage during each manoeuvre gt The HR probe The HR probe consists of three parts the elastic belt containing the transmitter and the USB receiver The parts should be assembled as close as possible to one another to acquire the most effective communication signal 3 Note Firmware versions up to 2 1 are compatible only with USB1 probes firmware version starting from 2 2 are 3 compatible also wit
111. erings of technical advice or service by COSMED its agents or employees in connection with Buyer s order or use of the product s furnished hereunder gt Return goods policy for warranty or non warranty repair Goods shipped to COSMED for repair are subject to the following conditions 1 Goods may only be returned after you receive a Service Return Number SRN from COSMED S r l 2 Place your SRN report and Packing List outside the package 3 Goods returned must be shipped with freight and insurance charges prepaid Collect shipments will not be accepted 4 The following list of goods are not eligible for return unless proven defective Special order items Expendable products Goods held over 30 days from COSMED s invoice date Used goods not in original shipping containers Goods which have been altered or abused in any way 5 The following parts are not covered by warranty consumables fragile glass or plastic parts rechargeable batteries damages due to use of the device not conforming to the indication reported in this manual gt Repair Service Policy Goods returned to seller for Non Warranty repair will be subject to conditions 1 2 3 4 The returned goods need to re enter COSMED together with the customs documents Pro forma Invoice and Customs Paper as requested by the Italian law e The shipment has to be qualified as a Temporary Export e All the goods returned to COSMED without the customs pap
112. ers will not be accepted For European Community members Pro Forma invoice complete with Appendix 195 e Number e Description of the goods e Quantity e Serial Number e Value in e Number of parcel e Gross weight e Net weight e Reason for resent i e Resent for repair In case you should send the system for repair please contact the nearest service centre or contact COSMED at the following address COSMED S r l Via dei Piani di Monte Savello 37 P O Box 3 00041 Pavona di Albano Rome Italy tel 39 06 9315492 fax 39 06 9314580 E mail customersupport cosmed it For USA customers only please contact COSMED USA Inc 2211 North Elston Suite 305 Chicago IL 60614 USA Phone 1 773 645 8113 Fax 1 773 645 8116 email usa sales cosmed it To ensure that you receive efficient technical assistance please specify as precisely as possible the nature of the problem as it is specified on the assistance information form We advise you to save the original packaging You may need it in case to ship the unit to a technical assistance centre 196 Fitmate User Manual Fitmate Registration Form fax to 39 069314580 or email to register fitmate net PSALMS I EE Ale IEN ECH E SE COUN E Phone and Fax En UN Model O FitMate O FitMate PRO O FitMate MED OFitMate GS Key oTo oo ecccccccecccsecessecenseceusecuesensesensecusseaeesensesenssesueseaeevesesenreesneeenee Mandatory field
113. escceccescessceccescs 91 Absolute e uge ue Tee hs saace recta cece cso tet cesses aaa ests va EEE eu EEO A E 91 Relative contraindicat ONS EE 91 D General WAN NGS EE 91 E SEENEN 92 gt Forced Vital Capacity EEN 92 FON I TVS Ne O Tei E E E a E EEA 93 P SIOW Vila CAD ACN Y nin AA 93 Beta geilen OS E 93 gt Maximum Voluntary WV eege 94 Porre E EE 94 A Broncho E dee is iar E E E E S T E OE E ents 94 PS ORIN e Ne O enaga A E T T A 94 Oximetry test Fitmate Med only Option sessssosessssosessescseosessssosecssecsecseecssosecsssosesseecsecsescssosecsesosessessssosecssscsessescseesese 96 E Patient DFE DAL ALIOM ee 96 General Warning S iitaa te caetestecceecituerceuiireenenadenauaeiieiceese ic E EN 96 H The TE de TA EE 96 D Perlormine Ce CCS iay a E sae ace eee veeuecec vane euaireeeuceaeevebecesanuucoevenuteseveveatasyec 96 Risk analysis Fitmate tere 97 E E 6 soi apn E E EAA EA A E E E E A E A 97 Eraus gegangen Eaa a ES 97 P DUKE TEMI S COTE eegene 98 E INGO E E E E A E E E 99 How to load paper in the printer compartment essssessssecsssecsssecsssecsssecsssecsssecsssecsssecscsecsesecsesecsssecsssecsssecscsecsssecseseoe 100 DB PSST Te i A E A A E E N E E A E 100 Additional functions OF EE 101 gt Flowmeter calibrati asies sates adesinmuasyasdanns samacsad oeadiesad ceaameadusaainentinaegear senugeadeeaumesdsnsimns 101 De Os BAI ZEN CMON E 101 DB COME OL Dae i wescsscaccacuwawsees cescusaasieasseatceaceuaceioudeaiven
114. ewed also with a text editor gt Import tests To import a test select File Import Select the test to be imported and confirm Software features 163 Other software features gt Archive Management To avoid possible loss of data from the archive we strongly recommend to adequately maintain the archives Select File Archive Management Reorganize Archive periodically If for any reason limited space on the HD all the data memorized in the archive should be erased then select File Archive Management Erase Archive Reorganizing the archive 1 Select File Archive Management Reorganize Archive 2 Wait till the reorganization is terminated before executing any operation Erase the archive 1 Select File Archive Management Erase Archive 2 Wait till the reorganization is terminated before executing any operation Backup and restore archive JEP LS Warning Archives must be saved at least once a month a warning message periodically reminds user to backup the archive this function avoid that all data memorized are lost if the archives should corrupt or the Fitmate program should damage D POC a To save the archive select File Archive Management Backup archive and follow the instructions To restore the archive select File Archive Management Reorganize Archive and follow the instructions gt Send subject card to the unit Select File Send to transfer a subject card from the PC to
115. fic ergometer See the diagram below for interfacing the Fitmate with an ergometer W ef H e SE FitMate 1 Fitmate ergometer cable A 362 300 006 2 RS232 cable of the ergometer 38 Fitmate User Manual Interface Fitmate Med with an external ecg Fitmate Med can be interfaced with an external ecg with TTL output in order to receive the heart rate signal directly from the ecg To connect the Fitmate with the external ecg use the opto insulated ecg Fitmate cable code A 661 200 045 The B side must be properly faced with the proper connector the black line is the reference the white one is the signal Please refer to the ecg instructions for the signals on the lines and the required connector The A side must be connected to the port on the rear panel of the unit shown in the following picture Installation 39 40 Fitmate User Manual Fitmate Operation Fitmate Operation 41 User interface The keypad and arrow keys control all the functions of the Fitmate Se F m A O l abe def Seet ng Be 1 2 d d 3 d 2 we A We be Ss J GEN S d Ka a eege a oe EN Re E j Be ag fa i 5 Se Y yu Ge S oh jk mp we 7 A K S j J J S ee
116. gement Tests of Session Opened on 12 05 2009 E x SO File Edit View Options Window Help l x B qaaa CH RE v ParQ y RiskFact y Body Comp a Det Ban y Weight Mont Cado Fit a Std Meas Goal RMR y Duke y EuoCHD y Bode Inde ack to test lis 4 D jody Composition FAT dh weekly Diet Planner A Energy Balance A Resting Metabolic Rate A Activity Monitor Fat is the percentage of fat over the whole body mass Excellent fee ee 16 3 16 3 19 6 19 6 22 5 22 5 26 1 gt 26 1 gt Resting metabolic rate The RMR test must be performed with the Fitmate or another Cosmed device and then imported in the PC software archive Refer to chapter Operating with Fitmate for the set up and the test execution Double click on the icon Resting metabolic rate from an open session menu i If the test is already saved in xpo format press Import a test from an XPO file select the file to be imported and confirm If the test was performed on the Fitmate download the test into the PC archive see the section Download the test from Fitmate unit An overall RMR assessment will be displayed on the screen 172 Fitmate User Manual Fitmate A A Nutritional Assessment Tests of Session Opened on 12 05 2009 Eile Edit view Options Window Help 18 x e SS C a7 a GOTH a Be CH EES A ParQ 4 Risk Fact A Body Comp A Diet Plan Weight Mont h Cardio
117. gnetic characteristic of a typical location in a typical field commercial or hospital environment IEC 61000 4 8 Nota U is the a c mains voltage prior to application of the test level Getting started 17 Guidance and manufacturer s declaration electromagnetic immunity The device is intended for use in the electromagnetic environment specified below The customer or the user of the device should assure that it is used in such an environment Immunity test Conducted RF IEC 61000 4 6 Radiated RF IEC 61000 4 3 Notes Test level IEC 60601 1 3 Veff 150 kHz to 80 MHz 3 V m 80 MHz to 2 5 GHz Compliance level 1 At 80 MHz the higher frequency range applies Electromagnetic environment guidance Portable and mobile RF communications equipment should be used no closer to any part of the device including cables than the recommended separation distance calculated from the equation applicable to the frequency of the transmitter Recommended separation distance d 1 17 JP d 1 17 JP 80 MHz to 800 MHz d 2 33 JP 800 MHz to 2 5 GHz where P is the maximum output power rating of the transmitter in watts W according to the transmitter manufacturer and d is the recommended separation distance in metres m Field strengths from fixed RF transmitters as determined by an electromagnetic site survey should be less than the compliance level in each frequency range Interference ma
118. gy Expenditure and Fuel Selection in Biological Systems The Theory and Practice of Calculations Based on Indirect Calorimetry and Tracer Methods M Elia G Livesey World Rev Nutr Diet Basel Karger 1992 vol 70 pp 68 131 Nutritional Assessment in Critical Care A Training Handbook Donald C Zavala Sub maximal test Cardiorespiratory Assessment of Apparently Healthy Populations Timothy R McConnell in ACSM s Resource Manual for Guidelines for Exercise Testing and Prescription Ai Edition pp 361 366 Franklin BA ed ACSM s Guidelines for Exercise Testing and Prescription 6 Edition Philadelphia Williams amp Wilkins 2000 22 29 Risk analysis European Guidelines on CVD Prevention Third Joint European Societies Task Force on Cardiovascular Disease Prevention in Clinical Practice De Becker G Ambrosini E Barch Johnsen K et al Eur J Cardiovasc Prev Rehabil 2003 10 Suppl 1 S1 S78 AHA ACC Scientific Statement Assessment of Cardiovascular Risk by Use of Multiple Risk Factor Assessment Equations A Statement for Healthcare Professionals From the American Heart Association and the American College of Cardiology Scott M Grundy Richard Pasternak Philip Greenland Sidney Smith Jr and Valentin Fuster Circulation 1999 100 1481 1492 Frammingham Study Wilson PW D Agostino RB Levy D Belanger AM Silbershatz H Kannel WB Prediction of coronary heart disease using risk factor categories Circulati
119. h USB2 probes PECs gt The oximeter N The oximeter probe should be placed on the patient s finger when measuring oxygen saturation at rest or during exercise only during SpO tests 24 Fitmate User Manual gt The canopy The canopy module can be used only on device with S N above XXXXXX1000 It is made of different items The canopy hood with vail The canopy hood allows the patient s exhaled air to blend with ambient air This mixture is then inspired by a pump with a known flow and the patient s Oxygen Consumption and Energy Expenditure can be calculated Canopy blower and unit The canopy blower and the Canopy unit generate the known flow for performing the Canopy test and perform the safety checks Getting started 25 26 Fitmate User Manual Reading the results Data presentation and values Below are the guidelines which were used in determining the format of the data and the predicted values ACSM s Guidelines for Exercise Testing and Prescription Sixth edition 1994 Frankenfield DC et al The Harris Benedict studies of human basal metabolism history and limitations J Am Diet Assoc 1998 98 439 445 Sixth Report of the Joint National Committee on Detection Evaluation and Treatment of High Blood Pressure NIH publication 1997 Clinical guidelines on the identification evaluation and treatment of overweight and obesity in adults National Institute of health National Heart
120. h e r We a Kei G d pq S I tuv wxyz Rees d it K wo 7 CFS KETKY S Pa Seier a KA S i Dee E A SI e ee SC F sche ger pr Ze BW Z Ki SN Es as e ae 7 X XS 3 0 on off A i A o 7 ES P 7 aa i a gt Powering the unit on off on off To turn the Fitmate on off press the on off button o for up to 4 seconds To save energy Fitmate will automatically e Dim the display when not in use This time interval can be adjusted see the Options section of this manual To reactivate the display press any button e Power down the unit after 5 minutes of idle time To turn the unit back on hold the on off button for up to 4 seconds 3 Note Attention If the battery is very very low for example if the unit has been not used for a long time let the unit 3 charge for some minutes without turning on it Otherwise acoustic signals and display flashes can occur To stop this sequence press the key 3 and wait some minutes before turning on the unit again If the available memory is less than 20 a warning message recommend to download tests on PC before going on 1 Download tests on PC according to the instruction reported in the chapter Software features 2 Erase the memory according to the instruction reported in the following of this chapter Erase memory gt Menus The menus are displayed on the screen or as the header top of the screen How
121. hapter Fitmate Operation The printer The built in thermal printer allows the user to print tests performed For more information please refer to the Chapter Fitmate Opertation The rear panel There are 7 connectors located in the rear panel as illustrated below Above each connector labels specify the type of connector From right to left they are respectively USB port for PC connection Optoelectric reader connector RS232 serial port for PC connection if PC does not have a USB port or for controlling an ergometer Gas sampling line connection Heart rate probe Polar connector USB port for an external printer optional or heart rate probe ANT connector GO mmm OO wD gt External power connector gt Battery Charger Fitmate is powered by rechargeable batteries For information on connecting the battery charger and other information related to charging the internal batteries please refer to the nstallation chapter gt Reader and Mask Fitmate is supplied with an optoelectronic reader which allows the measurement of the inspired and expired flows and volumes and a disposable subject mask The reader RMR reader and the mask RMR mask are used when performing RMR tests For more information on this subject please refer to the chapter Fitmate Operation 22 Fitmate User Manual SI oP ad Fitmate Pro and Fitmate Med have an additional optoelectronic reader VO max reader which has a larg
122. he Canopy The Canopy unit could be off or the ventilator could be not connected to the hood Beeps are sounded with the message indicating that the hood must be removed Be sure to use 2 3 or higher firmware release and in case select Canopy in Options RMR The Canopy unit must be turned on only when requested by the Fitmate during the start phase of the RMR test Replace the backup batteries in the Canopy unit Use only alkaline not rechargeable AA 1 5V batteries Verify that the O sensor is present and that it is properly installed Verify that the O sensor is efficient by means of the analyzer check tool If the sensor is exhausted replace it Verify that the turbine is properly connected to the blower and that the blower is properly connected to the hood Verify that the power cable is properly connected to the Fitmate Verify that the hood is ventilated Verify that the sampling line is connected to the sampling connector of the Fitmate and to the proper hole on the Canopy blower near the hood Continue test and follow the instructions if the oxygen concentration falls below 19 50 increase ventilation It is not possible to measure the subject s ventilation Adjust the ventilation and wait 30 45 seconds to check the effects Abort the test and change the option Verify that the Canopy unit is on Verify that the turbine is properly connected to the blower and that the blower is pr
123. he automatic acalibration before the test the message Calibration impossible is prompted During the test the red led blinks and the alarm beeps During the test a message warns that the exhaled oxygen is not detected Oxygen concentration is higher than oxygen concentration during RMR test with mask FeO aroung 20 Vp doesn t indicate the subject s ventilation during the test During the test messages indicate too high low oxygen concentration During the test a warning indicates a wrong test mode Although the Canopy is connected to the Fitmate no ventilation is detected during the test At the end of the test before ending it Fitmate beeps 126 Fitmate User Manual The Canopy is powered by the Fitmate only during the RMR test if Canopy is not powered the alarm beeps The backup batteries in the Canopy unit are discharged or a wrong battery type is used The O sensor could be exhausted or not properly installed A malfunctioning is detected The sampling line could be not properly connected During RMR tests with Canopy the oxygen is diluted with room air and the oxygen concentration is around 20 Vp is the pump ventilation and it is not related at all with the subject s ventilation The oxygen concentration depends on the ventilation in the hood The aceptable range is between 19 50 lt FeO lt 20 25 In option it is selected mask while the test is performed with t
124. he current date and time in the above example 07 05 2009 16 33 e The number of patients in archive in the above example e The state of the internal memory of memory free e This icon can be in the following states More than 50 of free space H Between 20 and 50 of free space H Less than 20 of free space e The battery state e This icon can be in the following states Battery full R Battery half DH Battery low H Battery empty e The O sensor state e This icon can be in the following states ei Sensor is optimal fe Sensor is poor Please plan for sensor replacement el Sensor exhaust Please replace sensor g There was a problem during sensor calibration Do not perform tests e f USB connection to an external device printer or ANT probe is active This icon is gray oa if the connection is not active otherwise it is coloured ae e Ifthe PC connection is active This icon is grey WS if the connection is not active otherwise it is coloured a 44 Fitmate User Manual Archive management FitMate Archive Subject 1 Subject 2 Subject n Session 1 Session 2 Session 1 Session n 01 01 03 12 01 03 01 03 03 20 03 03 Standard Mesurements Body composition Standard Measurements Body Composition 01 01 03 01 01 03 01 03 03 01 03 03 RMR Muscular Fitness RMR Muscular Fitness 01 01 03 05 01 03 03 03 03 15 03 03 Aerobic Capacity Flexibility Aerobic Capacity Flexibility 12 01 03 12 01 03 15 03 03 20 03 03 Program Goal 12 0
125. her the equipment is working properly to verify the detection of HR if used and to get the subject familiar with the equipment Press 1 Start to start the test after you have ensured that all data collected is accurate and physiological If you do not press start the test will automatically begin after one minute In the first part of the test the flow rate of the pump should be adjusted with the flow selector in order to achieve a FeO between 19 50 and 20 25 After modifying the flow please wait at least 30 45 seconds in order to visualise the variations Warning message on Fitmate Actions to do RMR Pred Kcalfday 3 0 Expired oxygen not detected Tek Ge Ge tube and Check the sampling line and the ann l vpump Fe flowmeter connection turbine connections Discard 81 100 RMR Pred thre 177220 2207 O A Kcalfday WA 377 2 High oxygen concentration Reduce entilation Vpoump Feo m ys Discard RMR Pred Kcaliday 3 107 8 pump FeO NOTHING Discard 81 100 RMR wo Pred ENE 177 220 PA D d ei Kcalfday D Da ISS S Warning Oxygen concentration too low pump Fee Increase Yentilation m EE Discard 64 Fitmate User Manual During the test you should continue to verify that the measured FeO is within the 19 50 20 25 range throughout the test and adjust the flow selector as necessary Warning If the green led turns off during the
126. hodilators can increase airway conductivity by relaxing the smooth muscle This test compares the results from the initial FVC FVC PRE and the FVC obtained after administering the bronchodilator FVC POST If the FEV1 increases by 13 15 with respect to the baseline value is representative of reversible airways disease Performing the test The manoeuvre is identical to the FVC test Select the patient enter the test menu select Spirometry amp SpO2 and then FVC post BD Wait until the program is ready to perform the test After performing the test press 2 End or wait for the automatic termination 5 seconds without any flow Press 0 Exit to abort the test and discard all results Press 1 Start to restart the test Press OK to confirm or X to cancel et a a Repeat the test until it is properly performed ATS recommends a minimum of 3 times by pressing 1 Start 94 Fitmate User Manual The three best trials will be superimposed on one another identified by different colours On the right side of the display the three best trials their colours and the measured parameters are reported ordered from best to worst Press 2 Save amp Exit in order to exit and save a trial You will be asked to select the individual trial which you would like to store press the number corresponding to the trial to be stored Otherwise press 0 Exit without saving in order to exit the test mode without saving any of the trials Fitmate Oper
127. ht corner of the screen turns on from time to time during the test and the indicator in ex near the small mask no longer matches the breathing rate The final printout displays only the final results no step by step data are printed The equipment discards all invalid steps i g when an automatic calibration is being performed during the test the breaths are discarded from the calculation of RMR An automatic air calibration is being performed every 6 minutes The frequency of the automatic calibration can be set from the menu option advanced The print tabular results option is not activated Ignore these values they will be printed on the report but discarded from the final calculation Ignore this event and keep going with the test The algorithm that manages the RMR calculation will discard those steps Do not remove the sampling tube from its position during the automatic calibration Activate the the print tabular results option in the Menu Otpion adavanced Maintenance 125 RMR test with Canopy The Canopy can be used only with firmware 2 3 or higher if you are using the Canopy it must be enabled this option in Options RMR menu Problem It is not possible to perform the RMR test in Canopy mode Before starting the test although the Canopy is on and properly connected the red led blinks and the alarm beeps Before starting the test the yellow led turns on During t
128. iate is kept off line For more than 30 days Indietro ATTN 146 Fitmate User Manual User Interface and settings User Interface Fitmate James BOND Tests of Session Opened on 12 05 2009 E q 5 m a x E File Edit view Options Window Help e x 7693 2O OW GEES v ParQ y RiskFact y Body Comp DietPlan y BO Mgmt Cardio Fit y Std Meas gt Muscular y Flexi y Goal Ex Prescr RMI ack to test lis Notes p _ wi Session Information SH Risk stratification SH Nutritional Assessment SI Cardio respiratory Fitness FAT Wi Standard Measurements Push Up 30 d Curl Up of Muscular Fitness Sit up w Flexibility Leg Strength 2 25 ag Upp Strength 1 38 ei Program Goal Flexibility 32 A Exercise Prescription vo2 Kg sain ery Poor Poor Fair Good Excellent Superior gt Ready NUM gt Display Different windows may be displayed at the same time The active one is highlighted with a different colour Some typical window functions are context sensible to the active window Print right button of the mouse gt Tool bar Operator may enter all the functions from the menu Many functions are alternatively accessible clicking on the related icon on the tool bar A brief description will appear when pointing an icon with the mouse if the option help is enabled Show hide the toolbar Select Toolbar from the menu Options to show or hide the
129. ibility cm 32 Flexibility cm Rank 25 o 32 Ability to move a joint through its complete range of mation Wery Poor Poor Fair Good Excellent Superior You can improve it with stretching w Muscular Fitness gt Program Goal oP Exercise Prescription SP gt Ready NUM Performing tests with the PC Software 187 Fitness goals gt Set the goal to reach To set the goals to reach double click on the icon Program goal A window reporting the results summary of the tests performed and the related goal if entered will appear Select the interval time for reaching the desired goals Program Goal Beginning of the program Beton End of the program 12 05 2009 Result EE Body Composition FATS o 22 0 0 0 1 Waist to Hip Ratio t 1 10 0 00 EE Resting Heart Rate bprn 64 D EE Systolic Blood Pressure mmHg 125 0 EE Diastolic Blood Pressure mmHg KE 0 E Cardio respiratory Fitness ml Kg min 45 0 0 0 MEE Duch mp rep 30 0 Curup trep z0 0 EE Sit up rep 25 0 E Leo Strength max body weight 2 25 0 00 MEE Upper Body Strength maxibody weight 1 38 0 00 mm Flexibility fcr 32 o Rank EE on an item to open the input a ialog Very poor Good Excellent Double click on a string to set a goal for that specific test Enter the target value in the dialog box that appears or move the cursor of the bar with the mouse til
130. inutes a 25 Watt Exercise according to the HR at the end of the warm up the load is set as in the following table dur HR lt 80 bpm HR 80 89 bpm HR 90 100 bpm HR gt 100 bpm 3 125W 100W 75W 50W 3 150W 125W 100W 75W Si 175W 150W 125W Recovery will follow The protocol can terminate before the end if the end of test condition is reached or you stop it manually Appendix 201 Bike Ramp 10W min patients limited exercise tolerance 500 geg 40 W min i l l I 450 i l 400 lI l 350 j P l 30 W min I lal l e e 300 I1 25 W min l D 1 D KAN I 250 e 20 W min i w S Ss I 200 l t Q s 15 W min l ol I 150 Panne Lt x 10 W min 100 psy l 4 l The end of the exercise 50 phase depends on the l l subject s conditions Rest A Exercise j Recovery 0 02 0 04 0 06 0 08 0 10 0 12 0 14 0 16 0 18 t h mm Rest 1 minute without load and activity Warm up 1 minute without load Exercise 17 minutes with load constantly growing 10W per minute Recovery will follow The protocol can terminate before the end if the end of test condition is reached or you stop it manually Bike Ramp 15W min elderly people deconditioned As the Bike Ramp 10W min protocol the load increment is 15 W min Bike Ramp 20W min sedentary As the Bike Ramp 10W min protocol the load increment is 20 W min Bike Ramp 25W min men average condition women fit As the Bike Ramp 10W min protocol the lo
131. invalid in the printout report and will be discarded from the final calculation RMR Pred Ecaliday 3o z BH DP E ck B High oxygen concentration Reduce Yentilation Yoump Feces Oo bm 15 m Fitmate Operation 67 If a wrong mode is selected i e it is selected mask mode and the RMR test is performed with the Canopy the following message will appear during the test the test must be stopped the proper option must be selected and the test must be restarted A TEST MODE ERROR Selected MASK In use CANOPY Please check it on RMR options Press Any Key Average interval selection At the end of the test a graph is shown 2 gt OK Confirm Cancel RMR 1965 FAR RMR 5 4 16 time min The user can graphically modify the start and the end of the average interval 1 e Press and the arrows to move the start cursor abc 2 e Press and the arrows to move the end cursor Press OK to confirm X to cancel Each time the cursor is moved the RMR value and the coefficients of variation are recalculated gt Printout interpretation Below the header and the subject s data in the Canopy section is reported the RMR graph is the option is enabled all the test steps if the option is enabled the final result the coefficients of variation for Vp and VO a graph showing the test result and its in comparison with the predicted value calculated by means of the Harris Benedic
132. ircumPerence cm Hip circumference cm Abdomen circumference cm Resting Heart Rate Dpm Systolic Blood Pressure mmHg Diastolic Blood Pressure rimHg Bp HF affected by Medication Mi Mk With the subject standing arms at the sides feet together and the abdomen relaxed a horizontal measure is taken ak the narrowest part of the torso above the umbilicus and below the xiphoid process When all the fields are filled in press OK to confirm a new window will display the results Exit 1Test 2 Print 3 Print all RMR Standard Measurements BODY COMP Date mirni dd yyyy l2i22 2005 E Eeler Waist circumference cr g0 Hip circumference crn 110 Abdomen circumference cm 100 Resting Heart Rate bpm 66 Systolic Blood Pressure mmHg 125 Diastolic Blood Pressure mmHg 80 Waist bo Hip Ratio 0 82 72 Fitmate User Manual Energy balance gt Setting up an energy balance Select Energy Balance from the test menu A new window will open e Amenu on the top left side of the screen is used to control the program 1 e The weight control program is shown on the top right side 2 e Anumeric representation of the program is displayed on the bottom left side 3 e Agraphical representation of the program is displayed on the bottom right side 4 RMR Lifestyle EEJ Food Exercise 0 ii HETA i DU e e EE Today Mext check 8 g1 Goal 2
133. is not required to perform Personal Weight Management test before the Activity Monitor test Performing tests with the PC Software 181 Activity Monitor Ei Head data From Activity Monitor When the test is started the user can e Initialize the Activity Monitor e Read data from the Activity Monitor In both cases the Lifecorder Plus must be connected to the PC through a mini B USB cable not included code A 362 315 004 For the use of the Lifecorder Plus please refer to its user manual Initialize the Activity Monitor Activity Monitor xX FPA Incentive Level Lower Limit METS E Upper Limit METS E 335 Calories C Target Activity Steps Target Activity Time min 30 Stride crn 75 Display Display mode when key lock any Not Keyvlocked sl Activity Cal IT Total Calories Jh FPA Graph Jh Steps Jh Activity Time Jh Clock TI Distance Warning Initialization of the Activity Monitor will erase all the data currently stored in it eei The user can set e The target activity as calories or steps e The target activity in minutes e The physical activity lower and upper limits in METS e The stride length e The parameters to be displayed on the Lifecorder Plus e The locked parameters on the Lifecorder Plus i e the parameters which the user can see on its display Warning Initialization of the Activity Monitor will erase all the data currently stored
134. it has been fully charged e Battery failure Please contact technical support Note Fitmate can be used without being plugged into the wall If the batteries are completely charged disconnect the battery charger and operate as normal Note The batteries must be replaced when they do not maintain their charge for enough time Please contact the technical support Note Attention If the battery is very very low for example if the unit has been not used for a long time let the unit charge for some minutes without turning on it Otherwise acoustic signals and display flashes can occur To stop this sequence press the key 3 and wait some minutes before turning on the unit again 36 Fitmate User Manual Connecting the Fitmate to a PC The Fitmate can be directly connected to a PC for data transfer data storage and analysis The PC also allows for data back up to a variety of storage devices HDD floppy CD ROM The test data can be exported in several formats If Fitmate is connected to a PC and used as medical device PC and or printer must be EN 60601 1 compliant by means of an isolation transformer Fitmate can be connected to PC through the USB port located in the rear panel and marked by the symbol a If no USB ports are available on the PC the Fitmate can be connected through the RS232 serial connection cable not included Select the communication port both on the PC when authorising the software or s
135. ivated by the Cardiosoft therefore STOP TEST must be manually pressed on the Fitmate Appendix 215 Technical specs gt Sensors Oxygen Type Galvanic Fuel cell Range 0 25 Optimized for RMR test Accuracy 1 mBar O circa 0 03 O 760 mmHg PB Resolution 0 006 Vol O Flow and volume flowmeter RMR 18 mm Range 0 50 L min Accuracy lt 2 Resolution lt 10ml Flow and volume flowmeter VO max 28 mm Range 5 300L min Accuracy lt 2 Resolution 24ml Barometric pressure Type piezo resistive Range 300 800 mmHg Accuracy 1 mmHg gt Power supply Old models till S N XXXXXX0999 4 NiMH rechargeable batteries 1 2 Volts 4500 mAh New models from S N XXXXXX1000 Li lon rechargeable battery 7 4 Volts 2150 mAh Battery charger Medical grade Battery charger power supply Friwo FM7555M 12 In 100 240Vac 50 60Hz 400mA Out 12Vdc 1 25A gt Autonomy Old models till S N XXXXXX0999 Mean battery autonomy stand by 5h 30m with low backlighted display 4h 15m with high backlighted display Mean printouts starting with completely charged battery approx 180 in 1h 20m about 20 each paper roll Mean battery autonomy normal use stand by tests and printouts 3h 30m approx New models from S N XXXXXX1000 Mean battery autonomy stand by 7h 30m with low backlighted display 6h with high backlighted display Mean printouts starting with completely charged battery approx 250 in
136. l RS232 port e MS Windows compatible mouse and printer e PC must be compliant with the European directive 89 336 EMC gt Power plug replacement If the plug on the power supply is not for your country replace with the proper on e from the Fitmate packaging 1 Extract the plug from the battery charger PiLZLZC PUD RARER Sew Le OU IIT T b s Idi el el ZS ag ee ee Pe Et eg 8 ee HI gl ef af cd zg ee NNN eg d d OT DT OT ee Tel Lrncnrgegene d muy gt O sensor installation The Fitmate unit is supplied without an installed O sensor Before using the device install the O sensor according to the instructions in the Maintenance chapter gt Product registration Before powering on the Fitmate it is required to 1 Activate the Fitmate Unit within 30 days since first use 2 Activate the PC SW before starting using it A Fitmate works without activation for 30 days after the first use Once this period has expired it is impossible to operate the Fitmate until the unit is properly activated Activating the Fitmate Unit To activate the unit 1 Set the date as soon as the Fitmate is turned on the very first time Abort OF End Wersion 2 20 Date nm dd yyyy 2010 2 Read the on screen prompts and accurately verify the following data 34 Fitmate User Manual e Serial Number This is the serial number found on the back of the Fitmate e Model Fitmate Fitmate Pro Fitmate Med or Fitmate GS
137. l configuration on the Fitmate Med Standard Standard VO Kg vs HR VO Kg vs HR Rehabilitation Fitness Elite Rehabilitation Fitness o x E Fo 3 A E x gt AT detection is available only with maximal tests Training zones based on measured AT are available only with Fitmate Pro or Fitmate Med in the Healthy Subject configuration Legend e Printout report Standard the standard printout report Clinical a printout report with all cardiovascular and pulmonary data e Graphs VO Kg vs HR used in sub maximal tests a line shows data extrapolation to the predicted or user defined HR max VO Kg amp HR vs time shows the oxygen consumption and the HR vs time If the AT was detected calculated a vertical line indicates this value If the report is a clinical one a horizontal line indicates the predicted VO max VE amp VO2 HR vs time used only in the clinical report shows the ventilation and VO HR values vs time On the graph it a training zone is displayed indicating the MVV value and the ventilatory limitation threshold calculated on spirometry data if present or on predicteds values e Training zones Fitness Labelled Fat burning Endurance Threshold and VO Max Customisable by the user Fitness AT based See Fitness Limits are calculated from the measured AT Flite Labelled Fat burning Endurance Threshold Race Pace VO Max and
138. l the desired value is reached Set a Target iz Ei Target value amp 9 Cancel Tip you can set the target dragging the Target Line in this gauge Curl up rep anki 19 targets zo Click OK to confirm The window will accommodate the new goals to reach Repeat the operation for every test Once finished click OK to confirm The updated summary report will display on the screen 188 Fitmate User Manual Fitmate James BOND Tests of Session Opened on 12 05 2009 18 x Eile Edit View Options Window Help 8 x Bares aoan aS o Steen vy ParQ y RiskFact y Body Comp 1 Diet Han y Weight Mgmt y Cardio Fit y Std Meas yy Muscular y Flexi y Goal Ex Prescr AR ack to test lis E gt i d Summary pee Body Composition FAT 22 0 0 0_ SL Waist to Hip Ratio 110 0 97 E ee Resting Heart Rate bpm 64 0 Men lr Systolic Blood Pressure mmHg 125 0 a is ff eee Diastolic Blood Pressure mmHg 82 0 S lrzzgan _ Cardio respiratory Fitness ml kg min 45 0 00 E Push up rep 30 0 wl Nutritional Assessment oO Curup rep 20 eee aq C e Sit up rep 25 D esoe FH Leg Strength max body weight 2 25 0 00 A Upper Body Strength max body weight 1 38 0 00 f Standard Measurements Jee Flexibility cm 32 e 24 f Muscular Fitness Ready x a gt 05 w Flexibility FAT o rogram Goal WHR A Exercise Prescription Rest HR SBP d DBP d 0
139. lable call COSMED Check if the optoelectronic reader is properly connected to the proper socket of the rear panel indicated by the symbol Turb and if the arrow near the mask on the display shows the subject s respiration Wait untill this phase is completed values are displayed every breath during this phase and every 30 seconds when the test starts If this problem persists after the first minute check if the sampling tube is properly connected on the rear panel of the unit Connect the mask better to the subject s face pull the elastic strings Leaks may occur around the bridge of the nose If still leaks are detected despite the precautions adopted use cotton or gel to improve the seal Adjust the position of the optoelectronic reader Check whether the sampling line has been connected properly if not correct it Check whether the O sensor was installed as described in this chapter Ask the patient to relax and slow down their respiratory rate RF if it is to too high Check whether the mask and the reader have been properly attached in case of too low RF Check whether the HR belt has been connected properly see the dedicated chapter satruate the electrodes with a conductive solution or a salty solution to improve the detection of the Heart signal Abort the test and change the option The equipment displays zero values during test execution The green light located in the bottom rig
140. lic Rate e Activity Monitor gt Body composition Double click on correspondent icon to calculate the body composition Body Composition Chest Abdomen Thigh Case A the percentage of FAT is known Click on the box Use this value for Body Composition Fat and enter the values in the corresponding field Press OK to confirm Body Composition Chest 0 00 0 00 Abdomen 0 00 0 00 0 00 0 00 Case B The percentage of Fat is unknown and it is required its measurement Chose the measuring method 3 sites or 7 sites and then enter the measured values in their respective fields Double click on the field to have access For a better execution of the measurement follow the instructions displayed on the screen and illustrated by the picture on the left side Performing tests with the PC Software 171 Body Composition ix Technique 3 site Formula chest abdomen thigh sl 0 00 ABA ER J K J 0 00 0 00 0 00 Thigh 0 00 0 00 0 00 0 00 iagonal fold one half the distance between he anterior axillary line and the nipple men or one third of the distance between F m ae heeptenten sollen Fos ag Gates T Use this value for Body Composition Fat women zz Click OK to confirm Note The average is calculated discarding the farthest measurement Test results display Both in case A and B all the information will lay on a report once they are confirmed Fitmate James BOND Weight Mana
141. ling the devices from aerosolization and splashing of infectious material 1 Manual cleaning of the items should be done under 22 43 C water Use a neutral pH 7 mild detergent Water hardness temperature and the type of soil affect the effectiveness of the detergents the detergent manufacturer s instructions should be consulted Use a small soft brush to scrub all parts Abrasive cleaning compounds and implements can damage the items and should not be used Additional cleaning supplies may be required to clean stubborn stains or hard to reach areas 2 Items must be thoroughly rinsed with clean water to remove the detergent residuals and debris from the components Use a flowing triple rinse cycle at a minimum with tap water Please note that rinse with flowing water is not possible on the turbine 3 Dry all components thoroughly using soft clean clothes or disposable paper towels gt Disinfection The recommendations in this sections have been retrieved from William A Rutala Ph D M P H David J Weber M D M P H and the Healthcare Infection Control Practices Advisory Committee HICPAC Guideline for Disinfection and Sterilization in Healthcare Facilities 2008 http www cdc gov hicpac pdf guidelines Disinfection Nov 2008 pdf High level disinfection is the recommended decontamination procedure for semi critical devices Devices are classified semi critical when they touches mucous membranes or broken skin Examples of se
142. lthough the HR probe is properly connected During the test a warning indicates a wrong test mode 124 Fitmate User Manual The Oxygen sensor might be not installed properly or its lifespan has expired Tests do not start until the unit detects the first valid breath The first minute of the test is used to check whether the equipment has been properly setup and whether all the accessories are working fine This minute is also used to wash out the sampling line It is thus normal to detect RMR amp FeO values different from what expected at the beginning of the test The mask is probably loose The optoelectronic reader might be fixed in the reverse position the sampling tube is loosing or oxygen sensor was not properly installed The algorithm that manages the RMR test includes some automatic controls during the test execution Thus if the respiratory frequency is out of the normal range this warning messages will appear e g RF too high means that the subject is not totally relaxed The HR belt might not be connected or the electrodes of the HR Belt might have lost their conductivity thus affecting the HR detection In option it is selected Canopy while the test is performed with the mask Check whether the sensor was installed properly ensure it is tight Check in the menu utilities O2 analyzer check the sensor efficiency is exhausted remove it and replace it If anew sensor is not avai
143. ly The rehabilitation training zones menu can be accessed only if the VO Max report in Options Advanced is set to Clinical Cancel Contirm Min 07R Max 0O7R Very light 10 Select this field to set the training zones percentage of VO reserve to obtain e very light physical activity e light physical activity e moderate physical activity e heavy physical activity Values to be entered are the minimum and maximum percentage of VO reserve for each zone Please note that the minimum values for the zones after the first zone are automatically calculated starting from the maximum value of the previous zone and cannot be modified Elite training zones Fitmate Pro only Cancel Contirm Min O2Maxn Max o O2Max Ideal training zone For optimal Fat burning low intensity Specify the criteria as a percentage of measured YO2rmax Select this entry to set the training zones percentage of VO max to obtain e optimal fat burning e endurance training e anaerobic threshold improvement e Race Pace e VO max improvement e Supramax reserved to experienced and top athletes Fitmate Operation 51 Values to be entered are the minimum and maximum percentage of VO max for each zone Please note that the minimum values for the zones after the first zone are automatically calculated starting from the maximum value of the previous zone and cannot be modified gt Customize protocols only Fitmate Pro Med Fitmate allo
144. mantle the batteries in any way batteries contain different chemical substances dangerous for skin eyes mucosa etc e Store unused batteries in the original package away from metallic objects risk of short circuit and damages for the batteries e Do not put batteries into fire e Use only recommended batteries e Clean the battery poles and the battery compartment before insert new batteries Preparing the Subject Ensure the subject is healthy enough to perform the test according to the guidelines Have the subject relax in a chair or lay down on a bed KIT r DN Warning Do not place the canopy hood on the subject until the test is started Caution If the subject has recently exercised eaten a large meal or is not relaxed during the test the RMR values will likely be higher than the subject s actual RMR and the test should be repeated at a later time Caution If there is a leak during the test the results will be lower than the subject s actual RMR and the test should be epegted When monitoring HR Fitmate Pro Med only use the belt and follow the instructions below 1 Attach the Transmitter to the elastic strap 2 Adjust the strap to fit tightly and comfortably 3 Secure the strap around the subject s chest below the breasts and lock the buckle 4 Without detaching the elastic strap pull the transmitter away from the subject s body exposing the two grooved areas that are located on the insid
145. mate GS Resting metabolism with mask or canopy Cardiorespiratory fitness VO max Basic spirometry FVC SVC MVV Oximetry x option Fitness assessment Fitmate allows for the automatic generation of e Personalized weight management programs e Personalized exercise prescriptions according to the ACSM s American College of Sport Medicine latest recommendations Fitmate may be used as a medical device It can be used as an auxiliary instrument for diagnosis and prescription of pharmacological agents and or rehabilitation treatments ONLY under the supervision of a licensed physician Fitmate Med is intended exclusively for physicians or expert staff supervised by a physician Caution Federal law restricts this device to sale by or on the order of a physician 3 Warning Personal Weight Management and Exercise Prescription reports contain statements which are not intended to be used to diagnose treat cure or prevent any disease without being reviewed by a physician Any weight management or fitness program must be reviewed by a physician Attention Cardiopulmonary Fitness Assessment through Maximal exercise testing can be performed only in the presence of a physician If there is no doctor present only sub maximal exercise tests should be performed RMR tests with Canopy option can be performed only on subjects weighing 25 kgs 55 Ibs or above COSMED Srl is not responsible for any accident occurring fr
146. me Fitmate is re connected to the PC A warning message appears on PC advising user when this period is about to expire and another connection is necessary The Software version enabled on PC is that one indicated in the activation code In case of Software upgrade it will be necessary to request a new activation code from COSMED as illustrated in the section Product registration in Chapter 3 Installation Software Authorization x a This software must be authorized fitmate Please connect Fitmate to rf USB Le Fitrnate Model Change Fitmate Language IMPORTANT NOTICE You wll be requested to authorize this software again if the Fitmate is kept off line For more than 30 days Indietro Annulla You can change the Fitmate language on the unit pressing the Change Fitmate Language button Otherwise select the communication port and the Fitmate model and press Next gt to authorize the software Change Fitmate Language i x Fitmate Fitmates PRO Available languages Spanish Castilian Turkish Upload Close Select the communication port the Fitmate model and the language Press Upload to transfer the language Close to cancel the operation Installation and Activation of Software 145 Software Authorization fitmate Authorization done Thank you For using a COSMED product IMPORTANT NOTICE You wll be requested to authorize this software again if the Fitr
147. med Ergoline Ergometer communication cable Cosmed HP Cosmos USB cable mini B for Lifecorder Plus gt Heart rate parts A 661 200 001 A 661 200 002 C02636 01 06 A 661 200 040 A 661 200 039 Polar heart rate elastic belt Polar heart rate transmitter Polar HR probe Heart rate monitor Dynastream elastic belt with tx USB heart rate receiver stick Dynastream gt Calibration parts CO00600 01 11 C00311 01 20 gt Flowmeters C02500 01 04 C02560 01 04 gt Masks C03611 01 10 C03612 01 10 C03613 01 10 A 800 900 023 A 800 900 022 gt Canopy C03886 01 10 C03880 02 10 C02235 01 05 3 litres calibration syringe Silicone tube for calibration syringe RMR Flowmeter VO max Flowmeter Face mask for VO max Small Face mask for VO max Medium Face mask for VO max Large Head cap S M Head cap Large Veil Hood Turbine 218 Fitmate User Manual gt Miscellaneous C00214 01 20 A 661 115 001 C02383 01 05 A 497 900 002 A 497 900 003 A 497 900 004 A 497 900 005 A 662 150 001 C02522 01 20 C01900 01 08 C01900 02 08 C01900 03 08 A 662 150 001 A 661 110 001 Paediatric mouthpiece adapter Lifecorder Plus Medical grade battery charger with European plug Australian plug for battery charger European plug for battery charger USA plug for battery charger UK plug for battery charger Skinfold caliper O sensor removal tool Carrying case Fitmate Carrying case Fitmate Pro Carrying c
148. mended by a doctor No Do you feel pain in your chest when you do physical activity No No In the past month have you had chest pain when you were not doing physical activity Do you lose your balance because of dizziness or do you lose consciousness No Is your doctor currently prescribing drugs for example water pills for your blood pressure or heart condition No Do you know of any other reason why you should not do physical activity Ki K K K No Do you have a bone or joint problem that may be made worse by a change in your physical activity Ki Ki nd Yes DO YOU CONFIRM ALL THE ABOVE QUESTIONS gt AHA ACC CHD Risk To perform the AHA ACC CHD Risk test double click on the icon AHA ACC CHD Risk Enter the requested data and press OK to confirm or Cancel to cancel 166 Fitmate User Manual 4H4 4CC CHD Risk Questionnaire HDL Cholesterol roi Sift Total Cholesterol mg dl 190 00 Systolic Blood Pressure mmHg 120 Have you been diagnosed with diabetes no D Smoking no sl Major CAD Symptoms Io symptoms raid Family History of Heart attack Mo cardiovascular diseases of Ge CP Used For Exercise Prescription only Cancel The test report will appear on the screen Fitmate James BOND Risk stratification of Session Opened on 12 05 2009 File Edit View Options Window Help l x PAE mm eN Be ee v ParQ y Rik Fait Body Comp Diet Plan Weight Mgmt Cardio Fit
149. meters during MVV testing include the following Symbol UM Parameter MVV l min Maximum Voluntary Ventilation MVt Tidal Volume during MVV M 1 min Maximum Respiratory frequency MVVt sec MVV duration time ETC PO Performing the test Explain the manoeuvre to the patient breathe as deep and fast as possible for about 12 seconds Select the patient enter the test menu select Spirometry amp SpO2 and then MVV Ensure the program is ready for the test After having performed the test the device will display the V T graph the main parameters and the predicted values Press 0 Exit to abort the test and discard the results Press 1 Start to restart the test Repeat the test until it is correctly performed ATS recommends a minimum of 3 times by pressing 1 Start a oY ae eS eg The three best tests will be superimposed on one another in different colors On the bottom of the display the three best trials their colors and the measured parameters are reported ordered from best to worst 8 Press 2 Save amp Exit to exit and save the trial You will be asked to select which trial to store press the number corresponding to the trial to be stored 9 Otherwise press 0 Exit without saving in order to exit the test mode without saving any of the trials gt Bronchodilator test Bronchodilators may be administered during lung function studies to determine whether or not a subject s airflow obstruction is reversible Bronc
150. mi critical devices are flexible endoscopes laryngoscopes endotracheal tubes respiratory therapy and anesthesia equipment diaphragm fitting rings and other similar devices Preparing the disinfecting solution The recommended disinfection solutions are as follows e Sodium hypochlorite 0 5 5000 ppm prepared fresh for use within 24 hours e Sodium hypochlorite 1 10000 ppm prepared fresh for use within 30 days The first solution can be prepared by adding 1 part household bleach sodium hypochlorite 5 25 to 9 parts water The second solution can be prepared by adding 1 part household bleach to 4 parts water gt The turbine flowmeter Guidelines recommend that the turbine should be cleaned and disinfected prior to every test to ensure accurate measurements and to comply with recommended sanitation measures as follow Cleaning the turbine Follow the standard cleaning procedure reported above paying attention to the following 1 For rinsing do not use flowing water which may damage the turbine Rinse the turbine in a vessel filled of clean water shaking gently to remove the disinfectant Do not place the turbine under running water or move the turbine while submerged For cleaning and rinsing do not wet the sampling line 3 Use the brush point 1 step 5 only for the external parts of the turbine in order to avoid damages to the turbine blade Disinfecting the turbine 1 Disconnect the sampling tube from the reader
151. modified The duration of the test phase to discard 5 minutes by default The duration of the data acquisition phase 10 minutes by default If the test is automatically printed at the end of the test If the RMR graph must be printed together with the test results If enable disable the automatic detection of start end of the test The interval time between two consecutive O sensor calibration 6 minutes by default The respiratory quotient 0 85 by default To print all steps after a test or none When the test is over 15 minutes a new window will automatically open showing the test result and a report will automatically be printed 56 Fitmate User Manual Exit feet 2brint 2 Print all Resting Metabolic Rate Date frori dd y yyy l2 22 2005 Pb mmHg 740 STPD 0 6029 Test length mmiss 10 00 RMR FPred Ecalfdays KA 2292 L11 Automatic detection of the start end of the test If selected by the user the unit can use the coefficient of variation of Ve and RMR in order to detect the start and the end of the test even if the predefined time interval is not elapsed In this case when a steady state is reached but not before 3 minutes the display shows the following RMR Pred E Relax Ecalfday KO p sx 1964 114 Depth Freq Oo bm 15 m Breathing Pattern Steady State Achtved Skip to second phase Confirm Ignore 1 npa X i Press to confirm the start of the data acquisition pha
152. n absence of medical staff D POC F gt Execute a VO2max test The following options are available Cardio respiratory Fitness x Cardio respiratory Fitness Or Cancel Enter a value For YOZmax wo te imiikgimin DU Import a test from a XPO file available for 9 1 version Rockport Walking Test 1 mile walk f 1 5 mile Run Test E Cooper 12 min Run Test e Insert a value of VO kg if known e Import a test file in xpo format Test executed with a different COSMED equipment e Enter the value of a Rockport Walking Test walk for a mile e Enter the value of a 1 5 mile Run e Enter the value of a Cooper test 12 minutes run Click OK to confirm An overall Cardiorespiratory fitness assessment will be displayed on the screen The aspect will be different if the test is imported from an xpo file or not 184 Fitmate User Manual Fitmate James BOND Cardio respiratory Endurance Tests of Session Opened on 12 05 2009 Eile Edit view Options Window Help l x QrGy o CITIICe Be Dee Par y Risk Fact Body Comp we Diet Plan echt Mamt y Cardio Fit y Std Meas Goal RMR y Duke y EuroCvD y Bode Inde ack Co test lls Ee 4 gt gt f Cardio respiratory Fitness al Cardio respiratory Fitness ml Kg min 20 5 Cardio respiratory Fitness ml Kg min The highest value of oxygen consumption of which a person is capable Also 20 5 i n
153. n then a slow forced exhalation and finally a deep inspiration 2 Select the patient enter the test menu select Spirometry amp SpO2 and then SVC 3 Wait until the program is ready for the test Fitmate Operation 93 After having performed the test press 2 End or wait for the automatic termination 5 seconds without flow Press 0 Exit to abort the test and discard the results Press 1 Start to restart the test Repeat the test until it is correctly performed ATS recommends a minimum of 3 times by pressing 1 Start e oY E The three best tests will be superimposed on one another identified by different colours On the bottom of the display the three best tests their colours and the measured parameters are displayed ordered from the best to the worst 8 Press 2 Save amp Exit to exit and save a test You will be asked to select the test to store press the number corresponding to the trial to be stored 9 Otherwise press 0 Exit without saving to exit the trial mode without saving any of the trials gt Maximum Voluntary Ventilation Measurement of Maximum Voluntary Ventilation is commonly performed when exercise testing is also being conducted MVV measurements are used as an index of the subject s maximum ventilatory capacity The procedure consists of breathing in and out as deep and fast as possible for 12 seconds The expired volume during this 12 second period is then extrapolated to one minute Measured para
154. n email to complain cosmed it if you should have claims and or suggestions gt Charging the batteries When the batteries are low a message asks the user to connect the battery charger within the next 60 seconds to avoid the automatic switch off Press any key to cancel the warning Installation 35 OK Confirm iew Search ATTENTION BATTERY DISCHARGED Connect the battery charger within the next 60 seconds to avoid the automatic switch off Press any kev FitmateMEDwi3bi4 25 06 2008 1548 o Hoes E gx Connect the battery charger to the Fitmate unit through in the socket marked by the symbol Note Fitmate is always powered through the batteries even if it is connected to the mains If you have fully discharged batteries please charge them for at least 1 hour before operating with the Fitmate A led indicates the battery status Green led Charging Orange led Fullly charged Red led Error only old models until S N XXXXXX0999 The red led can be due to e The battery is too cold lt 5 C The red led should switch off when the battery warms up 5 45 C e The battery is too warm gt 45 C The red led should switch off when the battery cools down 5 45 C e Very low battery It occurs when the unit is left unused for long period of time The battery has almost completely discharged The led will switch to green after charging for a while Do not disconnect the Fitmate from the battery charger until the un
155. nce 119 6 Calibrate the sensor to ensure proper functionality gt Replacement A warning message will appear on the screen to advise you when the O sensor is about to expire and needs to be replaced To replace the sensor follow the procedures below 1 Turn off the Fitmate and unplug it from mains 2 Remove the cover located on the right side of the Fitmate 3 Remove the sensor connector 5 Install the new sensor paying particular care to screw it in firmly a coin may be used to turn the tool 7 Install the cover 8 Calibrate the sensor to ensure proper functionality 120 Fitmate User Manual Troubleshooting Before contacting COSMED technical support make sure that the following checks have been carried out Preliminary operation on the Fitmate Fitmate does not turn on Fitmate turns on correctly but after few seconds it turns off Fitmate turns on but the screen blank Fitmate requires an activation code and turns off if pressing the X button Although paper seems properly installed no data is printed when selecting print test Batteries are dead Batteries are dead One or more keys might be held down on the keyboard or the system needs to be reset The 30 day time period before activation has passed The printer paper might be inserted on the wrong side or the green lever of the closing mechanism might be in the open position Plug the Fimtate in and let it charge
156. nd settings describes the user interface and the initial equipment configuration language settings report heading parameters Ge Software features the features of the software on the Fitmate Performing tests using the PC Software performing a test 10 Appendix includes information about warranty COSMED legal obligations for the personal data management and information about integrated exercise protocols normal values and the reference bibliography We recommend that all users read the first three 1 3 chapters carefully before using Fitmate If the Fitmate is intended to be used as a stand alone device without a PC connection then it is recommended that chapters 1 5 be read If using the Fitmate connected to a PC read chapters 1 9 This will cover all operating modes of the device gt Conventions Hereunder reported are all the graphical and typographical conventions used in this manual Typographical conventions Represents a command or a button to press software message Graphical conventions Illustration represents Ki Icon referred to a specific function of Fitmate 20 Fitmate User Manual Introducing Fitmate Fitmate is available in the basic Pro Med and GS configurations Check in the table below for comparison of the three configurations Test Fitmate Fitmate Pro Fitmate Med Fitmate GS Ce a Pre test screening v a Resting Metabolic Rate RMR with mask or canopy Y
157. nfirm gt Paper feed Select this entry to feed the paper when loading a new paper roll 102 Fitmate User Manual gt Erase memory A WARNING Erase memory If you proceed all archived data will be lost Press sequence 3 6 9 to proceed or any other key to cancel Select this entry to erase the archive After selecting this option a warning message will appear reminding the user to press the buttons 3 6 9 quickly in order to erase the archive or press any other button to exit Warning this operation will delete all the archive Before erasing the memory be sure to store all the relevant data on an external device hard disk CD ROM USB key POPP gt Ergomanager Select this entry to verify the communication protocol with an ergometer Cancel Confirm Ergometer COSMED Bike Speed UM kmh dh Load Bu Watt dh E ergometer device You can set e The ergometer e The speed measurement unit e Theload measurement unit Press OK to confirm 1 Send Load 2 Send Speed 3 5end Grade 4 Connect 5 5top Ergobike COSMED Bike Status Actual load OW Sent Command Received Command Initialization Initialization done Fitmate Operation 103 The unit tries to connect to the ergometer It will appear a window the top menu allows you to 1 Send a load to the cycle ergometer disabled if connected to a treadmill 2 Send a speed to the treadmill disabled if connected to a cycle ergomete
158. ng Use disposable anti bacterial filters or the RMR masks or disinfect each part in contact with the patient before each test 14 Fitmate User Manual 5 Follow all the cleaning procedures described in this manual precisely and thoroughly inspect all the components of the respiratory circuit after cleaning and before each patient test 6 To avoid choking or strangulation avoid entanglement of cables or cords around the user s or subject s neck Fitmate is not an AP nor an APG device according to the EN 60 601 1 definitions and it is therefore not suitable for use in presence of flammable anaesthetics 8 Keep the device away from heat and flame sources flammable or inflammable liquids or gases and potentially explosive atmospheres 9 Fitmate is not to be handled together with other medical devices unless directed by the manufacturer 10 It is recommended to use a computer with electromagnetic compatibility CE marking and with low radiation emission displays 11 If Fitmate is connected to a PC and used as medical device PC and or printer must be EN 60601 1 compliant by means of an isolation transformer 12 Cardiopulmonary Fitness Assessment using the maximal exercise testing protocols can only be performed with a physician present In the absence of a physician only sub maximal exercise protocols may be used 13 The Fitmate needs special precautions regarding EMC It needs to be installed and put into service according t
159. ng the components per the manufacturers instructions Use the concentration testing devices sold by the manufacture to determine that the solution is above the minimum effective concentration Pour the activated glutaraldehyde solution into an appropriate sized basin Completely immerse the mask and components in the basin Assure that all channels and cavities are filled with disinfectant and that no air pockets remain within the components 5 Cover the disinfectant soaking basin with a tight fitting lid to minimize chemical vapor exposure Step 2 Rinsing Adequate rinsing must follow disinfection to remove all traces of the toxic residues of the disinfectant left on the mask and components Sterile water rinse is preferred over tap water Tap water may contain a variety of micro organisms which could recontaminate the components 1 Rinse 1 Fill a basin with 7 8 liters of water preferably sterile water Place the mask and components into the basin and thoroughly rinse all the components for a minimum of one minute Empty basin 2 Rinse 2 Fill a basin with 7 8 liters of water preferably sterile water Place the components into the basin and thoroughly rinse all the components for a minimum of one minute Empty basin Step 3 Hot water pasteurization an alternative approach for disinfection it can be performed in place of step 1 and 2 Completely immerse the device components in a hot water bath All surfaces should be in direct contact
160. nitial stage the goal is to create a strong foundation from which your exercise prescription will be developed We will focus on gradual increases in training to minimize rcise Prescription risks of injury teach proper technique and create an environment where you are able to commit to a lifestyle of training We recommend that you consult with your exercise specialist in 4 to 6 weeks to review your progress and update the exercise rescription Frequency of exercise sessions Your exercise prescription has been prepared based on days week sessions week Frequency per week 3 Warm up Duration 5 to 10 minutes A We recommend 3 warm up activity similar to the one used during the carciovascusar training Ready mmf 192 Fitmate User Manual Appendix Conformity declaration Manufacturer COSMED S r l Address Via dei Piani di Monte Savello 37 00041 Pavona di Albano Laziale RM ITALY phone 39 06 9315492 fax 39 06 9314580 manufacturer of the following equipment Fitmate Fitmate Pro Fitmate Med Fitmate GS declares under his sole responsibility that e the above listed equipment comply with the essential requirements of the Annex of the Medical Device Directive 93 42 EEC e are classified in Class lla e their design manufacturing and final checks are performed according the Cosmed s Quality System conform to ISO 9001 2008 and 1S013485 2003 Norms certified by CERMET certificates nr
161. nother test of the same type and you are trying to overwrite it with a new one coming from the Fitmate a confirmation dialog box will prompted 3 Important Notice data stored in the Fitmate will remain available until the memory is intentionally initialized with the corresponding function Utilities Erase memory Software features 161 Test printout gt Printer set up To set up a printer select File Print Setup And then select the printer gt Print preview To preview a printout report select File Print preview or click on the icon indicated here by side Fitmate James BOND Tests of Session Opened on 12 05 2009 File Edit View Options Window Help al x BS JOOUbRe Be Stampa Pag succes Pag preced Due pagne moenda Riduci i 5 Fitmate Wellness Technology i W i aL i ast Name BOND Age 42 Membership First Name James Height cm 180 00 Report Date 12 05 2009 Gender Male eight 80 0 Personal Trainer Our ae ization would like to thank 5 for amoa in this fitness evaluation SE Ge results are as follows Fitness Index COLL Sg Overall Fitness Index calculated as the average of all the tests Very Poor Poor Fair Good Excellent Superior erformed in the current session P vs Body Mass Index Kg m 2 OLA Dr Body Mass Index BMI is calculated by dividing the body weight Under w Normal Overw Obesity I Obesity II Obesity 11 in Kilogram
162. ntities from the current day to be pasted into another day e Paste Day It pastes all the food of a previously copied day e Save as template It saves the current Weekly Diet Planner as a template for another subject e Load template It loads a previously saved Weekly Diet Planner for the current subject Once completed press OK to confirm or Cancel to abort e Another useful tool for the database management can be found in the Food search dialog box Here it is possible to Add a new food Add food Clicking on this button it is possible to add a new food into the database 180 Fitmate User Manual Add or Edit a Food TIP Use Food Group 0000 Favorites to Build a list of favorite foods Food Group Ok SEN Cancel Description Primary unit of measurements Secondary unit of measurements Al nutritional values are For 100g of Food WatertoflOOo Enerogatkcal 1 Oo Drot O 10D00 Fatig 100q Carb fg 100g Fibersfg 100q Sugarig 100g Calm 100g Feimo 100g Momo 100g Ping 100g equivalent to grams 0 000 equivalent to grams In Kool 100g MNaimgi 100g Vik Ctmg 100g Wit Betas 100g Vit Bl2tme g 100g Wit ACTL 100g Sat Fatig 100q Acids monouns tg 100g Acids polyuns fg 100q Cholest omg 1 00g Refuse E Select the food group the food description the units of measurement up to 2 and its nutritional facts It is also possible to edit the existing f
163. o ensure it is properly installed See the O sensor section of this chapter Check the efficiency of the O cell in the O cell menu If the analyzeranalyzer is exhausted replace it Check if the optoelectronic reader is properly connected in the proper port on the rear panel indicated by the Turb and if the arrow near the mask in the display follows the subject s respiration Wait untill this phase is completed values are displayed every breath during this phase and every 30 seconds when the test begins If this problem persists even after the first minute check if the sampling tube is properly attached to the rear panel of the unit Secure the mask better either by moving the mask or by tightening the elastic straps Leaks commonly occur at the bridge of the nose Have the subject tell you if they feel air escaping into their eyes If the problem persists you can use Adjust the position of the optoelectronic reader Check whether the sampling tube has been attached properly if not correct it Check whether the O sensor was installed as described in the specific chapter Check whether HR belt has been attached properly see the dedicated chapter eventually saturate the electrodes with a conductive solution or a salty solution to improve the detection of the heart rate signal a Make sure that the probe is far from possible interfering sources monitor telemetry devices electrical cables mobile
164. o the EMC information provided in the EMC section 14 Mobile devices i e cell phones and other RF devices may cause interference with the Fitmate 15 Only use the cables and accessories supplied with the Fitmate Unauthorized accessories and cables may cause equipment malfunction 16 Fitmate should not be used adjacent to or stacked on top of other equipment If it is necessary to stack the Fitmate ensure that the equipment is working properly before subject testing 17 Disconnect the battery charger from the wall socket in order to disconnect the device from the mains 18 Graphical symbols hereinafter used in accordance to the present specifications are described here below Equipment type BF EN60601 1 OFF ON Alternating current ai O Refer to the instructions for use gt Contraindications for Exercise testing Absolute contraindications Acute MI within 2 days High risk unstable angina Uncontrolled cardiac arrhythmias causing symptoms of hemodynamic compromise Active endocarditis Symptomatic severe aortic stenosis Decompensated symptomatic heart failure Acute pulmonary embolus or pulmonary infarction Acute noncardiac disorder that may affect exercise performance or be aggravated by exercise eg infection renal failure thyrotoxicosis e Acute myocarditis or pericarditis e Physical disability that would preclude safe and adequate test performance e Inability to obtain consent Relative
165. obic threshold secaisssccecasssincdsoaseneddaedessnsderdesausedeuesansdinnsassanswesussadonssasterohoaagouedcbeboseeonasensas 82 E P IMOUCN EMET I Mee 84 Table of contents 5 AR Tu e TN TC Rei CR 85 Muscular Fitness Fitmate Pro Only csccssccsssccsscesccesccecccscccscccsccusccusecesccusccusccecccsccesccusccesscesccecccnccesccesccusccesscuscsesceess 86 gt POSE CXECULION ANG data CNti y sericis A E A 86 Evaluation of flexibility Fitmate Pro only ssssesessesssecsessssosecseecsecseccssosecsescsecsescsecsecsssosecssecsecsescssosecsssosecsescseosesssecseese 87 gt Test E ENK EE ge EE 87 Energy expenditure during exercise Fitmate Pro Only csscccssccsssccsscccssccnscccscccnscccssccscccnscccscccescccssccnscccssccuscccesceenss 88 E e E A A A E A E E A A saeco E A A A E E E E E A T 88 e Perr EE 88 Initialization of the Unit E 88 EEN US es EE 88 SC SNS EE 90 ef ale bec EEN 90 P Printout INCE DIelAtiON BE 90 Spirometry test Fitmate Med ONY BE 91 gt Contraindications for the performing SPIrOMEtry ccccsccsccecccsccsccecccscceccesccscceccescescceccescescceccescescceccescesscecceses 91 Absolute contraindications cccccesecccceseccceeecccceececeusececauecceceuececsuseceseueceeseneceseueceeaueceesenecessusecessuecessegecetsuneeeeaes 91 REI ALIVE CONE le Ve Ol EE 91 gt Contraindications for Bronchial Provocation testing ccsccccccsccsccecccsccsccecccscceccesccsccnccescnccnccesc
166. of the screen Then enter the results in the respective fields If a zero is entered in a field this value won t be showed neither in the test results nor in the printout Cancel Confirm Muscular Endurance Push uplrep LG Curl uptrep E it upirep EN Muscular Power Lower Body Reps 1RM or est H Lower Body Lifted WeighttkKg IS eS Upper Body Reps CID or est H Upper Body Lifted Wwreightikg ES pe The maximal number of push ups performed consecutively without rest is counted as the score Rest is allowed in the up position only Not suitable For subjects at risk obese or elder For the Muscular power section measurements can be performed in two different ways 1 With a single repetition maximal measurement by entering 1 in the Reps field and the maximum weight lifted in the field Lifted Weight With maximum 9 repetitions sub maximal measurement entering the number of repetitions in the Reps field and the weight lifted in the field Lifted Weight The weight lifted must be the one that the subject cannot perform another repetition be Press X to cancel or OK to confirm the report of the measurements will appear on the screen Exit 1 Test 2 Print 3 Print all hh Muscular Fitness Ey Gu COMP Date frorni dd y yyy i2i2s 2005 z Se Push uptrep 16 E EN BALANCE Curl upirep 32 FIELD TEST Sit uplrep 20 AMET T Lower Body Lifted Weightikg 155 Lower Body Reps I
167. oll in the paper compartment Insert one end of the roll in the slit indicated by the 2 grey guides under the green lever 4 Lower the green lever 5 Select 4 Utility 5 Paper feed from the menu The equipment will then feed the paper If this does not happen double check that the paper has been installed properly a CG 6 Close the orange or green cover paying attention that some of the paper is outside the Fitmate gt Test printout 1 Choose the test to print from a test session 2 Select 2 Print or 3 Print all to print out an individual test or the entire test session If the paper is missing or the printer head green lever is raised an acoustic signal and graphic warning warns the user and the Fitmate automatically aborts the print job To correct this ensure that the paper is installed correctly and that the printer head green lever is down 100 Fitmate User Manual Additional functions of Fitmate Some functions allow the user to customize the unit and are only accessible from the menu 4 Utility gt Flowmeter calibration This function allows the user to calibrate the flowmeter correcting the errors caused environmental changes that may affect the turbine repeated use obsolescence etc For the details see the related section in the chapter Maintenance gt O analyzer check This function allows the user to verify the efficiency of the O analyzer and when necessary program the repl
168. om a wrongful use of this device such as e use by unqualified people e disregarding the intended use of this device e disregarding the hereunder precautions and instructions gt Warnings The recommendations and the warnings hereinafter mentioned are in accordance with the most recent accepted international standards Make sure that local laws do not apply further restrictions The device the program the algorithms and the presentation of measured data have been developed in accordance with the recommendations developed by internationally accredited organizations ACSM WHO AHA All of the relevant references can be found in the Appendix Read the following precautions before using the device 1 This user manual is part of the device and should always be available for reference 2 Safety measurement accuracy and precision can be assured if e only accessories described in this manual are used Other accessories may cause malfunction e all repairs are performed by an authorized COSMED technician e the environmental conditions and the power supply must be in compliance with this manual e ordinary equipment maintenance inspection disinfection and cleaning are performed as recommended 3 Before powering on the system check the power cables and plugs If a visual inspection reveal electrical or mechanically damaged parts they must be replaced immediately COSMED 4 Aspiration of contaminants can be potentially life threateni
169. on 1998 97 1837 1847 DeLong Frank E Harrell Jr Lawrence H Muhlbaier and Daniel B Mark Leslee J Shaw Eric D Peterson Linda K Shaw Karen L Kesler Elizabeth R Use of a Prognostic Treadmill Score in Identifying Diagnostic Coronary Disease 1998 98 1622 1630 Circulation Celli BR Cote CG et al The Body Mass Index Airflow Obstruction Dyspnoea and Exercise Capacity Index in Chronic Obstructive Pulmonary Disease N Engl J Med 2004 350 1005 1012 Canopy Energy Expenditure and Fuel Selection in Biological Systems The Theory and Practice of Calculations Based on Indirect Calorimetry and Tracer Methods M Elia G Livesey World Rev Nutr Diet Basel Karger 1992 vol 70 pp 68 131 Nutritional assessment in Critical Care a training handbook Donald C Zavala 220 Fitmate User Manual Exercise Physiology energy nutrition and human performance William D McArdle Frank Katch Victor L Katch Oximeter National Lung Health Education Program NLHEP Guide to prescribing Home Oxygen By Thomas L Petty ERJ 2004 23 932 646 ATS ERS Task force B R Celli W MacNee committee members Standard for the diagnosis and treatment of patients with COPD A summary of the ATS ERS position paper Appendix 221 222 Fitmate User Manual
170. on and then a maximal forced exhalation Select the patient enter in the test menu select Spirometry amp SpO2 and then FVC Wait until the program is ready for the test After having performed the test press 2 End or wait for the automatic test termination 5 seconds without flow Press 0 Exit to abort a test and discard the results Press 1 Start to restart the test Press OK to confirm or X to cancel Repeat the test until it is correctly performed ATS recommends a minimum of 3 times by pressing 1 Start Ge EE ee EE The three best trials will be superimposed on one another identified by different colours On the right side of the display the three best trials their colours and the measured parameters are reported ordered from the best to the worst 9 Press 2 Save amp Exit in order to save and exit a test You will be asked to select the test to store press the number corresponding to the test which you would like to be stored 10 Otherwise press 0 Exit without saving in order to exit the test mode without saving any of the trials gt Slow Vital Capacity The Slow Vital Capacity measurement is an important tool in the assessment of COPD Chronic Obstructive Pulmonary Disease Parameters obtained during SVC tests include the following Symbol UM Parameter Vt ti Leer Vt ti ratio Performing the test 1 Explain the manoeuvre to the patient breathe at rest when instructed perform a maximal inspiratio
171. on of Software 143 Operating Systems and on the PC configuration please refer to your network administrator if you experience troubles in sharing folders During the installation procedure on the other PCs be careful to select the exact archive path in the server PC Cosmed Fitmate Installation Installation Folder Ioj x Choose Install Location Choose the Folder in which to install Cosmed Fitmate Choose Archive path HW alberbod Archives Browse Space required 0 0KB Space available 36 266 Gosmed Software Installation lt Back Install Cancel ELLE Important notice Be careful each PC both the server one and the other ones has the same rights in order to read write and modify the archives Remember that each installed software on each PC must be authorized at least every 30 days by connecting an activated Fitmate gt Run the software Once the installation is terminated click on the icon Fitmate from the menu Start Cosmed to run the program Software runs automatically when Fitmate is connected to the PC if selected in Options Setup Alternatively 1 Select from the Windows start menu select Start program Cosmed 2 Click on the Fitmate icon 144 Fitmate User Manual Activation of SW PC Software program is automatically activated when connecting a Fitmate previously activated This activation expires after 30 days but it is automatically renewed anyti
172. on of the device The purpose of cleaning and rinsing is to remove all adherent visible soil to reduce the number of particulates and microorganisms and to reduce the amount of pyrogenic and antigenic material Any organic material lubricants or residual cleaning agents remaining on a device can inactivate liquid chemical disinfectants sterilants as well as protect microorganisms from destruction The second step in decontamination is the microbicidal process which is defined as a process to provide a particular level of microbial lethality kill COSMED components are classified as semi critical items which are devices that come into contact with intact mucous membranes Semi critical devices at a minimum require a high level disinfection procedure Sterilization is not absolutely essential COSMED components require complete or partial disassembly for cleaning and disinfection It is the responsibility of the user health care personnel for ensuring that the cleaning methods recommended can be duplicated in their environment that appropriate tools and replacement parts are available and that instructions are followed correctly gt Cleaning Note Please refer to additional specific cleaning instructions for the turbine assembly below Cleaning Agents supplies Mild detergents with a neutral pH 7 are recommended for cleaning Use warm water 22 43 c with the mild detergent To be effective cleaning agents must assist in the remov
173. onfirm Cancel 03 15 HR bpm 104 54 HR mar VUL rol kKoairmin EEN bpm rali rnin ate Specdtrade Ve RI Press OK to confirm A new window will automatically open up showing the test results 82 Fitmate User Manual Exit 1 Test 2 Print 3 Print all E o2mMax Cardio Respiratory Fitness Date fdd roirm yyyy 2506 2008 Test type Maximal Ergometer Treadmill not interfaced Exercise protocol Modified Bruce Test length mmss 06 45 Functional Capacity METS 12 AT ml Kg min 71 5 AT O2Max t 49 YO2 mlika rnin 43 6 174 Gin Pred Fitmate Operation 83 gt Printout interpretation Three kinds of reports can be printed with Fitmate depending on the device type Fitmate Pro or Med and its configuration Healthy Subject or Clinical The reports are presented according to the following table which summarizes their features Fitmate MED Fitmate PRO Healthy Subject Clinical Printout report Standard Results l Fitness interpretation AT detection enabled Printout report Standard Clinical Standard l VO Kg amp HR vs time Graph VO Kg amp HR vst VO Kg amp HR vs t VE amp VO gt HR vs time SE Fit AT based o w AT Fitness AT based Rehabilitation degen ges Training Elite AT based zones D wie D D D Resul Se Se Fitness Rehabilitation Fitness Interpretation To obtain the clinical report it is necessary to perform a maximal test with clinica
174. onment near noxious fumes or heat sources e Do not store near heat sources e While performing exercise tests ensure that there is adequate room around the subject e Useina well ventilated room 16 Fitmate User Manual EMC Guidance and manufacturer s declaration electromagnetic emissions The device is intended for use in the electromagnetic environment specified below The customer or the user of the device should assure that it is used in such an environment Emissions test Compliance Electromagnetic environment guidance RF emissions Group 1 The device uses RF energy only for its internal function Therefore its RF CISPR 11 emissions are very low and are not likely to cause any interference in nearby electronic equipment RF emissions Class B The device is suitable for use in all establishments including domestic CISPR 11 establishments and those directly connected to the public low voltage T EE Class A power supply network that supplies buildings used for domestic purposes Voltage Fluctuations d Complies Flicker Emission IEC 61000 3 3 Guidance and manufacturer s declaration electromagnetic immunity The device is intended for use in the electromagnetic environment specified below The customer or the user of the device should assure that it is used in such an environment Immunity test Test level Compliance level Electromagnetic environment guidance 1EC60601 1 Elect
175. ons duration speed grade Leg cycling Sessions duration watt Arm cycling Sessions duration watt 176 Fitmate User Manual Stepping Sessions duration rate step height Other Sessions calories If more than one exercise is performed or it is performed an exercise not included in the above list it is possible to indicate other and its caloric cost The windows will update with the latest information entered Goals j Click on My Goal to define the goal to reach Gi Personal Weight Management E xj Activities Kg per week 0 5 Desired Body Weight 70 5 BMI Target Next check 4 wesks sl Height cm 180 00 Weight Kg 30 0 Lefa BMI kgim2 24 7 Cancel Weight Plan Graph Flan reminder i Estimated weight 14 hours a day of Very light activity 100 Ideal weight loss 2 hours a day of Light activity 5 3 epes per week of 45 min each of Walking at Speed 6 00 kmh an 104 rerasan hed s0 nena kcal 22105 2009 27 06 2009 03 08 2009 09 09 2003 16 10 2003 h 5572 kcal Type the goals in the blanks e Weekly weight loss recommended within the range 0 5 1 Kg e Desired weight as alternative it is possible to enter the desired BMI e Time interval for the next check Click OK to confirm The windows will update with the latest information entered Performing tests with the PC Software 177 Personal Weight Management e p Activities kx Please sele
176. ood groups or add new ones by clicking on the Manage Groups button Add or Edit a Food Group i X Select the Food code to edit or enter a new code to add a Food group to the database Food Code r chew Groups Description 0000 0100 oz00 o3500 o400 UDO e Edita food Edit food Clicking on this button it is possible to modify the current food into the database The dialog boxes are the same as in the Add food case e Delete a food Delete food Clicking on this button the current food will be deleted from the database Be careful since deleting a food all the diets with a reference to this food will be altered In this way it is possible to customise or at worst replace the food database gt Activity monitor The activity monitor test allows to monitor the activity during the past days up to 60 days It is enabled only connecting the Lifecorder Plus code A 661 115 001 to a PC running the Fitmate software 3 Attention Only the Lifecorder Plus which is compatible with Fitmate software works properly with the Fitmate Other Lifecorder Plus devices don t communicate with the software and cannot be used with the Fitmate Please refer to COSMED to purchase a Lifecorder Plus compatible with Fitmate software As soon as the test is started it checks if a Personal weight management test was performed in the current session since some useful data are gathered directly from this test However it
177. operly connected to the hood Remove the hood and end the test No HR values appear on the screen although the HR probe is properly connected The HR probe is properly connected but the displayed values are wrong During the test some steps shows zero values During the test the green led in the lower right corner of the display turns on occasionally At the end of the test the printout shows only the final results and it doesn t show all the steps The HR belt might not be connected or the electrodes of the HR Belt might have lost their conductivity thus affecting the HR detection Perhaps some iterferences occur If during a test invalid steps are detected e g insufficient data these are discarded from the final calculation and zero values are shown During the test automatic air calibrations are performed every 6 minutes this value can be modifed in Options Advanced The all step printout is not enabled Check whether the HR belt has been connected properly see the dedicated chapter satruate the electrodes with a conductive solution or a salty solution to improve the detection of the Heart signal Try to place the probe away from interference sources such as monitors mobile phones electric cables Continue the test without problems the final printout will point out these steps Continue the test without problems The sampling line must not be removed during the au
178. p Diet Plan Weight Mgmt 4 Cardio Fit yy Std Meas A Goal RMR y Duke y EuroCYD y Bode Inde ack to test lis e DESEN gt 4 gt Z Summary l D Waist circumference cm 110 ae Gei Session Information Cl Risk stratification T Nutritional Assessment w Spirometry amp SpOz GH Cardio respiratory Fitness Waist to Hip Ratio Rank 20 High Risk 1 10 WHR is the circumference of the waist Standard Measurements z divided by the circumference of the Moderately High High Risk s lt 0 90 0 90 1 00 gt 1 00 dh Program Goal Resting Heart Rate bpm EES 64 Number of heart beats per minute measured at rest HR can be improved Excellent a a 47 54 54 60 ae ez Systolic Blood Pressure mmHg Highest value of blood pressure occurs Rank 42 wen heart muscle contracts and 125 pumps blood out into arteries BP can Optimal ae Sty 1 Hypr Stg 2 Hypr Stg 3 be controlled by reducing intake of salt Eege 130 140 140 160 160 180 performing adequate aerobic exercise reducing body weight avoiding smoking and stress Diastolic Blood Pressure mmHg Rank 44 4 D 4 gt Ready mmf 170 Fitmate User Manual Nutritional assessment To enter the nutritional assessment click on Nutritional assessment from an open session menu and then select one of the following options e Energy balance e Weekly Diet Planner e Body composition e Resting Metabo
179. pass across the face of the subject and mix with the air being collected by the transparent hood over the subject s head The flow rate measurement system will calculate the oxygen consumption and the Energy Expenditure gt Warnings and recommendations 1 Do not measure a comatose or incapacitated patient with the canopy 2 Constant attention by a qualified individual is required whenever a patient is measured with the canopy Problems in delivery of fresh gas may pass unnoticed in spite of alarms Use a pulse oximeter to ensure that the patient is sufficiently oxygenated 3 Verify before and during the test that the Fe0O2 falls within the range 19 50 20 25 and adjust the flow selector on the blower as necessary If the FeO2 is too low you should rotate the selector counterclockwise if the FeO2 is too high rotate the selector clockwise A low Fe0O2 could be dangerous for the patient while a high Fe0O2 may result in unreliable measurements After having changed the selector position please wait at least 30 45 seconds in order to visualise the variations 4 Do not place the canopy hood over a patient s head before powering on the unit and applying a continuous flow from the canopy blower 5 Do not obstruct the ventilation holes on the canopy blower gt Setting up and RMR test Preparing the Fitmate 60 Fitmate User Manual 1 Insert the green connector 1 into the Flow connector on the rear side of the Fitmat
180. pieces tubing breathing valves or interior spirometer surfaces Gloves should be worn when handling potentially contaminated equipment if the technician has any open cuts or sores on his her hands Hands should always be washed between patients Cross contamination To avoid cross contamination reusable mouthpieces breathing tubes valves and manifolds should be disinfected regularly Mouthpieces nose clips and any other equipment that comes into direct contact with mucosal surfaces should be disinfected or if disposable discarded after each use Only the portion of the circuit through which rebreathing occurs must be decontaminated between patients or if disposable discarded after each use Disposable sensors when appropriately used avoid the need for decontamination of sensors and mouthpieces Tuberculosis In settings where tubercolosis or other diseases that are spread by droplet nuclei are likely to be encountered proper attention to environmental engineering controls such as ventilation air filtration or ultraviolet decontamination of air should be used to prevent disease transmission Haemoptysis and oral lesions Special precautions should be taken when testing patients with haemoptysis open sores on the oral mucosa or bleeding gums Tubing and breathing valves should be decontaminated before reuse and internal spirometer surfaces should be decontaminated with accepted disinfectants for blood transmissible agents Othe
181. ple of what is visible during the test The breathing rate and depth are displayed as the two vertical bars in the top left corner of the screen 1 The color indicates if the breathing rate and depth are OK green slightly fast deep yellow too fast deep red need to relax It is recommended that the subject does not watch the screen to eliminate any external influence The value of RMR and percent of predicted is displayed in the upper right part of the screen 2 The horizontal bar 3 indicates the elapsed time the first several minutes are red and are automatically discarded from the RMR calculation When the bar changes to blue an audible signal alerts the user that the data acquisition for the RMR calculation has been started The duration of each phase can be adjusted by selecting 3 Options 3 RMR The instantaneous values of Oxygen uptake VO Ventilation Ve Respiratory frequency Rf heart rate if available HR and fraction of O expired FeO are displayed in the bottom of the screen 4 The bottom right corner of the screen shows 5 an icon which becomes green during the automatic calibration of the O sensor a small mask with arrows indicating the inspiration and expiration phases and 6 an icon which shows the O sensor status during the last calibration including the ones automatically performed during the test If the user selects 3 Options see the related section of this manual the following settings can be
182. propriate subject Subject data and test sessions are respectively displayed on the bottom and on the right hand side of the screen Males are marked by the symbol Females are marked by the symbol ES Fitmate Operation 45 Exit X Exit OK Select gt Sessions lt Subjects Erase Sessions X Exit OK Select gt Sessions lt Subjects Erase Erase T 1 12 22 2005 9 coy 12 23 2005 1 _ Bond James Sji Mr 0 2 Wood Lana ID Gender Dake mm a Birthinnrni dd yyy Personal Trainer Press OK to confirm and enter the Test menu press to exit gt Deleting a subject from the archive By pressing the 0 key the selected subject will be deleted from the archive Exit X Exit OK Select gt Sessions lt Subjects OErase Sessions X Exit OK Select gt Sessions lt Subjects OErase Erase Bond James CEREO 1 12 22 2005 9 A7 Mr 0 cy 12 23 2005 1 2 Wood Lana ID Gender Erase subject Dake mm Aes Birthimm dd y Confirm X Ignore Personal Tr ainer 1 l X Press to confirm or to cancel Note Deleting a subject will not free space in the Fitmate memory gt Displaying a test in the archive Once a client is selected use the navigator tool to move through the list of available test sessions The open sessions are marked with EN the closed sessions closed are marked with B X To select the desired session and press OK to confirm or to exit Exit OK Select gt Sessions l
183. qaccecvanseetswasusaaclucceee daly auseassneuseebevewaueasleouseatceenuacibeddeateusascecueaesvens 102 A LCD COMM ASE icvscssaccansctsecsseccarciwesvanecsensndeunnedeensanevacnsnssvancsssssGdeunpaisecssocssiianessdncdnsstaneunesdeessseidessiaesvanesssssateusncdiossines 102 Prett 102 P Erase KOENEN 103 6 Fitmate User Manual k OA ee 103 HINTON MATION siscovionzesenssscannenssqancsserisesesenravensendunnendsuancssesusenesentayansndannenusdancusenueeneientavensnndannenbeeaneusenisenesentavensenaennss 104 PV ANAS SU Ree EE ee 105 gt RESCUE E 105 gt Format the MEMO ccanisrsra EE 105 E Firmware update ssranseicie inn E E E E OE O T 105 Systemi le d eNA NEE EE 108 rile ae ca litem eh cg Eer 109 TGA Iie Abie Eu d 1 TEE 111 gt Prevention OF INFECTION transmission v5 cxsscssscesvcesssveesvsosssceeveassvensvensssnsnsvteyviionseeeeveassvehsveusnsasssvueevtonseeerseassvensveueevee 111 Transmission to technicans 111 CPOS an En E en EE 111 Re e EE 111 Haemoptysis and oral ESIONS ai scinsitacosacanezvasiaseacatinsaanoesiaisinaie saaewnnesaleddieadaun onaeibaGacasuavandeenaidnaaidstemeaaidedeawenapersandeyeds 111 Other known transmissible infectious dseases 111 PISO OS WS NS TS ea cess sncetsnctan ae acgnea cc ssesas tee eaantestssacea sua saute uso AE A T 111 gt Other precautions and RECH TE 111 ET T d Le ET 112 e 112 RE le Eu EE 112 Standard cleaning procedure EE 112 E Sue eege 113 Preparing the disinfecting solution 113
184. r Speed UM kmh dh Load UM Watt dh Choose best type The test type is preset as Caloric cost Select the desired entry with the navigator tool e The ergometer used for the test if any e The exercise protocol e The units for speed miles hour or km hour and work Watt or kg m min Press OK to confirm An O analyzer calibration precedes the start of the test Start of the test Once the calibration has ended test will start automatically During the first phase no data is stored Use this phase to check whether the equipment is working properly to verify the detection of HR and to get the subject familiar with the equipment Abort 1Start Wii HIR Geen 61 33 Gm HRmax O2 ralfkegs rnin 0 00 D o Pred i4 timefmin ZIMETS oe GH est Bb er oM _ 023 at zi z0 When everything is working properly press 1 Start to start the test The test will start automatically after one minute if start is not pressed 88 Fitmate User Manual Abort Phase d EI SC End HR bpm S5 46 To HRmax During the test various parameters are displayed in real time In the top left corner of the screen 1 HR is monitored also as percentage of the age predicted maximal heart rate Below the bar 2 the numeric value of VO Kg and its percentage of predicted The graphs to the right 3 VO Kg and HR are plotted against time At the bottom of the screen a table 4 including elapsed time t Ph
185. r 3 Send a grade to the treadmill disabled if connected to a cycle ergometer 4 Connect to the ergometer if disconnected 5 Stop the communication gt Information Select this option to read the information about the Firmware version installed on the Fitmate and the amount of free used and deleted but not available memory TI OS Wellness Technology Fitmate is a division of COSHIED Srl Cosmed wwy cosmed com S N 2010091068 Fitmate MED 2 3 h2 Jan 92017 12 36 54 BootLoader wv 1 5 LAdmin Exit Pressing 1 Admin you can access to a new menu Only the item 1 Memory Status is accessible Selecting this menu item you will be prompted the following information 104 Fitmate User Manual Advanced operations gt Reset Fitmate If Fitmate should lock up a reset may be necessary It can be done by pressing the small reset button located on the bottom of the Fitmate You will need to use a pin or paperclip to press the button Resetting the Fitmate will not cause any loss of data it just restarts the internal program gt Format the memory Formatting the Fitmate s memory is possible however not recommended It will erase all data including the software installed on the unit To do this turn on the Fitmate and keep the X button pressed after releasing the on off button then release the X button It will be necessary to re transmit the firmware from the PC by selecting Options Update firmware
186. r Plus drivers p Cosmed Fitmate Installation CD emmm e VM i Choose Install Location Choose the folder in which to install Cosmed Fitmate Setup will install Cosmed Fitmate in the following folder To install in a different folder cick Browse and select another folder Click Next to continue Destination Folder C Program Files gt Space required 0 0KB Space available 119 16B 8 Select the installation folder Installation and Activation of Software 139 3 Cosmed Fitmate Installation CD Installation Folder Choose Install Location Choose the folder in which to install Cosmed Fitmate Choose Archive path Archive Path C ProgramData Cosmed Fitmate archive Space required 0 Space available 119 16B Cosmed Software Installation 9 Select the archive folder The recommended folder is the default one FO 3 Note It is not possible to put the archives in the Program Files folder when the software is installed In case the i installation program will show an error message Installare questo software di dispositivo Nome COSMED Controller USB Universal Serial Ss Autore COSMED Considera sempre attendibile il software Non installare proveniente da COSMED L E consigliabile installare solo driver provenienti da autori considerati attendibili Come determinare quale software di dispositive pu essere Installato senza pericoli Sicurezza di Windows Installare questo software
187. r known transmissible infectious diseases Extra precautions should be taken for patients with known transmissible infectious diseases Possible precautions include the following 1 reserving equipment for the sole purpose of testing infected patients 2 testing such patients at the end of the day to allow time for spirometer disassembly and disinfection and 3 testing patients in their own rooms with adequate ventilation and appropriate protection for the technician Disposable in line filters These may be an effective and less expensive method of preventing equipment contamination The use of in line filters does not eliminate the need for regular cleaning and decontamination of lung function equipment gt Other precautions and warnings Please take the following precautions during the cleaning and disinfection activities 1 The responsibility for handling cleaning and decontaminating reusable medical devices should be assigned to trained qualified individuals 2 Appropriate protective clothing gloves masks eye protection gowns will minimize the potential for personal exposure to blood borne and other disease producing organisms 3 Immediately separate and contain soiled reusable devices at the point of use and transport to the decontamination area so as to minimize risk of personal contact with contaminants 4 Adisinfectant solution is only effective if it can contact all surfaces of the items to be disinfected or sterilized
188. rend Cal Show the summary of the session already Enter in the session already closed closed Gg Show the summary of the session Enter in the session gt Modify the data of an existing subject Select a subject from the list and click on the related icon Modify any information contained gt Delete a subject from the archive Select a subject from the list and click on the related icon Software features 155 Testing session manager One or more testing sessions are linked to any subject in the archive A single testing session consists of a number of tests performed or questionnaire filled in not necessarily in the same day A single testing session cannot contain two test of the same kind The session closes up automatically and no other test can be added to that session if executing a test already performed gt Create a new session Cl Select a subject from the list and double click on the icon New session Complete the information in the dialog windows that appears HR max can be confirmed at 220 Age default value or modified in order to obtain a more accurate estimation of VO max during submaximal protocols JNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 3 Warning if medication
189. rostatic 6 kV contact 6 kV contact Floors should be wood concrete or ceramic tile If discharge ESD 8 kV air 8 kV air floors are covered with synthetic material the IEC 61000 4 2 relative humidity should be at least 30 Electrical fast 2 kV for power 2 kV for power Mains power quality should be that of a typical transient burst _ supply lines supply lines commercial or hospital environment IEC 61000 4 4 1 kV for 1 kV for input output input output lines lines Surge 1 kV differential 1 kV differential Mains power quality should be that of a typical IEC 61000 4 5 mode mode commercial or hospital environment 2 kV common 2 kV common mode mode Voltage dips short lt 5 U lt 5 Ux Mains power quality should be that of a typical interruptions and gt 95 dip in UA gt 95 dip in U commercial or hospital environment If the user of voltage variations on for 0 5 cycles for 0 5 cycles the device requires continued operation during power supply input 40 U 40 U power mains interruptions it is recommended that lines 60 dip in U 60 dip in U for the device be powered from an uninterruptible IEC 61000 4 11 for 5 cycles 5 cycles power supply or a battery 70 U 70 U 30 dip in U 30 dip in U for for 25 cycles 25 cycles lt 5 Ur lt 5 U gt 95 dip in U gt 95 dip in U for 5 sec for 5 sec Power frequency Power frequency magnetic fields should be at levels 50 60 Hz ma
190. rt rate if you arenot 100 sure of the subject s actual maximal heart rate Modifying this value without being absolutely sure of it can lead to serious consequences and cause dangerous situations e The measurement unit for speed miles hour or km hour and work Watt or kg m min e The FEV1 value Fitmate Med only is preset to the measured value if present in the current session or to the predicted value Fitmate Operation 79 Warning Maximal exercise testing for the assessment of the cardio respiratory fitness can be performed only in presence o licensed medical staff and under the supervision of a physician Sub maximal exercise tests are only allowed in absence of medical staff Warning The maximal exercise test does not end automatically For this reason it is necessary to have supervision of og physician D D POC C Press OK to confirm An automatic O analyzer calibration precedes the beginning of the test Starting the test Once the calibration has completed the test starts automatically During the first phase of the test no data is stored The purpose of this phase is to check whether the equipment is working properly to verify the detection of HR and to get the subject familiar with the equipment Abort 1 Stark Wii 33 HRmax rollkalrmip opo DU Gin Pred l4 timefmin AR Fe SC est pnh hafe P sal When it is determined that everything is working properly pres
191. s Option Setting Date mm dd yyyy G one Time mm IG Ja Language English dh Unik oF meas ern kg EI Turn off LCD gmin O Never 5 Backlight LCD Low DC Communication LISE dF Select this entry to set up date time language units of measurement display automatic shutdown backlight and PC serial port communication gt Printout settings he 7 via dei Piani di Monte Savello 00040 Rome ITALY gwa cosmediti All PWC Manoeuvres WM 4 b Select this entry to set up the printout header The following options for the spirometry printout are available only for Fitmate Med e SVC Graph shows the slow vital capacity graph e MVV Graph shows the maximum voluntary ventilation graph e QC Messages shows the quality control messages for the selected test e Diagnosis shows the automatic interpretation of the results e All FVC Manoeuvres prints all the FVC manoeuvres performed during the session 48 Fitmate User Manual gt RMR Cancel Confirm Initial discarded interwal Um Averaged interval rn End test auto print Print AMR Diagram Start End auto detection Test Mode Select this entry to set up the RMR related options e The initial time interval to discard before the data acquisition e The averaged time interval for the RMR test e Ifthe automatic print at the end of the test is enabled disabled e Ifthe print of the RMR graph is enabled disabled e If the automatic detection of the s
192. s 1 Start to start the test Note The test will start automatically after one minute if start is not pressed Test Execution Abort iRecoyery 2 Load HD bpm S5 46 HRmax CrolfKg rnin 16 9 327 Gin Pred During the test various parameters are displayed in real time e Inthe top left corner of the screen 1 HR is monitored also as percentage of the age predicted maximal heart rate e Below the bar 2 the numeric value of VO Kg and its percentage of predicted e The graphs to the right 3 VO2 Kg and HR are plotted against time e At the bottom of the screen a table 4 including elapsed time t Phase Ventilation Ve Oxygen consumption VO Respiratory frequency Rf heart rate HR fraction of O expired FeO and METS e Inthe bottom right corner of the screen 5 an icon which will become green during the O sensor calibration and change to a small face mask with arrows indicating the inspiration and expiration phases of each breath The icon becomes red when HR gt 90 of the HR selected as max HR this indicates that auto calibration has been disabled in order to avoid data loss 80 Fitmate User Manual 6 an icon which shows the O sensor status during the last calibration including the ones automatically performed during the test By selecting 3 Options user can configure e The interval time between steps 15 seconds by default e The interval time between automati
193. s by height in squared meters Obesity related lt 18 5 18 5 25 0 25 0 30 0 30 0 35 0 35 0 40 0 problems may occurs when BMI is over 25 Kg m 2 Waist to Hip Ratio ranks 20 igh Risk ea UIA GAR WHR is the circumference of the waist divided by the circumference ofthe hips Resting Heart Rate bpm let Number of heart beats per minute measured at rest HR can be Superior Excelent Good Far Poor Vary eer Improved with aercbic training lt 47_ 47 54 54 60 60 65 65 72 gt 72 Pagina 1 gt Print test results To printout the test results a summary or a single report select File print or click on the icon indicated here by side 162 Fitmate User Manual Export import tests With Fitmate you can import or export tests in order to interchange data with other PC gt Export tests To export a test select a test left click in the test window and select File Export Select the directory and the file name and confirm The test will be exported in xp3 format Cosmed proprietary gt Export RMR and Caridorespiratory Fitness Tests in text format txt The steps of RMR and cardiorespiratory fitness tests can also be exported as txt files Left click in the test window and select File Export steps or right click in the test window and select Export steps Select the directory and the file name and confirm The test steps will be exported in txt format and can be vi
194. s for BP HR are assumed reduce HR max by at least 20 bpm Session information Ei James BOND Sessions and Trend Height cm 01 010 Weight Kai 0 0 Cancel HR Max bpm 179 Test conducted by Stage initial stage E Condition Sedentary b gt Open an existing testing session Bg Select a subject and double click on the icon Opened to open an existing testing session pl 7 The new window will display all the tests executed in that testing session Fitmate James BOND Tests of Session Opened on 12 05 2009 J E x File Edit view Options Window Help l x ony lt bk z N p a Sal SAS Gonna Q v ParQ y RiskFact y Body Comp Diet Plan y Weight Mont y Cardio Fit y Std Meas y Muscular y Flexi y Goal Ex Prescr RMI Back to test list gt 4 D 2 Notes wi Session Information Cal Risk stratification ww Nutritional Assessment wy Cardio respiratory Fitness FAT 22 0 w Standard Measurements Push Up 30 5 Curl Up f Muscular Fitness Sit up w Flexibility Leg Strength 2 25 mg Upp Strength 1 38 ei Program Goal Flexibility A Exercise Prescription v02 Kg 45 0 ery Poor Excellent Superior The summary will sum up all the tests performed and the respective value measured the bars have different colours to better individuate the fitness level If a session does not contain any test a blank summary will appear The s
195. sauraR anes 159 Download Ee 160 TSO DUNG r r rA reyinat nish pian nausblevinabonneqiena sel loninen sieves paeley nan vierieanenees 162 8 Fitmate User Manual a e A E A T P T A E A A E A A E A 162 P E A A A E E A E A A A A E A A A E 162 P PDEU ET sorar E E E E E E E 162 ESPERANCE 163 D gt EXPO dE 163 gt Export RMR and Caridorespiratory Fitness Tests in text format tXt cccscccsscccseccsscccsscccseccessccseccessceeeces 163 gt NID OPE TESTS cic cece resco scceraceccernnnecnosneenccnead a 163 CHENG SOE ah Peal E 164 gt Arthive Management E 164 Reorgeanizine elei 164 ERASE Tie AC MIV E A E A EAEE EE A EA S E ATIE A E N E E T 164 Backup and restore archive ene ne ee nee ee ee eee nero ee 164 gt Send SUDIECE card TO the UNINC svccccecscosseacscivcecesexusatesesvseancesesctecacbescexeancetecevesanesesseaewssseeeneuanesasenesacenesecuaateseseeeuanerese 164 De EZ ME 164 E ERGOE 164 DW PaO WE 166 gt AHA ACC CHD Risk E 166 gt Duke Treadmill score Fitmate Med Onlly sccssccssccesccesccesccecccscccsccnsccnsccesccesccesccecceccesccusccesccesscesscesceeccesces 167 gt European CVD Risk Fitmate Med only s esssssssessessessessessecseosecseoseoseossoesssesesoecsecseoseoseoseossossssssessessessecseoseoseosssee 167 gt BODE Index Fitmate Med only sessessessesseoseoseossossosssessesseoseosecseoseossossosssesoeosecseoseosecseoseossssssessessessesseoseossosseee 168 A Tun E 168 SEA Ee ET
196. se or to ignore and to continue with the first phase In the same way when the test can be ended but not before 5 minutes the display shows the following RMR Pred ME Fela Ecalfday KO cx 1955 113 Breathing Pattern Depth Freq 0 dm 15 m Enough data collected Stop the test e e Confirm Ignore bpm F 16 55 1 X Press to confirm the end of the test or to ignore and to continue the test Problems during the test execution The equipment has internal sensors which detects potential problems during test execution e g air leaks subject not adequately relaxed O not detected If a problem arises a warning message will appear on the screen The steps where the errors occur will be marked as invalid in the printout report and will be discarded from the final calculation Fitmate Operation 57 Respirazione RMR Pred E Fela Ecalfdie Sc Air leak Ba detected Volume Freg check face Resting Metabolic Rate t O2 e Rf HR Fe02 RMR mmiss milim Im Um bpm Ya kecal day 00 30 486 126 13 2 66 16 40 3386 0100 428 121 137 66 16 76 2983 0130 542 144 148 68 1650 3774 0700 460 128 142 65 1672 3200 02 30 359 117 151 61 1732 2503 0300 296 103 147 63 1756 2063 mR em Non valid steps 03 30 379 18 140 64 17 16 2641 0400 357 112 151 63 17 17 2488 a 0430 186 130 139 66 1925 1292 rm 05 00 57 120 149 65 2038 395 rm 0530 0 00 00 0 0 00
197. sesececececsesesececscsesesecececsesesecececsesesecececsesesesececseseseses 38 Interface Fitmate Med with an external ecg sessessessecsecsscsesecsecsecsecsecsecsecsccsscessecsecsecsecsecsecsecsecsssseseesecsecsecsecsecsecseeees 39 gt Powering the unit on off essesessoseesossescsserccsescoseeccssesccesesccsescoseseossescesesccseeccseseoseeecssescssesccseecoseescseesessesceseseeseee 42 dE 42 HOWO qo ag En E 42 P ROW E csiatiaysaceescevnneinevsnesussyunsen sey ce usmnestossaeueroceusernbseeeauvesueasessus un esussoseusbeaseriessusceuaiausindiereacuieiserinerssesunisanauresnts 42 Functioning principles Of the kevboard 43 ARTTEC EE 43 The main menu EIER ECK le e ET 44 ACTA TaN E 45 gt Entering a NCW SUD CCE vesssesicncacecacacasnsiicesnsanicraiensnsaansasacsenencasatuexstevaeeasasaetexsisieeeatansauenetexeanniaszausnmseousnsecessanmaeneaeaaes 45 gt View Search for a Subject in the archive cccsssscsssssossscccessccssssecessccusssecessceucssecececeussseccesecscsecseseusssesseseueseess 45 gt Deleting a subject from the AlCIIVG ewe ee ENEE ENEE NEEN 46 gt Displaying a test TEEN lU 46 e DAC D de 47 P Entering the test MenNUisiruicinanenan A 47 EEN 48 SE ge 48 lege Ee d IT 48 E ORMIR ccici verre nnccrewes an cawes cansany sea sasuconmeaiecen say ounce ananns nee ancsancsewendanaususeaneaensescenscsancseneneapossussaneannsnnde enestensanendanesauss cgmnneneee 49 ET EE 49 gt estoreckatottee EIDEN ENEE 50
198. sessecseeseessoe 190 A E E E A N A EE P AE A N E OER O NE A O A E T A AT 195 gt Warranty and limitation of liability sccsccsscssccecccsccnccecccsccscceccesccncceccesccscceccesccnsceccsccncceccsccsccescesconccesees 195 gt Return goods policy for warranty or non warranty repair ssesessesesseceeseceoseceoseceosececsececsecsosececseceoseceoseseeseceesee 195 gt Repair Service Policy sessessessecsecsesseseesessessecsecsecsecsscsesecsecsecsecsecsecsecsecsecsesecsecsecsessecsecseosessesecsecsessecsessecseeseessse 195 tee KEEN 197 Privacy INO i aUlOW scien a maa enn E 198 gt Personal data treatment ANA purposes sccsccssccscceccesccscceccesccscceccesccscceccesccscceccesccncceccesccncceccesccssceccsconccecees 198 gt HOW your personal Gata are treated WE 198 Theconsentis optional DU EE 198 e Bolder ofthe EEN 198 SEENEN EE 198 Waste of electrical and electronic CQUIPMENL ccsscsssccssccsccnsccnsccnsccnsccnsccsscesccosccnsccnsccnsccnsccssccsccesccesccescoescosseesees 199 Sate SiN COO irc ansnnenrgecen evens ceevaneetnnr eines ecient AeNeat nei 200 DOU EE 200 ENIC eege 200 eege 200 Medical Device Directive CE Mark astecsussicsmseedcastaeasaraauedsiens atossnimenooute AEN SAn ENAS EENE OKENE EAEAN 200 ENEE 201 gt PPOCOCOIS TOF CYCIG CV EOIN CLE G ee ugeegeteetteee eege 201 SUD MaXiMal protocol auto 201 Bike Ramp 10W min patients limited exercise tolerance cccccc
199. st warm up exercise recovery or a part if a marker is entered during the phase The columns for each phase indicate the phase duration energy expenditure in METS oxygen consumption ventilation mean oxygen concentration in the exhaled air maximum and the average heart rate and if a marker was entered Below the data is reported the energy expenditure in kcal for the entire test 90 Fitmate User Manual Spirometry test Fitmate Med only gt Contraindications for the performing spirometry Absolute contraindications For FVC VC and MVV tests e Post operative thoracic surgery patients For FVC tests e Severe airway instability patients with severe Emphysema e Non specific bronchial hypersensitivity e Severe gas exchange impairment total or partial respiratory insufficiency Relative contraindications For FVC tests e Spontaneous post pneumothorax e Arterial venous aneurysm e Severe arterial hypertension e Pregnant with complications in the 3rd month For MVV tests e Hyperventilation syndrome gt Contraindications for Bronchial Provocation testing Bronchial Provocation testing must be executed according to physician orders Testing is considered safe when executed properly in a clinical setting but the following contraindications should be acknowledged prior to testing Absolute contraindications e Severe bronchial obstruction decreased FEV1 in adults e Recent myocardial infarction e R
200. st result and a report will automatically be printed Fitmate Operation 65 Print all Exit 1 Test 2 Print Dakefidd rirmn yyvy l2i22 2005 PE rmHg 747 STPD 01 8110 Test length mmss 10 00 RMR Pred Ecalfdays KA 2292 A11 FO Note Always remember to turn off the Canopy at the end of the working session D PODER C Summary on test execution Here follows a table with a graphic summary on the main steps of the Canopy test Be sure to carefully read the previous instructions in order to be aware of all the warnings cautions and dangers related to the test execution Step Step 2 Description Description Cancel Confirm Initial discarded interval m t Averaged interval rr End test auto print Print RMR Diagram Start End auto detection Test Mode During this period data collected will not be used For evaluation of results Standard Measurements Spirometry amp Sp02 A Operator supervision required during the whole test Do not place hood on Subject if blower not operating WARNING AY WARNING Turn ON blower Place canopy hood Adjust blower rate according to Subject s weight Resting Metabolic Rate Body Composition E Bal Press OK to continue or X to abort PAE Press Any Key Cardio Respiratory Fitness Risk analysis Abort End Exit 1 Test 2Print 3Print all fin Canopy RMR Pred Keal day Datefdd mm yyyy 12 22 2005 E ji 107
201. stic cords Point A and B tightly in order to eliminate possible leaks The mask needs to be air tight Leaks will likely occur near the nose point C Finding the perfect fit for each subject will take practice as each person has different anatomical features which will change the adjustments that need to be made Caution If the subject has recently exercised eaten a large meal or is not relaxed during the test the RMR values wii likely be higher than the subject s actual RMR and the test should be repeated at a later time K L 3 Caution If there is a leak during the test typically the nose or mouth the results will be lower than the subject s actual RMR and the test should be repeated PECs 54 Fitmate User Manual When monitoring HR Fitmate Pro Med only use the belt and follow the instructions below 1 Attach the Transmitter to the elastic strap 2 Adjust the strap to fit tightly and comfortably 3 Secure the strap around the subject s chest below the breasts and lock the buckle 4 Without detaching the elastic strap pull the transmitter away from the subject s body exposing the two grooved areas that are located on the inside of the transmitter Wet the grooved electrode areas with saliva contact lens solution or any other saline solution Return to its original position against the subject s skin 5 After wetting the electrodes do not slide the transmitter around on your body as this can dr
202. t Subjects 0 Erase E Bond James _ 12 22 2005 9 2 Mr Q cy 12 23 2005 1 2 Wood Lana ID Gender BEAU Set Birthinnrn dd yyy Personal Tr ainer 46 Fitmate User Manual A new window which is divided in half will appear The list of the executed tests will be displayed on the left as shown above Scroll through the tests using the navigator tool Test information is displayed on the right as shown in the figure below Exit 1 Test 2 Print 3 Print all Energy Balance E RMR E BODY COMP Date fmm dd yyyy 122272005 2 STD MEAS Time Weight EN BALANCE weeks ikg Today 0 a5 Next check amp gi Goal 0 a5 gt Data editing Note It is not possible to modify or delete data in the memory of the Fitmate once the data is stored The only way to 3 clear out the memory of the Fitmate is to delete the archive for more information see the Utility chapter POPP If you would like to delete or modify a subject s data it is necessary to download the test and or archive to a PC and proceed using the included Fitmate Software see the Software features chapter gt Entering the test menu The Fitmate will automatically display the Test Menu after a new subject is entered or one is selected from the list To enter the Test Menu from the screen displaying the tests performed in a session press 1 Test Fitmate Operation 47 Fitmate can be customized by pressing 3 Options gt Setting
203. t formula for age over 18 years or Schofield formula for age up to 18 years The test section is divided into three parts e Section one refers to the test data which will be discarded and not used in interpretation e Section two refers to the RMR test data considered in the calculation e Section three summarizes the test results The columns of the first and second part indicate Column DELE t mm ss The time of the step VO2 ml min The average oxygen consumption in ml per minute during the last 30 seconds 68 Fitmate User Manual Vp l min The average pump ventilation in liters per minute during the last 30 seconds HR bpm The average heart rate if measured during the last 30 seconds FeO2 The average oxygen concentration in the hood in the last 30 seconds RMR kcal day The RMR value calculated starting from the oxygen consumption during the last 30 seconds The columns of the third section indicate Column AE t mmiss The duration of the second phase of the test VO2 ml min The average oxygen consumption in ml per minute Vp l min The average pump ventilation in liters per minute HR bpm The average heart rate if measured FeO2 The average oxygen concentration in the hood RMR kcal day The RMR value calculated starting from the oxygen consumption measured during the test Fitmate Operation 69 Body composition gt Test execution and data entry Select Body Composi
204. tart end of the test is enabled disabled e If RMR tests are proformed with mask or canopy gt Advanced This dialog is different depending on the device Fitmate Fitmate Pro Fitmate Med or Fitmate GS Cancel Confirm Cancel Confirm Temperature T at Temperature Temp Flower Temp Flower RMR Resp Quotient x100 RMR Resp Quotient x100 4uUto Cal Rate 4Ubo Cal Rate Average interval VOZmax Average interval VOZmax Test s self start time Test s self start time Print tabular results Training Zones Mode Fitness Printer Quality Normal Print tabular results VIe dd min wyyy Printer Quality Normal Date Type dd minn wyyy Prink Zones Fitmate Fitmate GS Fitmate Pro Cancel Confirm Temperaturen Temp Flowm t C RME Resp Quotient x100 4uUbo Cal Rate Average interval YO max Test s self start time YOzMax Report Clinical Print tabular results Wo Printer Quality Normal Date Type dd minn wyyy dh Prink Zones YES ar Cholesterol mmol dh Fitmate Med Fitmate Operation 49 Different settings can be modified from this menu more information is available at the bottom of the Fitmate screen e The room temperature e The flowmeter temperature we suggest to keep the value at 34 C e The default value of the respiratory quotient R if known only used during RMR test e Time interval between two consecutive automatic calibrations in minutes e The average time for data display in seconds only for V
205. ter the requested data and press OK to confirm or Cancel to cancel European C D Risk Low Risk zones are Risk Zone e Smoker no r Total Cholesterol mg dl 150 00 Systolic Blood Pressure mmHg 120 Belgium France Italy Luxembourg Spain Switzerland Portugal Cancel de Risk Zone Low risk for Belgium France Italy Luxembourg Spain Switzerland and Portugal High risk for the other Countries The test report will appear on the screen Fitmate James BOND Risk stratification of Session Opened on 12 05 2009 Eile Edit View Options Window Help l x PAE mmr CH Sakta kati v ParQ y RiskFact Body Comp Diet Han Weight Mgmt Cardio Ft Std Meas A Goal RMR y Duke y EuroCVD 4 Bode Inde ack to test lis lt gt al Risks Summary Risk Zone Low risk i Systolic Blood Pressure mmHg 120 s Total Cholesterol mg dl 150 00 w AHAIACC CHD Risk Ir Smoking No ERR A Duke Treadmill Score European CYD Risk E d The food group code is already in use mm Moderate Risk Moderate Risk Please assign a UNIQUE code to the new a NS 10 14 group A BODE Index gt BODE Index Fitmate Med only To perform the BODE Index test double click on the icon BODE Index Enter the requested data and press OK to confirm or X to cancel BODE Index xj Forced Exp Volume in 1 s Obtpei B20 Distance walked in 6 minutes gt 250 and lt
206. tered values of Blood pressure and RPE The final printout displays the final results no step by step data is printed The test is terminated normally but the value of VO max extrapolated is 0 or less than what was measured during the test 132 Fitmate User Manual Some external signal might disrupting the transmission The equipment discards all the invalid steps i e when a calibration is being automatically executed during the test the breaths are discarded from the final calculation of the averaged data An automatic air calibration is being performed every 6 minutes The frequency of the automatic calibration can be set from the menu option advanced The red signal indicates that no other automatic calibrations will be carried out from the moment it turns on to the end of test No important data are lost during the critical part of the test where the VO Max is calculated The size of the display does not allow to visualize all data The print tabular results option is not enabled The last stage of the exercise protocol was too short less that 3 minutes consequently the calculation of the extrapolated VO is wrong Ensure that the probe is as far as possible from interfering sources computer monitor telemetry devices electrical cables mobile phones These invalid values even though they are on the printout will not be used to calculate the final values Ignore this event and continue
207. test the red led flashes or the alarm beeps you should abort the test and 3 remove the hood from the patient s head This could indicate that the pump doesn t work the system is not powered 3 the blower is not properly placed the turbine is damaged or not properly inserted the ventilation holes are obstructed or another problem exists If the system is not powered the pump is being powered by the backup battery but the test must be stopped em Abnek End RMR Pred Ecaliday D 1078 2 During the test several variables are displayed on the screen The above picture is an example of what is visible during the test e The pump ventilation and the FeO are displayed as the two vertical bars in the top left corner of the screen 1 The color of the FeO indicates if the diluted oxygen concentration is OK green too high yellow need to decrease the pump ventilation too low red need to increase the pump ventilation e The value of RMR and percent of predicted is displayed in the upper right part of the screen 2 e The horizontal bar 3 indicates the elapsed time the first several minutes are red and are automatically discarded from the RMR calculation When the bar changes to blue an audible signal alerts the user that the data acquisition for the RMR calculation has been started The duration of each phase can be adjusted by selecting 3 Options 3 RMR e The instantaneous values of Oxygen uptake VO
208. the Fitmate unit gt Wizard r g It is activated by selecting File New Activity Various pop up windows will guide you step by step to the execution of a new test the modification or the printout of an existing test the download to a PC of a test performed on the unit Select the desired entry and follow the instructions displayed on video Fitmate Wizard i x Welcome to the mate Wizard From here vou can easily perform the everyday activities Choose an activity and click on Net button C Perform a new test Download a test from the Fitmate Indietro Annulla gt Documentation On line documentation for example the USDA MyPyramid guides and links to interesting web sites for example Fitmate USDA ACSM sites are available by clicking on this icon in the toolbar 164 Fitmate User Manual Performing tests with the PC Software Subject preliminary assessment To enter the Section dedicated to the Subject preliminary assessment double click on the folder Risk stratification from an open session menu and then select one of the following tests e Par Q amp You e AHA ACC CHD Risk Frammingham cardiovascular disease e Duke Treadmill score Fitmate Med only e European CVD Risk Fitmate Med only e BODE Index Fitmate Med only gt Par Q To perform the Par Q test double click on the icon Par Q amp You x This questionnaire is mandatory you cannot execute tests without compile it
209. the display follows the subject s respiration Wait till this phase is completed values are displayed every breathe during this phase and every 30 seconds when the test starts If this problem should persist even after the first minute check if the sampling tube is properly fixed in the rear panel of the unit Secure the mask betterto the subject s face pull the elastic strings Leaks will usually occur around the nose If leaks are still detected despite the precautions adopted use cotton or gel to improve the seal Adjust the position of the optoelectronic reader Check whether the sampling tube has been connected properly if not correct it Check whether the O sensor was installed as described in this chapter Check whether HR belt has been attached properly see the dedicated chapter saturate the electrodes with a conductive solution or a salty solution to improve the detection of the Heart signal Maintenance 131 The HR probe is properly connected but the values displayed are too variable The equipment displays some zero values during test execution The green light located in the bottom right bottom corner of the display turns on from time to time during the test and the indicator in ex near the small mask no longer matches the breathing rate During test execution a red signal turns on in the bottom right side of the screen Impossible to display the data concerning load and the en
210. this value has not been entered the algorithm will not calculate the value Only one exercise modality can be selected when completing the exercise section Execute the RMR test before performing the weight management program Enter a RMR value executing the RMR test the value will be automatically imported or directly typing the value Select Other if more than exercise mode are to be selected and specify the amount of calories burned for each session Cardio respiratory Fitness VO Max Fitmate Pro only It is impossible to set a HR limit value to stop the test when test is in Maximal modality The message wrong reader appears on the screen after pressing OK for starting the test The message impossible to calibrate appears during the automatic calibration phase starting before the test No values are displayed on the screen although the calibration was successful and all the accessories are connected The FeO values displayed are too high gt 19 00 when starting a test The message air leak detected check the face mask appears during the test execution The message Expired oxygen not detected check sampling tube be sure flowmeter is not reversed appears during the test execution No HR appears on the screen although the HR probe is properly connected The cardiorespiratory fitness test does not include this option when in Maximal modality To execute
211. tion TT Curl up rep Rank Value Renew OY 40 Top Por rar cod Seier 13 235 26 36 36 67 69 77 Class Horizontal bar Values Each value refers to a single parameter e g Flexibility Blood pressure Percentage of body fat etc and may be measured directly by the equipment or entered by the user Rank Rank is a numerical index between 0 and 100 that quantifies the status of a specific physiologic parameter The higher is the rank the better is the health status is as referred to that specific parameter In parameters which a higher number is more desirable the Rank refers to the percentage of population which is under the measured value 28 Fitmate User Manual In parameters which a lower number is more desirable the Rank refers to the percentage of population which is above the measured value RMR BMI WHR and risk factors are not ranked Horizontal bar The horizontal bar graphically represents the measurement performed In the PC software the horizontal bar may have 3 colors e Green indicates a positive response e Orange indicates an ordinary or poor response e Red indicates a very negative response Classes Each single parameter measured is graded on a scale which for most parameters has six steps or classes Class very poor poor fair good excellent superior The values for RMR are compared to the predicted ones calculated with the Harris Benedict equation and classifi
212. tion from the Test menu and start a test Case A The percentage of FAT is unknown and or it is necessary to measure it With the navigator tool move to the desired field Chest Abdomen and Thigh and perform all the measurements with the skin fold calliper following the instructions at the bottom of the screen The picture on the screen illustrates each of the measurements End po pr 21 ou aaa fis fo 15 ea Case B the percentage of FAT is known Enter the values in the corresponding field FAT and press OK to confirm End Viewing the results When all the fields are filled in press OK to confirm both in case A and B a new window will display the result of the Body Composition test 70 Fitmate User Manual Exit feet 2brint 2 Print all E RMR BOLY COMP Body Composition Date froni dd y yyy l2 22 2005 Chest rm 10 Abdomen rr 23 0 Thigh mmm 19 0 FAT 19 9 FAT Mass Kg 19 Lean Body Mass kg 76 Fitmate Operation 71 Standard measurement gt Performing the measurement and entering the data Select Standard Measurements from the test menu to start the measurement Perform the measurements following the instructions at the screen They are also illustrated by the picture appearing on the left side of the screen If a zero is entered in a field this value won t be showed neither in the test results nor in the printout Abork End Standard Measurements _ eS Waist c
213. tmate calibrated and all the accessories are connected The FeO values displayed are too high gt 19 00 before starting the test The message air leak detected check the face mask appears during the test The message Expired oxygen not detected check sampling tube be sure flowmeter is not reversed appears during the test execution No HR values appear on the screen although the HR probe is properly connected The HR probe is properly connected but the values displayed are too variable To execute a VO Max test you are required to use the large turbine 28 mm The O sensor might not be installed properly or totally exhausted The RMR test does not start until the unit detects the first valid breath The first minute of the test is used to check whether the equipment and accessories are properly working This minute is also used to wash out the sampling tube It is thus normal to detect FeO values different from what expected at the beginning of the test The mask is most likely loose The optoelectronic reader might be attached backwards the sampling tube is loose or oxygen sensor was not properly screwed The HR belt might be not attached properly or the electrodes of the HR Belt might have reduced conductivity effecting the HR detection Some external signal might interrupt the transmission Press X to cancel remove the small reader and connect the large one Check the O sensor t
214. tomatic calibration Enable the printing of all steps in Options Advanced Maintenance 127 Body Mass Composition Test The averaged values of the executed The calculation for average skin fold measurement with the skin fold calliper do not match the effective average of the measurements In case the body mass composition test is performed with the Skin fold calliper and with alternative equipment only the percentage of fat the screen will display and the printout will report only the Fat mass percentage measured with this alternative equipment The body mass composition test terminates soon after the first measurement with the Skin fold calliper has been entered 128 Fitmate User Manual is the following the average of the closest two measurements the outlier will be discarded The SW has been design to record and print out only one body fat percentage per body composition test The OK button has been most likely pressed after the first measurement has been entered Ignore the event and accept the value calculated by the SW In order to have n records for the same test but performed with n techniques User will have to repeat the test as many times as the alternative techniques are keeping in mind that a session terminates when the same test is repeated Use the Down arrows on the navigator tool to enter the measurements performed after the first one Press OK only after all the measuremen
215. tons to insert wariable Fields 5b Date of Birth bi ID Gd Date of Test Cl Last Mame SF First Mame oe Gender m Press the buttons in the lower section to enter one of the fields If the format selected is for example d l of the filename will be composed by lt date of the test gt space line space lt last name gt space lt first name gt This tool is very useful for network archiving data particularly when the central unit requires that the file name is formatted in a specific manner 152 Fitmate User Manual Software features Subject archive management Ki Select File Subject manager to access subject database or click the quick icon illustrated here by side A new window will allow the execution of a number of operations Subject Manager he UR Refresh this list Close this window Jh Show this window when the program starts Search by Name First Name Date of B BOND James O4 03 1967 Member ID Select or deselect the check box Show this window when the program starts if you want this window when you start the program or not gt Enter a new subject in the archive K To enter a new subject in the archive click on the related icon type in the data required and click OK to confirm Subject Information Motes Member ID First name James Last name BOND Date of birth RI 1967 age 42 Gender male
216. toolbar gt Dialog windows Typical of the windows environment is the interface with dialog box to fill in with the information requested Use of the keyboard e To move through the fields of a dialog box press Tab till the desired field is reached e Type in the field the related information with the keyboard e Press enter to confirm the information or Esc to quit the window Use of the mouse e To access a field of a dialog box with the mouse left click when the mouse pointer is on the desired field and then type the information e Click OK to confirm the information typed or Cancel to quit the window e The right button of the mouse allows the execution of the main operations and it is sensible to the active window modify print etc 148 Fitmate User Manual gt Scroll bars Some dialog windows have a scroll bar that allows the visualization of the information exceeding the space available e To move through the bar click on the arrows located on the bar gt Help on line Pressing the F1 button or selecting the from the menu Help On line Help operator accesses the user manual Tips Helpful tips are displayed if selecting Help Tip of the day from the menu The equipment may be configured to have the tips automatically shown at the start up gt Version of the program To view information about the software select Help About Fitmate About Fitmate Ei About Fitmate xj Fitmate w 2 0 build 15 Fitmate w 2
217. tory fitness VO2max to start the test The interface will be different depending on the device used Fitmate Pro or Fitmate Med Cancel Confirm Cancel Confirm T est type Maximal T est type Waximea E rgometer Other not interfaced Mk E rgometer Other not interfaced Ge E xercise protocol N one Mk E xercise protocol N one Mk End of test HR SHR iia End of test HR SHR iia HRmax bpr ma bpr Speed UM kmh Mk Speed UM kmh WK Load UM Watt WK Load UM Watt Mk Casse test type Fv UL EES Fitmate Pro Fitmate Med Select the desired entry using the navigator tool e Type of test maximal sub maximal energy expenditure For the test of energy expenditure refer to the specific paragraph e The ergometer used if any and if user wants to control it by the Fitmate e Exercise protocol Bruce Ramp etc e If asub maximal protocol has been selected the reasons for stopping the test of the maximal physiological HR etc must be set as well It is recommended not to exceed the 85 of maximal HR e The maximum heart rate only for sub maximal tests This value is automatically calculated as 220 age but it can be modified by the user if necessary in order to achieve a better extrapolation of the results For example highly trained athlete may have a higher maximum heart rate while a subject who takes blood pressure medication may have a lower maximum heart rate Warning Do not modify the maximum hea
218. trongly recommends that you stop this installation now and contact the hardware vendor for software that has passed Windows Logo testing STOF Installation 6 During the installation the warning message shown above will appear if a hardware device driver is not submitted or does not qualify for Microsoft certification This is a message from Microsoft encouraging your company to submit hardware solutions for certification COSMED drivers will not impair or destabilize your computer You may choose to ignore this message and select Continue anyway Hardware Update Wizard Completing the Hardware Update Wizard The wizard has finished installing the software for Cosmed All models USB Driver Click Finish to close the wizard lt Back j Finish Cancel 7 The drivers are now properly installed Windows Vista Windows 7 The installation of the Fitmate USB drivers in Windows Vista or Windows 7 is fully automatic gt Installation of the Lifecorder Plus Activity Monitor USB driver The Lifecorder Plus code A 661 115 001 is an activity monitor useful in the Weight Management Program It can be controlled by the Fitmate software and its data can be downloaded into the Fitmate software Attention Only the Lifecorder Plus which is compatible with Fitmate software works properly with the Fitmate Other Lifecorder Plus devices don t communicate with the software and cannot be used with the Fitmate Please refer to
219. ts have been performed Standard measurement test The abdomen measurement as been The abdomen measuremtn is only entered but it is not reported in the displayed on the screen final printout The hip and waist measurements have The hip and waist values are only been entered but they are not displayed on the screen The test reported on the final printout printout shows the hip to waist ratio Maintenance 129 Weight management program When entering a weight management program the amount of calories for RMR is shown as 0 and keeps remains zero even after performing a RMR In the PC SW weight management program the amount of calories calculated by lifestyle shown in the final summary is zero even when lifestyle is specified on the proper section This amount is on the contrary correct when entering the value measured with an activity monitor or a pedometer When specifying the exercise profile into the section exercise It is impossible to select more than one exercise modality 130 Fitmate User Manual The measured RMRis automatically entered in the weight management program if the test was performed before entering the required data in the program If starting a weight management program before performing the RMR test the measured value can no longer be entered in the weight management program The calculation of the calories burned by lifestyle once specified is based on value of the RMR If
220. uaaeceessuaseeeeesaeseseessagassss 67 Average WCE aS ORO CO e gees cenbcrecntetcqamdatieneeaseetenen sau tc onieaetanenseseeaes ceeds qancant EE 68 E PLINLOUE INTEL DPETALION eege 68 Dee Compo ENN EE 70 gt Test execution EIER E CR E 70 Case A The percentage of FAT is unknown and or it is necessary tO measure it oo eeeeeeeeeeeeeeeeeeessseeeeeeeeas 70 Case B the percentage Of FAT iS KNOWN ccccccsssseccccseeececeeeuseccccueseceesaaeeeceessenseceesaeeecessauassceesaaasecessaaaeeessages 70 Vater d EE 70 SARC Ch ONS SUNN MCG A AA ania A ANAE cesta onsageg AAEN A AA E A A N PAEAN aun AN A E A A 72 gt Performing the measurement and entering the Cata sccsccssccscceccssccsccecccsccsccecccscceccesccscceccescescceccescessceccess 72 EE erte 73 E Setting up an energy Cdl ANCE siciicinidinn E 73 RIR ee 73 Fu 73 EE Eege 75 CG EE 75 Viewing the lee Ten sereine rT nno EE TE NE EAE EA 76 Cardiorespiratory Fitness Fitmate Pro Med only ccccsssccccsssccccsssccccsssecccsssecccsesecccessecccecscccceeseccceeseccceesececeeseceoeesees 77 gt Setting up of a Cardio Respiratory fitness test s ssessesesseseosececsececseceosececseceoseceosesecsececsececsececseceosececseceeseceesee 77 Fitmate Ee ld e ME 77 Subject preparation EE 77 gt Performing a VO max test EEN 79 min EHF ere Op EPS EE 79 SEENEN 80 eebe 80 Canceling PCTS tanpe E NE a 82 TONGO T E E E E E E A AE EA TA O AOO A 82 How to calculate the anaer
221. ue won t be showed neither in the test results nor in the printout Cancel Muscular Endurance Push up rep 30 Curl up ren 20 Sit up rep 25 Muscular strength is the maximal force Muscular Strength that can be generated by a specific muscle or muscle group A common Lifted Weight kg 180 of reps D measure of strength is a 1 repetition maximum 1 RM weight lifting test A 1 RM is the heaviest weight that can be Lifted Weight tkg 110 of reps 1 lifted only once It can be measured through a single gt imax 10 reps otherwise increase weight Execute the test as illustrated in the picture on the left side of the screen and described in the bottom of the screen Then enter the results in the respective fields For the Muscular strength section measurements can be performed in two ways 1 With a single repetition maximal measurement by entering 1 in the Reps field and the maximum weight lifted in the field Lifted Weight 2 With maximum 9 repetitions sub maximal measurement by entering the number of repetitions in the Reps field and the weight lifted in the field Lifted Weight The weight lifted must be the one that the subject cannot lift another time Click OK to confirm The evaluation of the muscular fitness will display on the screen Fitmate James BOND Tests of Session Opened on 12 05 2009 i E la sl Eile Edit View
222. ummary can be also displayed in another way selecting deselecting View alternate summary 156 Fitmate User Manual Fitmate James BOND Tests of Session Opened on 12 05 2009 Eile view Options Window Help B 2 a S Ki Back to test list mmary P Notes wi Session Information ER T Risk stratification E CN Nutritional Assessment a Cardio respiratory Fitness A Standard Measurements A Muscular Fitness A Flexibility A Program Goal dh Exercise Prescription Ready Ss S AMF Aa A Diet Plan wv ParQ y RiskFact y Body Comp 4 Fitness Index 59 Body Mass Index Kg m 2 24 7 Under w Normal Over w Obesity I Obesity II Obesity m Waist to Hip Ratio Rank 20 High Risk Targets 0 97 1 10 lt 0 90 Resting Heart Rate bpm Rank al 64 Excellent Good 47 54 54 60 60 65 65 72 gt 72 Systolic Blood Pressure mmHg Rank 42 OO O 123 Normal 120 130 160 180 Diastolic Blood Pressure mmHg Rank 44 4 wv Weight Mgmt gt Cardio Fit laxi 12 x v Std Meas y Muscular y Flexi y Goal Ex Prescr p RMI ts Overall Fitness Index calculated as the average of all the tests performed in the current session Body Mass Index BMI is calculated by dividing the body weight in Kilograms by height in squared meters Obesity related problems may occurs when BMI is over 25 Kg m 2 WHR is the cir
223. urned to maintain vital body lt 1834 functions Body Composition FAT 26 Rank 43 dh Resting Metabolic Rate N dh Activity Monitor 22 0 Fat is the percentage of fat Excellent eer Ae erie ey ese 12 3 16 3 16 3 19 6 19 6 22 5 22 5 26 1 Superior lt 12 3 Body Mass Index Kg m 2 Body Mass Index BMI is 24 7 calculated by dividing the body Obesity I Obesity II Obesity 1 1 weight in Kilograms by height in 18 5 25 0 25 0 30 0 30 0 35 0 35 0 40 0 squared meters Obesity related problems may occurs when BMI is over 25 Kg m 2 Estimated weight Next check 4 weeks Target weight Kg 70 5 Ideal weight loss Estimated time to target weeks 19 Under w lt 18 5 TOF Halle O D O LL 56 12 05 2009 30 06 2009 18 08 2009 06 10 2009 4 kcal Lifestyle 4 KAIRI gt Ready WM 178 Fitmate User Manual gt Weekly diet planner To calculate exactly the daily caloric intake click on the correspondent icon and fill in all the necessary information in the dialog that appears Weekly Diet Planner i E Si domenica re martedi mercoledi giovedi venerdi sabata Breakfast Smack Morning Lunch Snack Afternoon Dinner di lt Click on the icon op the left to add or remove a meal YoFrot Breakfast D 0 D Snack Morning D 0 0 Lunch D 0 0 Snack Afternoon D 0 D Dinner D D D Daily C
224. ute maximum gt Highest possible Fitmate Operation 81 Abort iRecovery ZLoad 46p SRPE OK End HR bpm 6 il Phase has 33 HRmax been changed YO2 i mli Kgimin opo D Pred a m LEE mn E a D I E a i I TIC Dun ne Zm 14 tire minj t Phase WO2 Ke RE HR FeO2METS BO EE 24 T e we 00 02 Rest LZ le ol 119 9715 It is also possible to manually adjust the load by pressing 2 Load or starting the recovery phase stopping the selected protocol pressing 1 Recovery Warning Stop the test if any of the symptoms described in the guidelines appears If not activated before the recovery phase will start when indicated by the selected exercise protocol Canceling the test To cancel the test press X Warning All the data will be lost To end a test To end a test press OK The sub maximal test will end automatically after achieving the HR capacity determined before starting the test How to calculate the anaerobic threshold At the end of a maximal test a window asks the user if he she wants to calculate the anaerobic threshold OK X Press to calculate it to cancel During anaerobic threshold calculation a window will be displayed Using the left and right keys it is possible to move the anaerobic threshold line In the lower part of the screen each parameter is displayed with its value at the AT the maximum reached value and the of the maximum value AT C
225. wiped from device surfaces with a moist sponge or towel The soiled contaminated items are then contained in a manner that will reduce the risk of personal exposure to pathogens Items are usually placed in a basket tray or rigid container for transportation to the processing area usually transported in or on a cart as hand carrying of soiled items is discouraged 112 Fitmate User Manual Step 2 Inspection Inspect the items for damage at all stages of handling If damage is detected on any of the components it should be identified and documented Complete the disinfection sterilization process and contact technical service for replacement Step 3 Presoak Protective attire is required of personnel handling contaminated items At the processing area soak or rinse the items in tap water 22 43 C Please note that rinse with flowing water is not possible on the turbine If an enzyme product is required soak for one to two minutes Remove and examine extend the soak time for components with dried on matter prolonged soaking of components may be detrimental causing damage to the component surfaces Refer to the detergent instructions for its usage and soak time Step 4 Disassembly Disassemble the item if necessary according to the instructions reported in the corresponding section Step 5 Cleaning Protective attire is required for personnel handling contaminated items Manual cleaning must be done in a manner that protects personnel hand
226. ws cutomizing exercise protocols both for bikes and for treadmills Time Phase Watt I 1 00 00 2 01 00 3 02 00 d 03 00 5 04 00 Modify 2 Print 3New Time Phase Kb Grade 1 00 00 Rest 0 ee 3 02 00 Warmup 0 4 03 00 Warmup 5 04 00 Warmu 0 Rest D Rest D Warmup 450 Warmup 20 Warmu 20 Bikes Treadmills Select the device by means of the arrows To create a new protocol press 3 Grade oO Time Phase kmh Grade kmh Rest Rest Time 1 00 00 2 01 00 Time Oo H DS 00 00 Rest 0 03 00 3 02 00 4 03 00 5 04 00 Warmu 50 Contirm Number of intervals Ss D Interval extent seconds 30 Mk Warmup Warmup Bikes Phase Rest oO 20 20 een 06 00 S ee 09 00 e S a 17 00 Rest a tapa Confirm E oF intervals 5 D I Interval extent seconds 30 Mk 5 peed LIM kmh dh EEN Treadmills D D 0 Rest D 0 Rest D 0 Oo 0 Select the number of intervals and their duration for bikes or the number of intervals their duration and the measurement unit of the speed for treadmills and press OK to confirm or X to cancel Then it is possible to modify the steps in order to complete the creation of the desired protocol To modify the selected step press 1 Grade oO Time Phase Kmh Grade kmh Rest Rest D 0 Rest 0 0 0 Time a a 00 00 a Re 03 00 3 06 00 Rest OF OF 06 00 E O E 09 00 SE a T a 17 00 Rest Reet Pace uU Confirm Phase ao Speed
227. ximum output power of the communications equipment Rated maximum Separation distance according to frequency of transmitter output power of m transmitter W 150 kHz to 80 MHz 80 MHz to 800 MHz 800 MHz to 2 5 GHz d 1 17 JP d 1 17 JP d 2 33 JP For transmitters rated at a maximum output power not listed above the recommended separation distance d in metres m can be determined using the equation applicable to the frequency of the transmitter where P is the maximum output power rating of the transmitter in watts W according to the transmitter manufacturer Notes 1 At 80 MHz and 800 MHz the separation distance for the higher frequency range applies 2 These guidelines may not apply in all situations Electromagnetic propagation is affected by absorption and reflection from structures objects and people Getting started 19 How to use this manual This manual is structured in the following 10 chapters Getting started briefly describes the Fitmate illustrates its intended useand warnings How to read the results illustrates how tests and test results are presented to the user Installation guides the end user through the entire installation process Fitmate Operation illustrates the functions of the device including managing data and test performance Maintenance describes maintenance procedures Installation and activation of software installation and activation of software eS A SS a User interface a
228. y occur in the vicinity of equipment marked with the following symbol o I 2 These guidelines may not apply in all situations Electromagnetic propagation is affected by absorption and reflection from structures objects and people Field strengths from fixed transmitters such as base stations for radio cellular cordless telephones and land mobile radios amateur radio AM and FM radio broadcast and TV broadcast cannot be predicted theoretically with accuracy To assess the electromagnetic environment due to fixed RF transmitters an electromagnetic site survey should be considered If the measured field strength in the location in which the device is used exceeds the applicable RF compliance level above the device should be observed to verify normal operation If abnormal performance is observed additional measures may be necessary such as reorienting or relocating the device b Over the frequency range 150 kHz to 80 MHz field strengths should be less than 3 V m 18 Fitmate User Manual Recommended separation distances between portable and mobile RF communications equipment and the device The device is intended for use in an environment in which radiated RF disturbances are controlled The customer or the user of the device can help prevent electromagnetic interference by maintaining a minimum distance between portable and mobile RF communications equipment transmitters and the device as recommended below according to the ma
229. y the electrodes It is recommended that the subject wears the transmitter against bare skin to ensure accurate data acquisition If the transmitter is worn over a shirt the shirt needs to be wet under the electrode area to ensure proper conductivity In order to have a good HR signal we suggest to put the HR receiver as close as possible to the HR belt If the signal is poor although the belt is properly positioned adjust the position of the HR probe gt Test execution Verify that in 3 Options 3 RMR Mask is selected Cancel Confirm Initial discarded interwal Um Averaged interval rn End test auto print Print AMR Diagram Start End auto detection Test Mode Fitmate Operation 55 Select Resting Metabolic Rate from the test menu The equipment will automatically calibrate the analyzer The test will start immediately after the calibration is over During the first phase no data is stored Use this time to check whether the equipment is working properly to verify the detection of HR if used and to get the subject familiar with the equipment Press 1 Start to start the test after you have ensured that all data collected is accurate and physiological If you do not press start the test will automatically begin after one minute Perform the test as recommended in the guidelines RMR Pred Ecalidie 3o LEY Y U20 During the test several variables are displayed on the screen The above picture is an exam

Fitmate Pro only

Contents

Download Pdf Manuals

Related Search

Related Contents