Home

User`s Manual

image

Contents

1. From Composite Video Source INPUT 2 INPUT 3 INPUT 4 O COMPOSITE VIDEO S VIDEO Z s Video Decoder INPUT 1 REMOTE CONNECT EITHER GREEN BLUE HOR COMP VERT SWITCHER RS 232 IN RS 232 OUT U COMPOSITE OR A S VIDEO TO INPUT 1 O status NOT BOTH SZ rower O I L sc J Or From S Video Source Figure 2 23 Connecting an Extra Video Source to nput 1 Optional modules from Christie allow you to increase your total number of inputs and or accommodate different signal types whether analog or digital Any one of these modules can be installed in the area labeled INPUT 2 They include RGB 500 Input Module RGB 400 Active Loop Thru Input Module RGB 400 Buffered Amplifier Input Module Composite S Video Input Module PC250 Analog Input Module Serial Digital Input Module Digital HDTV Input Module DVI Input Module originally DVI DFP Input Module Alternatively the analog interfaces 1 e non digital can be installed in a Marquee Case Power Supply or Marquee Switcher if desired for use with the projector NOTES 1 Audio ports on optional interfaces are non functional Use the projector s audio connectors labeled
2. Proj 001 Proj 002 Proj 003 o o o d D ci D D n n N il D C D d D d m 13 d Bi a D D D d n d n d D d n d D d D d n o w D D q n a n n a D d n la est B d D d D 0 LY D n d oeeo mae D cd o o o o url UuT T UT I JRS 232 Proj 001 Proj 002 Proj 003 o o o D ci D C D D d ae D D d D d Gas D d n C A CI m D C D 4 n 5 D m D C a D C D d dn TI sas ol N Cl mm D d D g M DATE 5 eee W 2 D cd o f D d n 5 d e s e e es Ol p o o o 181 url I uriTT Proj 001 Proj 002 Proj 003 o o o o c D D d m m d D a D d B gt D a l T D C T s D D 0 D 3 D D d D 2 2 D D d ol D Qd c e ol D d D q TY eee 2 ee J c 5 5 f D d Soo D d D E gt D s ll D c D uri11 h wii Use either or both network cable types RS 422 RS 232 Use either or both NOTE Programming for the RS 232 controller must be compatible with the RS 4
3. nal PROTOCOL B 321 sc ALWAYS 321 JP3 IR 321 JP4 gt WIRED KEYPAD Figure 2 36 Locating and Setting the Jumpers NOTE A wired keypad can be converted into an IR remote keypad and vice versa Follow the settings shown above adding or deleting the cable and batteries as required The cable with 3 pin XLR connector is available separately from your dealer SHORTCUT METHOD You can also issue software protocol settings through the keypad These software commands will be lost when the keypad is either unplugged or when a battery is removed the keypad will revert back to the hard wired jumper settings see above until you enter the software commands again Press Protocol A Press Protocol B NOTE If you change any keypad to a new protocol and the projector stops responding the projector may be set to a conflicting protocol Use the projector s built in keypad to access the Communications menu Under Front IR or Back IR or Wired Keypad select the protocol that matches the new protocol of the keypad at hand The projector should now respond properly w gt gt 5 gt 5 0 l l ls j US R SSS INSTALLATION AND SETUP Converting a Keypad If desired you can convert an IR remote keypad into a wired remote keypad and vice versa available Februa
4. uri11 RS 422 RS 232 p e Connect both network cable types Use controller desired RS 232 messages remain RS 232 only RS 422 messages remain RS 422 only Connect both NOTE Programming for the RS 232 controller must be compatible vvith the RS 422 controller Baud rates must be the same Figure 2 33 Tvvo Types of Split Netvvorks Each proyector can be assigned a unique 3 digit proyector number for example 001 These numbers are necessary when you are working with multiple linked projectors enabling you to direct commands to a certain projector rather than always broadcasting to the entire network For complete information on how to assign projector numbers see 3 7 Configuring System Parameters Projector Numbers NOTE To loop a single incoming video source through to another projector or display device on a network see Video Loop Through in 2 4 Source Connections Roadster Vista User s Manual 2 33 INSTALLATION AND SETTUP a a w a a CL c w a a a a a a gt gt gt gt gt gt gt gt 535 5 NN ff At manufacture every keypad is assigned A as its default protocol which is simply 2 10 Keypad Protocols and Conversion Remote Keypad Protocol IR OR WIRED KEYPAD 2 34 Road
5. 3 18 Adjusting the ar se 3 24 Configuring System Parameters 3 4 Working With he Lampa TE O Ni 3 47 Projector SCS uuu o aa T aE EATE 3 50 Using Multiple ProJectors 3 51 Fi COIN ONS calal a ar dad zonan 3 54 YUam nes and 4 1 Fi mb A 4 3 Replacing Keypad Battertles 4 3 Replacing the Lamp and Hilter 4 4 ASS AC a ENS m d 4 9 DOU TE SHO GGG u uuu uu uu u uu aeai 4 12 SpeG u au usussasakasqastapssssdhakasskuqaspaspasakaasaykaphaqpanatastespuqasisssataphaspappa 5 1 070 n anaes A 1 Keypad RoT u B 1 Mon iU uu a a O E Er 1 Serial Communication Cables D 1 uu ananassa 1 Optional Input 1 5 F 1 NOTE Due to continuing research all information in this manual is subject to change without notice 54 017115 13P Software Version 2 1 10 02 Roadster Vista User s Manual ili Section 1 Introduction Me The Vista and Roedster projectors are professional quality
6. Maximum amount of display above center of lens 128 gt 100 Maximum amount of display below center of lens 100 28 m AAA Asa 10096 above center of lens 123 4 4 6 52 gt 100 Maximum amount of display below center of lens 100 100 Figure 2 13 Maximum Vertical Offsets Continued 2 12 Roadster Vista User s Manual N INSTALLATION AND SETUP 4 7 1 VERTICAL OFFSET RANGE Maximum amount of display Standard Roadster Vista lens above center of lens 130 Maximum amount of display below center of lens 100 100 lt 4 7 1 VERTICAL OFFSET RANGE Maximum amount of display This is a Vist1GRAPH gt lens above center of lens 114 Maximum amount of display below center of lens 100 100 lt Figure 2 13 Maximum Vertical Offsets Continued ALL LENSES NOTES 1 If you cannot raise or NOTES FOR ALL LENSES lower the image enough using Maximum optical performance is produced at NO offset mechanical vertical offs ets try i e when the image centered with lens and minimum zoom Geometry focus and light output will all be optimized adjusting V Position in the Size and Position menu see 3 6 Adjusting the Image 2 If the image become
7. 4 1 o 195 101 p nse w aouejsip MOJYL su 7 1007 p Z Z oO N O O C LO 0 CN O oO TE SOOO OS m ZL 81 61 Oc k CS 62 ye GC 92 12 8z c 06 LE 66 ve Cu UIPIM u 15S 5 Roadster Vista User s Manual THROW DISTANCE l llDlm9l mC21__2 KEk FA FI Wih lt w lt wc aaa a a a a R c c wau c wc lt gt 5 558 Ove oec Ole 00 061 091 011 G 31 u 9ue1sid MOJUL 091 091 OEL C L OOL 06 08 02 09 OS OV 06 Oc 01 JUOJJ o 95 WOJJ painseaw aouejsip MOJYL sos ow 2 su 7 1002 1 1 O N LO TON O LO TON O oO mm m m i 11 81 61 02 k CC c ye Gc 92 12 82 c 06 LE c ve Cu PIM u 15S Roadster Vista User s Manual E 6 n THROW DISTANCE 061 021 OLL S 1 M 5uelsiqd MOJUL 001
8. s nb y 3 ION SUS 1002 Havas 1 06 Ge Roadster Vista User s Manual E 8 Appendix F Optional Input Modules There are many optional input modules and accessories currently available for this projector Contact your dealer for a complete and up to date listing Marquee Marquee Signal Switcher is a rack mountable signal selector which can greatly Signal Switcher increase the number of analog sources inputs available to the projector Connected 38 801050 xx to INPUT 1 a single switcher provides up to 9 more sources to the projector Additional Marquee Signal Switchers can be connected to the first with their input locations switcher slot selectable through the key on the keypad Switcher inputs can also be selected at the switcher by pressing the appropriate front panel push button or through serial communications See Section 2 BHLECTROHOME IMARQUEE SIGNAL SWITCHER 7 Marquee Signal Suvitcher Features simple connection and push button control easy to see illuminated indicators 9 slots for analog interface modules RS 232 serial interface input for a wired remote keypad universal power input up to 9 switchers can be daisy chained together with a projector co RGB500 Input Module The RGB500 Input Module may be install
9. Conversely high brightness changes black to dark gray causing washed out images See 3 6 Adjusting the Image Image Settings subsection Volume Press to control the audio level if connected Use lt and until you reach the desired volume NOTE Audio control is standard on Vista models only In other models the key does nothing Roadster Vista User s Manual 3 9 OPERATION j Y IIIKI I HI UW amp I III I4II 9T III CRkY G k NE I IW IEIE I IEI lt Y ZDIIII W I I III I w II II I I I II I E II I I A I I I I IA AAI a c 558 3 10 Roadster Vista User s Manual Projector Press when you want to access a specific proJector within a network or 1f you simply need to see if the local projector is listening The number appearing in the Enter Number window indicates which projector is currently listening to commands and will match the projector number that has been defined in its Communications menu The Projector checkbox read only shows whether or not the projector physically connected to a keypad is listening to commands from that keypad A checkmark means that connected projector is listening if there is no checkmark you are communicating with a different projector To use a specific projector enter the 3 digit number assigned to the projector you want to use Press to select press to cancel If you switch to a projector other than the
10. 115 5 125 13 135 14 145 15 155 16 165 7 _ 175 18 185 19 195 20 il 7 7 Q ol N O O gt NOTE 5 1 2 1 Lens VVidth ft 5 5 5 5 co 5 45 640 5 702 55 764 6 85 65 887 7 949 75 104 pe 13 00 85 11 35 9 11 97 95 1259 10 1321 10 5 1383 N 1445 115 15 07 _ 12 1569 12 5 16 30 _ 13 16 92 13 5 17 54 14 1816 1450 1878 15 19 40 15 5 20 02 16 20 64 16 5 2126 _ 17 2188 175 22 50 18 2312 185 2373 19 2435 195 24 97 _ 20 2559 20 5 2621 _ 21 26 83 215 2745 22 5 2869 23 2931 23 5 29 93 _ 24 30 55 Throw Distance ft 6 40 1 02 1 64 8 25 8 87 9 49 10 11 10 73 11 35 11 97 12 59 13 21 13 83 14 45 15 07 15 69 16 30 16 92 17 54 18 16 18 78 19 40 20 02 20 64 21 26 21 88 22 50 23 12 23 13 24 35 24 97 25 59 26 21 26 83 27 45 28 69 29 31 29 93 30 55 n THROW DISTANCE 9 31ON H 5uelsid MOJYL ce ce ble E c 9 le 9 582 k 2 ce IC Oc GL 8 1 OL SL TL Eb d LL OL 6 8 2 9 S L 0 JUOJJ O U H S WOW peynss ni
11. STATUS oe POWER Figure 2 16 Rear Connector Panel GREEN BLUE HOR COMP VERT SWITCHER RS 232 IN RS 232 OUT 6 D Ces 5 mam L sync l Graphics or Video Input 1 Serial Control RS 232 Roadster Vista User s Manual 2 15 INSTALLATION AND SETUP HU r wc wc F R c lt c c lt s 2 16 RGB Signals Roadster Vista User s Manual INPUT 1 provides 5 BNCs connectors for linking to a variety of sources typically to an RGB source such as VGA SVGA XGA Mac PowerMac DEC Sun SGI and others This projector supports multiple sync types with RGB signals sync on green composite sync and separate H amp V syncs NOTE Depending on the source you may need a custom adapter cable with BNC connectors at the projector end and a different type of connector at the other such as a 15 pin D connector for computer sources Contact your dealer Connect the SYNC BNC input s first Then connect the red green and blue source outputs to the RED GREEN and BLUE BNCs on the INPUT 1 panel If the source uses sync on green only the red green and blue connections are required If the source provides a composite sync output connect it to the SYNC input labeled HOR COMP If the source provides separate horizontal and vertical sync outputs connect horizontal sync to the SYNC input labeled HOR COMP and connect vertical sync t
12. Set LAMP LIMIT to the number of hours you expect to log on the current lamp before replacing it This limit typically will match you lamp warranty but consider also that actual lamp life depends on what lamp mode s you use over the life of the lamp and how much light output is desired for your application In any case when the lamp approaches your chosen lamp limit the Lamp Message if it has been enabled will appear upon power up NOTES 1 If you change modes over the life of a lamp the lamp limit you originally expected may no longer apply 2 Turning the lamp on and off can reduce lamp life significantly as will other factors Limit lamp strikes to what is necessary Set which LAMP MODE you want to use in order to control the 1 Max Brightness light output in your application Although there can be 2 Intensity exceptions in most lamps the higher the light output or power 3 Power setting the shorter the life span of the lamp Figure 3 27 Use the lamp mode that best suits your need for brightness For example you may simply need as much brightness as possible which will apply maximum power to the lamp choose Max Brightness Alternatively in a tiled application you may want to closely match and maintain brightness levels between adjacent images choose Intensity for each projector then judge by eye and set each individual intensity setting as necessary see Intensity below Or you may simply want to apply a re
13. 15A 250V NEMA 6 15P 15A 250V 700 watt Xenon short arc open 1200 watt Xenon short arc open 1700 watt Xenon short arc open 450 700 watts 800 1200 watts 1200 1700 watts any vertical angle 15 horizontal 5 minutes 1000 hours to half intensity Roadster Vista User s Manual 5 3 SPECIFICATIONS S tLllITlIq Iw ww T A Tw_ tww km Q a c lt c lt c gt lt lt lt gt lt gt gt 558 IR Control Typical range 100 line of sight IR carrier frequency subcarrier modulated 336 kHz Battery type 4 required AA 1 5 V Alkaline cells Battery life 1 yr Shelf 1 mo continuous use Size amp Weight Roadster Size W x L x H of product only no lens 27 3 69 3 cm x 30 3 77 cm x 11 9 30 2 cm Max weight of product no lens 114 Ib 51 7 kg Max shipping weight 176 lb 79 9 kg Vista Size W x L x H of product only no lens 22 3 56 6 cm x 30 3 77 cm x 11 9 30 2 cm Weight of product no lens 88 b 39 9 kg Shipping weight 147 Ib 66 7 kg 22 28 56 6 cm gt 1 6 gt lt 4 1 cm 21 25 54 cm 6 63 30 1 76 5 cm k cm do Bs ma 11 88 30 2 cm Es 7 5 19 1 cm z mk mo xZ
14. C a HII 3 82 7 1 63 m 9 7 cm 19 00 48 3 cm 5 85 4 1 cm 18 63 47 3 cm FT CNTRS 14 9 cm FT CNTRS Figure 5 1 Projector Dimensions Rosdster shown Safety C S A 22 2 No 950 M94 U L 1950 and EN60950 EMC Emissions FCC Part 15 Class A Conducted and Radiated Emissions e CISPR 22 Class A Conducted and Radiated Emissions EMC Immunity e EN55024 all parts Operating Environment Temperature 0 C to 35 C 32 F to 95 F Humidity non condensing 20 to 80 Altitude 0 3000 meters Non operating Environment Temperature 25 C to 55 C 22 F to 120 F Humidity non condensing 0 to 95 IR infrared Remote Keypad includes batteries High current AC line cord User s Manual 9 64 hex socket ball driver 4 Eyebolts Roadster only Standard Components 5 4 Roadster Vista User s Manual SPECIFICATIONS Accessories Wired Remote Keypad 2 Way Controller NOTE v1 2 or higher TWC required for CoRE v1 4 or higher IR Remote Sensor Alternate Throw Lenses see page 5 1 Roadster Hoisting Stacking Kit Universal Ceiling Mount includes Roadster Vista adapter CoRE Librarian for downloading new software Threaded lens adapter flange for installing VistaGRAPHX lenses Shutter kit for Vista Options Input Modules Interfaces RGB500 Input Module RGB400 Active Loop Through Input Module RGB400 Buffered Amplifi
15. Gamma 3 32 Geometry Menu 3 42 Global Icon 3 15 H Handles 2 3 3 2 HDTV Connection 2 22 Help Context sensitive 3 14 Help Key 3 13 Hoisting 2 3 Stacked Projectors 2 5 Horizontal Filter 3 40 Horizontal Position 3 29 I ILS 2 25 3 11 Operating Tips 2 26 Troubleshooting 4 14 Image Adjustments 3 24 Image Orientation 2 24 3 41 Image Settings 3 30 InMenu Checkbox 3 23 Input Connection 2 1 2 15 Roadster Vista User s Manual i SE G Definition of 3 18 Selecting Switching 3 18 Selection 2 2 Input 1 2 16 Extra Video Sources 2 22 Input 2 2 22 Input 3 Connection 2 18 Input 4 Connection 2 18 2 19 Input Key 3 7 3 19 Input Levels 3 36 Input Video Black 3 35 Installation Front Screen 2 6 General Considerations 2 3 Horizontal Position 2 13 Leveling 2 14 Quick Setup 2 1 Rear Screen 2 7 2 15 Room Lighting 2 8 Types 2 6 Vertical Position 2 11 Intelligent Lens System Description and Use 2 25 3 11 Operating Tips 2 26 Troubleshooting 4 14 Intensity Lamp Mode 3 49 Interfaces Optional 2 22 Interpolated 3 34 Interpolated Color 3 32 3 34 Invalid Channel 3 55 Invert Stereo3D 3 40 IR Sensors 3 4 3 45 K Keypad Guidelines 3 6 Types 3 5 Keypad Batteries 4 3 Keypad Protocol 2 34 3 13 3 45 4 13 Changing in Keypad 2 34 Conflicts 2 36 Default 2 34 3 13 Hard wired 2 34 Software Method 2 36 Keypad Built in 3 5 Keypad IR Remote 4 3 Desc
16. Offset When using certain RGB sources Blue Odd Pixel Offset 128 FEE first Then Gain H 3 wlth still Images you may need to 4 Red Odd Pixel Gain 128 M adjust the normal gain or offset of 5 Green Odd Pixel Gain 116 7777 6 il odd pixels in relation to even pixels Blue Odd Pixel Gain 128 T This will smooth out very narrow Color Enable White M 1 p xel wide checks or vertical stripes that indicate adjacent on and off pixels You can remove these patterns as follows 1 Use an external grayscale test pattern with both dark and light gray areas 2 Display the image in its native resolution select No Resizing by accessing Resize Preset in Size and Position menu 3 Display a single color choose from a Color Enable list or use the key shortcuts indicated on the back of the keypad Roadster Vista User s Manual 3 43 OPERATION wG lt wmaan gt u oxrnszli010O 1 lIUIWIIIIKI I NW I I I II I II I I I I I III lt I9I9IoO lt III I IIY lt lt e pp ls ahI _ 8 lt a h l l amp a5a5 x h X System Communications 3 44 Roadster Vista User s Manual 4 Examine an area of darkest gray but not black If there is a 1 pixel wide pattern present adjust Odd Pixel Adjustment offset for the current color Stop when the pattern disappears and the area is smooth 5 Examine an area of lightest gray not white I
17. 3 4 5 6 7 8 Figure 3 14 Size and Position Menu Resize Presets Use Resize Presets to quickly Resize Presets display an image in its native 1 Default maximize for current source resolution including 2 No Resizing display in native resolution anamorphic or to 3 Full Size fill the screen regardless of source automatically resize an image 4 Full Width m to closely fit the screen The 9 Full Height 6 Anamorphic retain 16 9 aspect ratio letterbox value for Size Position and 7 Tiled Full Size Blanking parameters 8 Tiled Full VVidth Same as above except across described later will in turn 9 Tiled Full Height multiple screens Requires a Setup change as necessary without 0 Tiled Anamorphic your having to set them Figure 3 15 Resize Presets Choices manually Resizing options for non tiled applications are explained in detail below WHAT IS THE PROJECTOR S DEFAULT When displaying a new source by default your image will fill the screen as fully as possible for the type of source present See Select Default below WHEN CUSTOM APPEARS The Custom descriptor automatically appears in the Size and Position menu when any of the values for Size Vertical Stretch H Position V Position or any Blanking do not correspond to those for a preset It is not an option in the Resize Presets pull down list e Select DEFAULT default for m
18. Open or close lens Standby optional on Turn both image models and audio off on a toggle key Press and hold to toggle l Press and release followed Color Ere Poster 2 Protocol B With AON or WORE O Figure 3 3 Keypad IR Remote IR Remote Keypad controls the projector by way of wireless communications from a battery powered infrared IR transmitter Use the IR remote keypad the same way you would use a remote keypad supplied with a TV or VCR When making key presses point the keypad either toward the screen or toward the front or rear of the 3 5 Roadster Vista User s Manual OPERATION j Y IIIKI I HI UW amp I III I4II 9T III CRkY G k NE I IW IEIE I IEI lt Y ZDIIII W I I III I w II II I I I II I E II I I A I I I I IA AAI a c 558 3 6 Wired Remote OPTIONAL Guide to Keypads Keypad Commands Roadster Vista User s Manual projector One of two sensors on the projector will detect the signals and relay the commands for internal processing The wired remote keypad connects to the 3 pin XLR jack via a 50 ft cable It is recommended when e the rear of the projector is inaccessible lighting conditions are unsuitable for proper IR transmission you want to use a separate keypad for each projector in a group NOTES 1 For extra long distances and or harsh environments you may prefer to use an optional r
19. You can switch to an input in either one of two ways Pressing the appropriate direct key neut nput3 nput3 or 1s a quick and seamless way to display from one of the four inputs connected at the rear of the projector Or if your projector has a switcher connected to it at the SWITCHER port press the general key and enter n OPERATION Creating a New Channel AUTOMATIC the 2 digit number representing the switcher and slot location for the desired signal note there is no on screen feedback for entering the numbers Regardless of which method you use to select a source input the image will be displayed according to the following If it is the first time you have used the source input or if you used the input but did not define a channel by adjusting anything the projector will recognize the new input signal based on its frequencies and polarities and will automatically display an image according to default settings for such a signal Note that a graphic source will resize into a full screen Image whereas video or HDTV sources will resize only as much as possible while maintaining their aspect ratio If you used the source once before and changed a display parameter such as contrast V Position etc then a channel was automatically created and still exists in projector memory see below Using an key will automatically recall this channel and all its setup parameters and update the display accordingly I
20. You may wish to use one or more external Marquee Signal Switchers or a third party switcher in order to significantly increase the number of sources you can select If you are using a Marquee Signal Switcher connect the switcher s RGB output to INPUT 1 and connect an RS 232 serial communication cable between the switcher and the projector serial port labeled SWITCHER refer back to Figure 2 24 The switcher communication link permanently set at 9600 baud enables you to access inputs connected to the switcher in the same manner as those connected directly to the projector For most other third party switchers connect and access sources according to the documentation provided with that switcher NOTE See 2 4 Source Connections Connecting a Switcher for complete details Serial Communications RS 232 NETWORK To control multiple projectors with a computer controller having an RS 232 interface first set them all to the same baud rate needed then chain the projectors together by connecting the RS 232 OUT connector of the first projector already connected to the computer controller to the RS 232 IN connector of the next projector in the chain Roadster Vista User s Manual 2 29 INSTALLATION AND SETUP INPUT 2 INPUT 3 INPUT 4 COMPOSITE VIDEO S VIDEO Y C G D K Vide di ideo Decoder L LOOP I 1 Loop Module 804600 INPUT 1 REM
21. nosis Table of Contents ist Visi User s Manual Section 1 Introduction 1 1 1 2 1 3 2 Installation amp 2 1 Setup 2 2 2 3 2 4 2 5 2 6 2 7 2 8 2 9 2 10 3 Operation 3 1 3 2 3 3 3 4 3 5 3 6 3 7 3 8 3 9 3 10 3 11 4 Maintenance 4 1 5 Specifications 5 1 6 Appendices 5 1 02 0 Contents Page Ti PO a idi 1 1 COTM OIA IES nce asa E I EE E maa s a a al na 1 2 Purchase Record and Warranty Registration 1 2 it ipl dai 2 1 Installation Considerations 2 3 Projector Position and Mountin 2 10 Source OM MCC ONS c Pa d bd 2 15 Power Connectio i u ussasasqaaakasusqassakawqhqkasqaqshapaqaqkakqakqaqayhanasawquqhusqas 2 24 Operating OrIentafiObr u uu uuu a pada S daz baqqa 2 24 vu 2 24 ZOOM Focus amp Lens et a 2 25 serial Port Connections z aad R R a 2221 Keypad Protocols and Conversion 2 34 V VI u 77717 3 1 o CC LO TS RIK uuu a aa ya asa a dan 3 1 Usmo 3 4 Tluyizat nz the lenus u u 3 14 Using Inputs and Channels
22. 02 0 1 32 72k 59 94 3 Left Blank 03 0 4 s vid 4 Right Blank 5 PLL Loop Gain HELP 6 Keystone Projector Setup Keypad 8 Tiling Setup Using Help XGA models only or Channel Selection Requires opt Status LEDs DVI module 2 1012 gt Scrollable window for help with the 1 Contrast current procedure 2 Brightness z Standard on Roadster onl 7 7 y 4 Detail a LENS e ontro 5 Color Space m m wauu 6 Color Setup I k P 7 Video Options MENU 2 Zoom 8 Input Levels 3 Lens Horizontal Offset 9 More TEST 4 Lens Vertical Offset m m 5 Intelligent Lens System 6 Calibrate Lens She J 7 Center Lens 1 Processing Mode Zoom requires 2 Motion Filter zoom lens SHUTTER 6 PLL Loop Gain 1 Size and Position 2 Image Settings 3 Channel Setup 4 Configuration 5 Lamp 6 Status 7 Auto Setup Not in this model Requires opt ADP module sample Standard on Roadster only Channel Setup 0 1 p4WH 48 73k 60 01 0 2 iDig 1st display 0 1 56 33 72k 60 00 01 BA 0 A 03 E Channel Copy Delete 1 Copy 2 Delete 3 Delete Unlocked 4 Delete All approx 10 patterns 4 Configuration Lamp Resizing Presets Default No Resizing Full Size Full Width Full Height Anamorphic Tiled Full Size Tiled Full Width Tiled Full Height Tiled Anamorphic 10
23. I lt x Y II I I Iz3 WI gt II4 I I I IhI I lt I I II II IIAA X X a X X38 X 5 l i li s xun Most of the controls for the projector are menu gt Main Menu 3 4 Navigating the accessed from within the projector s menu z Menus system There are several groups of related 1 Size and 2 Image Settings Junctions with each group selectable from the 3 Channel Setu Main menu as shown at right Press atany Choose a as P function Configuration time to display the Main menu 5 Lamp l 6 Status On the keypad either enter the number 7 Auto Setup corresponding to the function menu you wish to access such as 2 for the Image Settings menu Figure 3 6 Main Menu or use the AJ Y keys to highlight the desired option and press Erte The function menu you selected will then appear If you select Auto Setup this will not activate a separate function menu but rather begin an automated process of optimizing critical display parameters such as size position pixel tracking etc Once you have a function menu displayed navigate in a similar manner enter a menu option number for any numbered option or use 4 to move the highlight and press at the desired option Extra long menus have a scroll bar on the right use the arrow keys to see the remainder of the menu Items that are locked out or do not pertain to the current action appear dimmed and cannot be selected NOTES 1 If there i
24. Motion inconsistent you may wish to force a setting to ensure stable processing for this source if desired override Roadster Vista User s Manual 3 39 OPERATION UK I lt I I I I I I III lt IIII IIII III I III I OIIIK I I Z 9 lt I2I ITZI IIIICII I IKAIII IUPTuYKCKZ IIEII I2MI I x I E ErEI I vI IE9IeXAIAIIAI I9IEI9 T TP oXG5 3Vl 8 3 40 Roadster Vista User s Manual the default Auto setting by selecting the appropriate motion filter 1 AUTO The projector will automatically use the correct motion filter according to the incoming signal Note that the Still Video filter will be applied for RGB non HDTV interlaced signals and the Motion filter will be applied for RGB HDTV interlaced sources 2 STILL VIDEO For static images with no motion such as graphics from a CD Note Applied for RGB non HDTV interlaced signals 3 VIDEO For video images that did not originate from film or for moving computer generated images NOTE Applied for RGB HDTV interlaced signals 4 FILM For video images that originated from film This will optimize image quality and stability 5 NOTES 1 For 60 Hz video standards NTSC PAL M PAL 60 2 Also recommend for PAL video standard if the ADP module is present note that you must select film mode manually in this case 3 Signals can be from RGB video composite video or S video sources 6 GRAPHICS Fo
25. defined and stored in projector memory Once you enter a 2 digit channel number or if there is a list displayed highlight it and press 2 the display will automatically change and update according to the numerous setup parameters defined for that channel NOTE key behavior during a presentation depends on whether or not the Display Channel List option is selected in the Menu Preferences menu You can choose to use a scrollable list of channels when you press Can or you may prefer to enter the desired channel number blind i e without on screen feedback See Menu Preferences later in this section Roadster Vista User s Manual 3 7 OPERATION wG lt wmaan gt u oxrnszli010O 1 lIUIWIIIIKI I NW I I I II I II I I I I I III lt I9I9IoO lt III I IIY lt lt e pp ls ahI _ 8 lt a h l l amp a5a5 x h X 3 8 VOFF Roadster Vista User s Manual Standby Press and hold for approximately 1 second to blank all display and mute the audio output 1f connected vvhile keeping the proyector in a vvarmed up and ready state Or quickly press and release and follovv immediately by or if you vvant to guarantee the correct toggle useful 1f you are unsure of the present status Note that the lamp and electronics remain ON in standby mode even though the image turns to black and most functions are disabled To leave standby press
26. lt or to change slidebar settings Numeric entry eliminates the time delay to distant projectors ensuring all projectors receive the command The IR keypad may have been disabled for use with this projector s Press to enable broadcasting to all projectors See 2 70 Keypad Protocols and Conversion and 3 7 Configuring System Parameters for additional information The power is on but the lamp is not I Does LCD status window say warming The projector probably became overheated there is likely an error code flashing and a message in the LCD status window Allow to cool and make sure that nothing blocks projector vents Do not operate in environments warmer than 35 C 95 F Roadster Vista User s Manual 4 13 MAINTENANCE UI II II I I IIIII I I lt I lt IIII I lt I lt IC I I IIoI2 IIIII 4 lt I I I IIWI I II I IZAIIIAI2 I IA I N HI AI I A I 3I I9IAI R KB KE BEel l 8 4 14 Symptom CAUSE REMEDY Symptom CAUSE REMEDY Symptom CAUSE REMEDY Symptom CAUSE REMEDY Symptom CAUSE REMEDY Roadster Vista User s Manual 3 The lamp may have reached the end of its life Check the Lamp Hours via RS 232 request Iph Motorized FOCUS does not work I 2 Remote lens functions are standard with Roadster models only If focus does nothing and the focus tabs move freely by hand the focus motor located just bel
27. make sure Video Termination is checked for only the final projector All other projectors must have this option unchecked in order for the signal to continue For other types of display devices in the chain typically a Hi Z switch position is needed OI INPUT 2 INPUT 3 INPUT 4 COMPOSITE VIDEO S VIDEO ee j L LOOP l INPUT 1 GREEN BLUE HOR COMP VERT SVVITCHER RS 232 IN RS 232 OUT 7 est oes sync From S Video Source or To next projector previous projector or display device or vice versa Figure 2 22 Connections for S Video Loop Through Roadster Vista User s Manual 2 21 INSTALLATION AND SETUP Extra Video COMPOSITE OR S VIDEO 2 22 Optional Inputs Roadster Vista User s Manual If you want to use an extra video source In addition to the video source s connected at INPUT 3 or INPUT 4 connect either a Composite or S Video source to INPUT 1 as shown in Figure 2 23 Do not connect both types here simultaneously NOTE For additional video inputs install an optional Composite S Video Input Module at INPUT 2 Left amp Right Left amp Right Audio Inputs Audio Outputs pre amplified ae ma To Amplifier
28. projector rear See right bottom example Make sure the interlock MAINTENANCE Roadster X4 S4 X6 S6 Vista X3 S3 X5 S5 Wires must NOT touch igniter contacts BA Figure 4 6 Lamp Orientation for Different Models wires travel between the lamp and the igniter and remain secured in clip as shown Do not allow contact with igniter A WARNING A Check lead dressing in lamp compartment Secure the new lamp to the alignment plate Roughly align the 3 T bolts on the lamp to the 3 slots in the alignment plate at the rear of the lamp compartment Push the lamp all the way back and make sure the pin on each T bolt aligns with its slot on the alignment plate slowly turn each until the clearance slot is located Then push and turn each T bolt 90 to lock See Figure 4 7 X S3 X S4 X S5 X S6 orientation shown Invert drawing for X9 S9 rotate lamp 180 TO INSERT Align T bolt pin to slot Push T bolt in Turn 90 coil spring pin will straddle groove in plate TO REMOVE Push T bolt in Turn 90 coil spring pin will fit through slot Figure 4 7 Using the T bolts INVERT ILLUSTRATION FOR X9 S9 Replace the side mount air deflector if you had to remove it X9 S9 only Roadster Vista User s Manual 4 7 MAINTENANCE a I K I sII 5I I II I I I I II III I I I I IO I lt I lt II I lt KKCKCIZI I 5 ISIT HO I IIEIEIH AIFO I
29. 06 08 02 09 09 OV 06 02 01 JUOJJ O U J S 1101 5 aouejsip MOJYL INOOZ 1 01 91 UIPIM oz 499405 GC 06 su 7 4 19 31 su 7 1002 Havas b S Z G E 7 Roadster Vista User s Manual THROW DISTANCE l llDlm9l mC21__2 KEk FA FI Wih lt w lt wc aaa a a a a R c c wau c wc lt gt 5 558 OSC 002 S M 59uel1siq 001 001 OS 10 2 f04d Jo 5 1401 O u 12s 101 p nse u MOJYL IWOOZ L Z OL GL n UPIM u 15S oz ET 4 ldepy Sua XHdVt BISIA
30. 27 2 29 2 34 3 44 3 51 3 52 5 2 RS 232 and or RS 422 2 32 RS 422 2 28 3 44 3 51 5 3 S Screen Size 2 7 2 10 2 11 4 15 Select Color Temp 3 32 3 34 Serial Ports Communication Cables 3 44 Service Menu 3 44 Service Requirements 4 3 Shutter 3 2 Shutter Key 3 12 Signal Types 3 21 Size See Sizing Size and Position 3 25 Sizing 3 25 3 27 Slidebars Using 3 15 Slidebars Direct 3 24 Slot 3 23 Source Connection 2 1 Specifying a Location 3 7 Source Setup See Channel Split Network 3 46 And Downloads 2 32 Options for Setup 2 32 When to Use 3 46 Stacking 2 3 2 4 Standby Key 3 8 Status LEDs 3 3 Status Menu 3 50 S Video Connecting 2 19 Extra 2 22 Loop Through 2 21 Switcher 3 23 3 44 Switcher Connection 2 23 Sync Def and types 5 Roadster Vista User s Manual INDEX W T KEE I II I I I IK I I I IC I G GV C G9GC I IzI I lt I lt 2 II I II CII2 I ISI I I9 I II I I9II6I qEkDFu hp w T Test Key 3 13 Test Patterns 3 42 Text Editing 3 17 Throw Distance 2 1 4 16 Definition 2 10 Sample 2 11 Tiling Setup 3 52 Resizing 3 53 Time outs 3 15 Tint Key 3 9 3 32 Toggle Keys 3 8 Troubleshooting 4 12 Two Way Controller 3 6 U User Color Temperatures 3 34 V VCR Checkbox 3 36 Vertical
31. 4 e Display from a projector input Lens e Adjust zoom focus offsets Requires motorized lens Func e Color enable shortcut Detail e Adjust sharpness primarily video OSD e Turn menus on off toggle Volume e Adjust Vista audio Menu e Display menus toggle Lightbulb e Illuminate keys Exit e Return to previous Channel e Select channel setup Projector e Select projector s Help e Display context sensitive help toggle Test e Display selected test patterns Mute e Vista audio on off Hide menu Power Turn projector on off Standby Turn both image and audio off on a toggle key Input Color Pixel Position 2 Protocol B Figure B 1 Keypad Roadster Vista User s Manual Press and hold to toggle or Press and release followed with AON or VOFF B 1 Projector PROJ J Enter Number 1 Size and Position PIXEL Piei Phase 4 1 Resize Presets POS H Position 538 2 Size 7 3 Vertical Stretch COLOR color 5 4 Pixel Track 5 Pixel Phase TINT Tint 50 6 Filter DETAIL Detail 52 ET 7 H Position 8 V Position CONT Contrast 50 9 Lens Control 0 More BRIGH Brightness 50 T FUNC J Color enable etc Size and Position 2 CHAN Channel 02 sample 1 Top Blank 01 0 2 hdtv 10801 2 Bottom Blank
32. Gb sec provides both a SERIAL IN and a SERIAL OUT BNC connector includes 4 status LEDs OPTIONAL INPUT MODULES Serial Digital Input Module Serial Digital Input Module SDI can be installed in the projector at INPUT 2 38 804602 xx where it accepts a serial digital 4 2 2 component video signal YCbCr via a single SERIAL IN BNC connector The signal can loop through the SERIAL OUT BNC out to another device such as another projector Inputs are 75S terminated Serial Digital Input Module 804602 SERIAL IN SERIAL OUT 2 ERROR SIGNAL SDI Features Q accepts serial digital 4 2 2 component video YCbCr Q provides both a SERIAL IN and a SERIAL OUT BNC connector Q includes status LEDs for signal and error NOTE Connect audio to the projector s IN 2 audio port if available standard on Vista models only Marquee The Marquee Case Power Supply enables you to use an analog input module as a Case Power Supply stand alone interface Two supplies are available one for use with 120 volt line 38 801023 xx voltage 38 801023 and the other for use with 220 volt line voltage 38 801026 xx 38 801026 XX Both models include a 15 VDC 500 mA AC adapter Interface Module sold separately Case Power Supply VERT HOR COMP BLUE GREEN RED 12 15 VDC 777 MARQUEE casE POVVER SUPPLY Marquee Case Povver Suppiy Features Q easy installation no tools required Q the Marquee Case
33. Image Image Settings Settings menu to alter your image in ways that do not affect its size or m 200 Pixel Phase 0 Detail 2 gt position Changes made to the Image Settings menu are applied immediately and are saved when you ColorSpace RGB v exit the menu press or Meny Color Setup Options not avallable for your Video Options projector model appear dimmed and Input Levels are disabled More Contrast Image Settings 2 Auto v SHORT CUT Press and adjust the 1 Processing Mode Auto v slidebar 2 Motion Filter Auto v l 3 0 1 Contrast increases or decreases the 10 perceived difference between light 6 PLL Loop Gain 10 and dark areas of your image 0 100 7 Noise Reduction 0 If contrast 1s set too high the light 8 Horizontal Filter 0 parts of the image lose detail and 9 Vertical Filter clarity If set too low the light areas will not be as bright as they could be and the image will be dim Start low and increase so that whites remain bright but are not distorted or tinted and that light areas do not become white 1 are crushed For best results keep close to 50 Figure 3 16 Image Settings Menu n OPERATION Brightness SHORT CUT Press and adjust the slidebar Brightness increases or decreases the amount of black in the image 0 100 Start high and decrease so that dark areas do not become black 1
34. Interlace Keypad Keystone Linearity Line of Best Viewing The ability of a screen to direct incident light to an audience A flat matte white wall has a gain of approximately 1 Screens with gain less than attenuate incident light screens with gain more than 1 direct more incident light to the audience but have a narrow viewing angle For example An image reflecting off a 10 gain screen appears 10 times brighter than it would if reflected off a matte white wall Curved screens usually have larger gain than flat screens A display of help information regarding the current task or presentation The frequency at which scan lines are generated which varies amongst sources Also called horizontal scan rate or line rate The difference between the center of the projected image and the center of the projector lens For this projector this value is expressed as the maximum percentage of the image that can be projected to one side of the lens center without degrading the image quality Horizontal offset ranges can be affected by the type of lens In use and whether or not the image is offset vertically at the same time A circular area of a screen where the image appears brighter than elsewhere on the screen A hot spot appears along the line of sight and moves with the line of sight High gain screens and rear screens designed for slide or movie projection usually have a hot spot The Intelligent Lens System describes the ability
35. Lens Adjustments Zoom 5711 gt Adjust with lt ana gt No offsets approx HANI INSTALLATION AND SETUP 2 2 Installation Considerations Lifting Hoisting and Stacking If you ve just installed the lens select Calibrate Lens before making any adjustments see Section 3 for details Then with the Lens Control menu displayed use the keypad as shown in Figure 2 1 to focus the image clearly and if a zoom lens is present to increase or decrease image size If desired adjust horizontal and or vertical offsets to shift the lens and image location ranges are shown in 2 3 Projector Position and Mounting Press to refine other display parameters if necessary See 3 5 Using Inputs and Channels if you want to work with other source inputs or defined channels You may want to reduce initial setup time by starting with an Auto Setup The projector will automatically optimize a variety of display settings according to the incoming source detected You can then re adjust these settings at any time if desired Although this projector delivers a high brightness quality output final display quality could be compromised if the projector is not properly installed This subsection discusses issues you should consider before proceeding with a final installation Even if you do not intend to use the projectors in a fixed and permanent installation this subsection will help you to better understan
36. Offset How to Adjust 3 2 Vertical Position 3 29 Vertical Stretch 3 27 Video 3 3 Formats 5 2 Video Options 3 35 Video Standard 3 35 Video Termination 2 20 2 21 3 36 Volume Key 3 9 W White Boost 3 40 White Levels 3 34 Wired Keypad 3 45 Y YPbPr 3 31 Connecting 2 17 Z Zoom 2 2 2 25 3 2 Troubleshooting for Motorized 4 14
37. Roadster Vista User s Manual 4 11 MAINTENANCE 4 12 STEP 6 STEP 7 STEP 8 C 4 6 Troubleshooting Symptom CAUSE REMEDY Roadster Vista User s Manual Figure 4 14 Insert Lens and Rotate FIXED LENS SHOWN Secure new lens assembly Secure the 3 lens mount screws Refer back to Figure 4 11 Accessing the Lens Mount Screws note 30 angle of hex driver required to secure a motorized zoom lens Power Up and Calibrate the Lens Remove the lens cap and power up the projector Press to focus then select the Calibrate Lens option in the Lens Control menu Reposition the projector for new lens Reposition the projector closer or further from the screen as necessary for the screen and the new lens type refer to lens descriptions in Section 2 and Section 5 and Appendix E Throw Distance In a permanent installation always use the appropriate throw distance formula Av IMPORTANT A Always calibrate a newly installed lens If the projector appears not to be operating properly note the symptoms present and use the following guide to assist you If you cannot resolve the problems yourself contact your dealer for assistance NOTE Always check the LCD status window at the rear of the projector for initial information about a problem The projector will not turn on when is pressed 1 Make sure to hold for approximately one second Or press quickly and release and follow with aon 2 Do both
38. Screen gain is usually greater than 1 but audience viewing angles are reduced PAL Phase Alternating Line video is a 50 Hz standard with 768 x 576 resolution It is found on some video tape and disk players used primarily in Europe China and some South American and African countries A distortion of the image shape characterized by concave or convex borders The smallest discernible element of data from a computer generated image The phase of the pixel sampling clock relative to incoming data The frequency of the pixel sampling clock indicated by the number of pixels per line The projector is at presentation level when an image from a source is displayed without the presence of a slidebar menu pull down list or error message The distance between the projector s front feet centers and the screen Also called Throw Distance The type of code format called A or B utilized by the remote keypad s The default protocol set at manufacture is Protocol A By using two different keypad protocols adjacent projectors can be controlled independently with their remote IR keypads A selectable menu item that unfolds into a list of options pertaining to it A translucent panel for screen projection Incident light travels through the incident surface of a rear screen and forms an image on the other surface The ability to manipulate through software commands the physical size placement and or aspect ratio of an im
39. User s Manual A 3 GLOSSARY ww MIp E EI I I I II II III I I lt I _ lt I_KI I I5IX I_ II lt I lt I lt I I II TI gt II lt I I lt I II I IZI I2 I lt I I ZI I w I II I I IIAIII IMIIIIIAI IIAIS SO 8 Loopthrough Loopthru Lumen Lux Menu NTSC Video Optical Screen PAL Video Pincushion Pixel picture element Pixel Phase Pixel Tracking Presentation Level Projector to Screen Distance Protocol Pull down List Rear Screen Resizing Resolution lens A 4 Roadster Vista User s Manual The method of feeding a series of high impedance inputs from a single video source with a coaxial transmission line in such a manner that the line is terminated with its characteristic impedance at the last input on the line The unit of measure for the amount of visible light emitted by a light source The amount of visible light per square meter incident on a surface I lux I lumen square meter 0 093 foot candles A list of selectable options displayed on the screen A video output format of some video tape and disk players There are two types of NTSC National Television Standards Committee video NTSC 3 58 and NTSC 4 43 NTSC 3 58 is used primarily in North America and Japan NTSC 4 43 is less commonly used A type of rear projection screen which re directs light through the screen to increase image brightness in front of the screen
40. are crushed Conversely high brightness changes black to dark gray causing washed out images For best results keep close to 50 Pixel Phase SHORT CUT Press and adjust the slidebar See description in Size and Position section above Detail SHORT CUT Press and adjust the slidebar Detail adjusts the sharpness of a video image Use 4 and until the display is as sharp as desired keeping in mind that any increase in detail above 3 default will also introduce a certain degree of noise in the image Set below 3 to filter the signal and remove noise from a noisy source Keep at 3 to apply no detail Color Space This option determines how the color components of an input gt 1 RGB signal are decoded for accurate color in the display Selecting a 2 YPbPr Video color space option is useful only for analog signals connected to 3 YPbPr HDTV INPUT 1 or INPUT 2 Although the color space for such a signal is automatically determined by the projector in some circumstances you may wish to override this and manually set a different color space NOTE For digital signals or for signals connected to INPUT 3 or INPUT 4 the color space function is entirely automatic and the pull down list disabled e Select RGB unless you are using component video at INPUT 1 or 2 e Select YPbPr Video with a standard definition televised signal SDTV e Select YPbPr HDTV with a high definition televised signal HDTV N
41. been exposed to excessive moisture e The projector does not operate normally e The projector has been dropped or the case has been damaged e Projector performance has deteriorated Do not attempt to service the projector yourself All servicing must be performed by a qualified Christie service technician only If replacement parts are required it 1s important that only Christie approved parts are used Other parts may result in fire electric shock or risk of personal injury Clean the projector when required Before cleaning always unplug the projector from the power outlet To avoid the risk of scratching the lens clean the lens only if absolutely required A small amount of dust on the lens will have very little effect on picture quality If the lens must be cleaned use a DRY soft cotton cloth Clean gently in a circular motion It is important to never touch the glass surface of the lamp as the oil imprint will seriously degrade lamp performance Should you accidentally touch the surface of the lamp clean carefully with a lint free cloth moistened with isopropyl alcohol Clean the case with a soft dampened cloth Use a mild commercial cleaner Do not use liquid or aerosol cleaners The optional IR Remote Keypad uses four AA size 1 5V batteries preferably alkaline To install new batteries open the battery compartment at the back side of the keypad by pulling on the raised portion of the cover as shown Figure 4 1 Roa
42. directly from the Figure 3 9 Entering Text keypad it will be accepted and the cursor will move on ADD OR DELETE A CHARACTER OR SPACE To insert a space at the cursor location press To delete a highlighted character or space press lt Roadster Vista User s Manual 3 17 OPERATION wG lt wmaan gt u oxrnszli010O 1 lIUIWIIIIKI I NW I I I II I II I I I I I III lt I9I9IoO lt III I IIY lt lt e pp ls ahI _ 8 lt a h l l amp a5a5 x h X Editing Numerical Values 3 18 HAA 3 5 Using Inputs and Channels Do I Select an Input Or a Channel Roadster Vista User s Manual show2 show2 Press Press lt to insert a space before to delete show 2 show PRESS WHEN FINISHED To accept the edits and move out of the edit window press NOTE Press at any time to cancel changes and return to the previously defined text Enter numbers directly from the keypad in order to specify numbers representing projectors channels source setups switchers or slots As each digit is entered it is displayed and the cursor moves on Note that channel numbers are defined with 2 digits for example if you enter only a single digit like 7 for a channel number the channel will automatically be defined as 07 Use 07 to utilize this channel NOTES 1 Once you enter the first
43. image Light from the projection screen should be absorbed by the ceilings walls and floors so that it will not be reflected back to the screen Again keep reflective surfaces to a minimum Here are some other considerations and tips which can help you improve your installation e Ventilation is an important factor when preparing a projection room The ambient temperature should be kept constant and below 35 C 95 F Keep the projector away from heating and or air conditioning vents Changes in temperature can cause drifts in the projector circuitry which may affect performance e Keep the projector away from devices which radiate electromagnetic energy such as motors and transformers Common sources of these are slide projectors speakers power amplifiers elevators etc Roadster Vista User s Manual 2 9 INSTALLATION AND SETUP MH 2 10 23 Projector Position and Mounting Throw Distance Roadster Vista User s Manual e Tor rear screen applications less space 1s required if a mirror is used to fold the optical path e Choose the right screen size for the application 0 As screen size increases magnification increases and reduces brightness Select a screen size which is appropriate for the venue but not larger than that required Q Installing a large screen in a small room is similar to watching television close up too large a screen can overpower a room A good rule of thumb is to be no closer than 1 5 times the wi
44. is level from side to side see 2 7 Leveling Connect a Source Locate the main input panel at the rear of the projector The lower left area labeled INPUT 1 accepts an RGB input via BNC connectors The upper right area assuming a video decoder is installed accepts a composite video atINPUT 3 or S video input at INPUT 4 Connect your source to the appropriate panel connectors Connect the Line Cord to AC Power Connect the projector s line cord to the AC receptacle at the lower right rear corner of the projector and to proper AC Use the line cord provided with the projector see Section 5 Model AC Power Required X S3 and X S4 100 240 VAC 50 60 Hz max 11 5 amps 100V X S5 and X S6 200 240 VAC 50 60 Hz max 8 5 amps 200V X9 S9 200 240 VAC 50 60 Hz max 12 amps 200V A Turn the Projector ON Using either the built in or remote keypad press and hold for approximately 1 second to turn the projector on or press aon Let the projector warm up for about five minutes The POWER LED located in the lower right corner of the rear input panel should glow a steady green WARNING Do not attempt operation if the AC supply and cord are not within the specified voltage and power range See Section 5 Roadster Vista User s Manual 2 1 INSTALLATION AND SETUP STEP 5 Select a Source Using either the built in or remote keypad press neut input or to select and display the image for the sourc
45. key and 2 8 Zoom Focus and Lens Offset Blank Top Bottom Left or Right Blanking These slidebars blank turn to black the top bottom 1 TopBlank 8 left or right edge of the image so that any unwanted 2 Bottom Blank 4 EF information is cropped from view For example when 3 LeftBlank 18E displaying native size video you may want to blank 4 Right Blank 1 out a few of the top lines Do not use in combination with Keystone control PLL Loop Gain This control changes the relative offset to the default gain The default PLL Phase Lock Loop Loop Gain setting of 10 is set automatically with a Pixel Tracking adjustment and is correct in most cases In rare instances such as if your image exhibits tearing or flag waving increase the PLL loop gain setting as necessary Or if your image is unstable and breaks up this may indicate that the PLL loop gain setting is either too high or too low PLL Loop Gain affects the current channel only Keystone NOTE This function is not available in S models Adjust the keystone control if images appears non rectangular or keystoned in shape that is smaller at either the top or bottom edge The effect of keystone adjustment is similar to physically tilting the projector forward or backward in relation to the screen and it affects all sources NOTES 1 Keystone is enabled for a source only if Size is 1000 and Size x Vertical Stretch is 1
46. lists a variety of details about the standard and optional components currently in use on the projector Refer to the Status menu for versions of hardware left side and software right side installed the number of lamp hours logged in total and for a specific period such as a rental period and for your projector model name and serial number In addition the Status menu identifies the current channel switcher slot and frequencies Use on yorr lt or to see additional Status information n OPERATION 3 10 Using Multiple Projectors Assigning a Projector Controlling One Projector Status Scroll to see more Model Roadster S4 S N 123456789 Lamp Hours 20 Lamp Counter 5 Projector Hours 152 Native Resolution 1280 x 1024 Chan Name Sync Type Tri Level on HC input ChanNumber 02 Sync 33 72 kHz 159 94 Hz Switcher 0 projector Slot 1 Input 1 IPM 6 2 Software 2 1 Interconnect 2 3 Boot 1 4 LCD HW 2 3 LCD SW 1 0 Panel Driver 2 2 T2 ADP SW 2 97 ADP HW 2 31 ADP Firmware 2 97 ADP Bios 2 21 MCM 1 3 Decoder 1 4 1 26 1 PLL 23 1 003 2 1 3 1 Decoder 1 6 008 T5 Engine SW 1 10r Figure 3 29 Status Menu SAMPLE When working with multiple projectors you may want to use the RS 232 or RS 422 serial ports to chain the projectors together in a network that you control from either a keypad or a computer controller see 2 9 Serial Port Connections Or you may prefer that each projector stands alone but is contr
47. lt I9I9IoO lt III I IIY lt lt e pp ls ahI _ 8 lt a h l l amp a5a5 x h X Broadcasting to All Projectors Tiling An Image Across Multiple Displays 3 52 Roadster Vista User s Manual sure to select the Broadcast Keys option for the projector to which the wired remote is connected To work with a single projector press to display an editable window from each projector Enter the three digit number you have assigned to the projector you wish to control All keypad commands will then affect this projector exclusively until you press again and enter a different number or until you switch to broadcast mode below NOTES 1 If you are using a computer or controller to issue commands use the correct RS 232 software command to gain control of a single projector First make certain that only one any networked projector has its Broadcast Keys option selected checked the remaining projectors must have the option unchecked and their keypads disabled do this in Configuration Communication menu The Broadcast Keys projector will then relay keypad commands to the others If using a wired remote make sure to select the Broadcast Keys option for the projector to which the wired remote is connected On either the IR remote or wired keypad press to display the projector box Press again without entering a number the keypad commands will now affect all projectors NOTE 1 If you are using
48. mount air deflector Remove lamp and detach from terminal block e Pull the lamp module out slightly Note that it is still attached to a terminal block which connects to the lamp power supply via anode and cathode cables the lamp module cannot be fully removed yet e Remove the single screw securing the lamp module to the terminal block See Figure 4 5 top view The lamp should now be fully free refer to the recycling disposal instructions provided with the new lamp Terminal block Remove screw to detach lamp from terminal block Figure 4 5 Detach lamp from terminal block TOP VIEW A important Detach the lamp from the terminal block only Do not disconnect cables STEP 7 STEP 8 Reattach terminal block and insert lamp Secure the new lamp module to the terminal block with the single screw Insert the new lamp module into the lamp compartment as shown in Figure 4 6 For 700W or 1200W models Looking into the lamp compartment the terminal block should be located at approximately 3 o clock 1 roughly centered and on the side of the lamp facing the projector front See right top example Make sure the main lamp cables travel over the lamp t e NOT along the lamp compartment floor For 9 49 Looking into the lamp compartment the terminal block should be located at approximately 9 o clock 1 e roughly centered and on the side of the lamp facing the
49. of lens with Intelligent Lens System ILS for recall of lens settings from source to source standard in Roadster only Tandem horizontal and vertical sizing software control Independent vertical stretch for changing aspect ratios Keystone adjustment via menu option X models only Interchangeable lenses for diagonal screen sizes up to 40 or more feet Display of NTSC PAL and SECAM video input Display from PCs VCRs laser disc players video cameras etc Intuitive on screen menus or hidden direct control with built in or remote keypad Memory for up to 99 custom channels source setups accessible with keypress Controller and switcher compatibility Built in RS 232 and RS 422 ports for computer control and networked projectors Remote controlled shutter optional in Vista models Rugged functional design for harsh environments and secure handling Roadster Simple hardware option for hoisting and for stacking multiple projectors Roadster Modular design for easy servicing Exterior panels of metal and polymer Roadster Vista User s Manual 1 1 INTRODUCTION M Vista and Roadster accept data graphics and video input signals for projection on to front or rear flat screens High brightness light is generated by an internal Xenon arc lamp then modulated by three DMD digital micromirror device panels that provide digitized red green or blue color information Light from the on pixels of each panel is reflected conver
50. only if the direction of lens movement has not changed during an adjustment See Figure 2 26 Alternatively simply enter a new position to reverse direction For example if the current setting is 2000 enter 2001 to start moving up then press gt If current setting is 2001 enter 2000 to start moving down then press lt Lens Control Focus 3140 Zoom 5711 M with or P gt Avoid tweaking with Lens Horizontal Offset 4881 opposite key if using ILS Lens Vertical Offset 2664 Intelligent Lens System Calibrate Lens checkmark to save Center Lens these lens settings in current channel memory A 55557 Figure 2 26 Lens Settings and the ILS e When adjusting lens offsets slidebar values will not reach extremes of 0 or 9999 This 15 normal and does not mean that corresponding lens mount movements failed to reach their physical extremes Mn NOTE Communication software is required for serial control Contact your dealer 2 9 Serial Port Connections If using a computer for details You may wish to use equipment other than the keypad for controlling the projector or for performing other special functions Such equipment such as most personal computers requires a serial interface for sending and receiving communications through the serial ports on the projector Note that there are two different types of serial communication ports on thi
51. plugging back in and connecting to the projector and or network Left amp Right Left amp Right Audio Inputs Audio Outputs pre amplified 1 To Amplifier phono plugs IN 2 IN 3 IN 4 e e e EY INPUT 2 INPUT 3 INPUT 4 COMPOSITE VIDEO S VIDEO J00 L Loop I 1 Loop Ma du es 804 200 INPUT 1 REMOTE RED GREEN BLUE HOR COMP VERT SWITCHER RS 232 IN RS 232 OUT OOOO Oe o m 9 pin D style connection NOTE 9600 baud rate female BNC connectors Uu WWW WWW RGB and sync output from switcher f From switcher Figure 2 24 Connecting a Marquee Signal Switcher If you are using more than one Marquee Signal Switcher daisy chain the RS 232 switcher inputs outputs together to form a complete network of inputs accessible from the projector you can network up to 9 switchers and connect Switcher 1 to the projector as shown in Figure 2 24 In addition connect the RGB output from each switcher to its matching slot on switcher 1 for example connect the RGB output from switcher 2 to
52. poor pixel tracking Adjust the slidebar until the stripes broaden to the point where one large stripe fills the image Again the image may still exhibit some noise See Pixel Phase Pixel Phase SHORT CUT Press and adjust the bottom slidebar Pixel phase adjusts the phase of the pixel sampling clock relative to the incoming signal It is used primarily for adjusting RGB inputs NOTE Adjust pixel phase after pixel tracking is properly set Adjust pixel phase when the image usually from an RGB source shows shimmer or noise Pixel phase adjustment is done most effectively from within a proper test pattern such as a smooth gray consisting of a clear pattern of tiny black and white dots or a similar graphic image such as the Windows shutdown screen Adjust until the image is stable and each dot is clearly defined Using the numbers on the slidebar as a guide you will notice that you can actually stabilize the image at more than one point 1 e you may find that the image appearance at 11 is identical to the image appearance at 38 thus you can select either setting Filter Filter applies a low pass filter to the input signal This removes high frequencies which can improve pixel phase noise but which also reduces signal bandwidth Note that most signals will not require any filter adjustment use the filter option only if standard pixel tracking and phase adjustments do not adequately clear up a noisy signal For best
53. processing sources through Top and bottom rows the opti onal ADP module you have almost no data Re tile on fewer rows may have to crop the extreme top and bottom edges of the image OR map to fewer screens see right Occasionally the projector may encounter an error condition that interrupts normal operation Such a condition can be caused by an invalid user entry an input signal error most common or other system error If you would like to be notified on screen of such errors select the Screen option from the Display Error Messages pull down list in Menu Preferences Menu If you would like to be notified via a serial communication only select the RS 232 option instead To receive both notifications select A T To disable error messages except for invalid user entries select Off NOTE Error messages also always appear at the rear LCD next to the keypad _c_ wa a a lt n a a a gt a _ _ a apw G h X ss OPERATION User Errors Input Signal Errors System Warnings Errors Invalid User Entry Any keypad entry not recognized by the projector will trigger an on screen error message describing the problem For example if you specify a channel number that has not been defined the message Invalid Channel will appear Or if you try to enter the wrong password you ll see Invalid Password Press or to confirm the message and eliminate the message box NOTE Displayi
54. results 1 Optimize Pixel Tracking and jot down the Good area value V m m 5 Optimize Pixel Phase 79 3 If the image is still too noisy return to Pixel 7 7 Tracking and m s adTust so that 2 vertical bands of noise appear separated by a good center band See right 2222222222 7 0797 SEERE 4 Adjust Filter to maximize the width of the good Enlarge good area area See right S ig 5 Return Pixel Tracking to its correct setting from lt Step 1 wa 6 Readjust Phase 4m gt NOTE Filter affects only the current signal H Position SHORT CUT Press and adjust the top slidebar This option moves image right or left n OPERATION NOTE The value shown represents where the approximate center of the image lies in relation to the total number of pixels available horizontally This varies widely according to the signal watch the image while adjusting V Position SHORT CUT Press and adjust the bottom slidebar This option moves the image up or down NOTE The value shown represents where the approximate center of the image lies in relation to the total number of pixels available vertically This varies widely according to the signal watch the image while adjusting Lens Control STANDARD IN ROADSTER ONLY SHORT CUT Press to activate the Lens Control submenu For a full description of the Lens Control submenu see 3 3 Using the Keypad tens
55. the lens to the approximate center of the lens opening the image will be fairly well centered on this axis Note that if centering remains significantly off lens mount bore sight is likely poor Contact your dealer for service Shutter OPTIONAL IN SOME MODELS If your projector has a mechanical lens shutter a k a douser installed press and hold for approximately 1 second to toggle the shutter closed or open with a single key press this also blanks the image electronically Or quickly press and release and follow immediately with or if you want to guarantee the correct toggle useful if you are unsure of the present status Close the shutter whenever you want to mute all display yet maintain access to projector functions Open the shutter to regain the display With no shutter installed still blanks the image electronically but the blanking is not quite as black NOTES 1 The status of the shutter is shown in the LCD window on the rear panel of the projector 2 Upon power up the shutter is open 3 The lamp remains on Mute Use to mute audio if connected and or hide the current menu Press and hold for approximately second to toggle on or off with a single key press Or quickly press and release and follow immediately with or if you want to guarantee the correct toggle useful if you are unsure of the present status In either case a small message appears on screen to signify mute status NOTE After early October 2
56. to max Use 550W or more to ensure normal operation and prevent similar shutdowns or install a new lamp in order to reliably use lower lamp power levels INTENSITY This number represents the current brightness of your lamp decreasing over time when you are operating at Max Brightness or at a specific Power level However when you are operating in Intensity mode this value remains at your chosen Intensity setting NOTE The number shown for intensity is not the actual lumen output but rather an arbitrary value unrelated to lumens To use Intensity mode judge by eye and set the level as desired for your application remembering that higher settings can significantly shorten lamp life Over time the projector will automatically increase the power supplied to the lamp as needed to maintain the chosen intensity as closely as possible This is called Brightness Tracking or LiteLoc Keep in mind that once power reaches its maximum see Power above this tracking is no longer possible At this point the lamp will gradually begin to dim as usual even though your original Intensity value will still appear in the menu To resume accurate tracking reduce the intensity setting so that the resulting Power value 15 less than its maximum the lower the intensity the longer it can be maintained Do not lower the Intensity so much that the corresponding Power value reaches its m
57. usisip moms 71 O O N O O CO N T T HH uu HH HH EE HH s I N NN pt LA FT j s tT 7 IL LC T IT T T TT T T j TT TT T a Lt tT jO j j j d l _ LA pt l l l l 1 l l l l 1111 11 4 depy su 7 XHdVuDBISIA SUB 1 80 YL 310N x su 7 1 1 27 pue su 7 p xIJ gt AcivtiSDISI 1 870 u zis U9919S E 3 Roadster Vista User s Manual THROW DISTANCE m mm ah amp hK CmltI c a w ww F a w aacc _wwa lt c a aca a gt gt 5 5588 GZ S JLON Uu 9ue1sid MOJUL 02 99 09 99 OS GV OV 96 06 92 02 GL OL 40 9afo1d JUOJJ o UDAIOS 101 painseew aouejsip L ee ys X d SU T ul002 L 2 c G Lk oro LO TON O O FON O OD 11 61 Oc Lo CC 62 ye Gc 92 12 8c c 06 LE ce ce ve MH UIPIM u 15S Roadster Vista User s Manual E 4 n THROW DISTANCE 071 061 021 01 001 S FLON M ue s q 06 08 02 09 09 OV 06 02 01
58. zoom lens Optional Wired Kypd only Pixel e Adjust pixel tracking and phase Position e Adjust image position Color Adjust color intensity video only Tint e Adjust red green balance hue Video Contrast e Adjust difference between light dark Brightness Adjust amount of light in image Enter Select a highlighted menu item e Change a value Accept a changed value Arrovv Keys Move highlight within menu e Adjust a setting up down Input Select other switcher slot location Number Keys aa Enter a number such as channel input projector etc Shutter Open or close lens optional on some models Input1 Input 2 Input 3 Input 4 Pixel Position Lens Func Color Tint Detail OSD Cont Bright Vol Menu Enter Exit 0 asa AON P Y OFF Input 1 2 3 Help 4 5 6 Test 7 8 9 Mute 0 Shutter Stby Power mt Appendix B Keypad Reference Projector Inputs 1
59. 0 1 full on full off Roadster X9 400 1 ANSI 500 1 full on full off Roadster S9 400 1 ANSI 800 1 full on full off Color Gamut and Gray Scale Gamut of displayable colors gt 1 billion Gray scale resolution standard bit Gray scale resolution with ADP installed 10 bit Gamma processing 13 bit Color Temperature Default 6500K Range of Adjustment 3200K to 9300K 1918 0100 g 77 11042 100 g 77 C 1289 0100 g 77 728 01002 g 77 T123 91002 g 77 7190 91002 77 Tiax 010 o 77 NOTES 1 VistaGRAPHX lenses noted above require a threaded adapteriflange for installation in this projector 2 VistaGRAPHX zoom lenses noted above do not offer motorized zoom function Manual only 3 VistaGRAPHX 0 8 1 lens is not recommended for use in S models 4 Maximum offsets are reduced when simultaneously offsetting horizontally and vertically 5 Offsets shown are for motorized lens mounts Manual offset ranges may differ Roadster Vista User s Manual 5 1 SPECIFICATIONS M M Inputs Number of Inputs 2 second input via plug in module 2 video 4 stereo audio standard on Vista only Analog RGB and YPbPr INTERLACED OR PROGRESSIVE SCAN FORMAT Horizontal frequency range 15 120 kHz Vertical frequency range 23 97 120 Hz Pixel clock rate 10 160 MHz Active pixels per scan line H 640 2048 Active lines per frame field V 200 2000 Signal format Analog RGB or
60. 000 audio control is standard on Vista models only In models without audio temporarily turns the current menu on off Function Key From presentation level press followed by a 2 digit number to enable a specific color or colors in the display For example 6 14 will display only red and green data 6 7 will display all color data The list of available color combinations is shown below and also appears on the back of the IR remote keypad Color enabl ng can also be accessed through the menu system rather than these shortcuts n OPERATION 6 Red 6 2 Green 6 3 Blue 6 14 Red and Green 6 5 Green and Blue 6116 Red and Blue 6 7 All colors amp does the same thing NOTE VVhen is pressed in presentation level the profector vvill not respond to non numeric entry until 2 digits have been entered or until 5 seconds of inactivity have elapsed Use of the key within the menu system is noted with the appropriate topic elsewhere in Section 3 For example press in the Channel Setup menu to enable deletion or copying of a channel OSD On screen display Press and hold for approximately 1 second to toggle menus on or off 1 visible or invisible Or press followed immediately by or to guarantee the correct toggle direction useful if you are unsure of the present status Note that invisible menus are fully functional NOTES 1 With OSD on you can still mute menus error messages slide
61. 000 000 2 Keystone adjustment is not available in S models 3 Avoid using Keystone with Blanking Roadster Vista User s Manual 3 29 OPERATION 3 30 Image Settings Roadster Vista User s Manual Generally set at 50 default to apply no Before After keystone if your projector is positioned Deereas with its lens surface parallel to the Keystone screen images will be rectangular If images are too narrow at the bottom increase keystone If images are too Before After narrow at the top reduce keystone Increase Keystone The keystone control may be limited when Size is just slightly greater than 1000 In general work with image size stretch and keystone controls as necessary for your application Plug amp Display EDID NOTE Requires optional DVI Input Module Disabled for all other inputs By default the Plug amp Display option detects an incoming digital flat panel video signal and displays it in the native resolution of your projector If you have additional daisy chained projectors 1 1024x768x60Hz they will display in this resolution as well If you want to l use a different resolution example your 1 5 card 4 1280x1024x105Hz may not support the current resolution select a different 5 1600x1200x45Hz Plug amp Play setting from the list Tiling Setup See 3 10 Using Multiple Projectors Tiling Setup section Use options in the two page
62. 2 Do not connect digital component signals known as YCbCr to INPUT 1 Use the appropriate digital interface installed at NPUT 2 AUDIO for INPUT 1 STANDARD ON VISTA ONLY To control audio levels in an audio visual system connect pre amplified line level audio inputs to the IN 1 left and right channel audio inputs located near the top left corner of the rear input panel Then connect external audio amplification equipment to audio OUT for sound output Audio connection cables require standard RCA type phono plugs Roadster Vista User s Manual 2 17 INSTALLATION AND SETTUP a a w a a CL c w a a a a a a gt gt gt gt gt gt gt gt 535 5 NN 2 18 Composite Video Roadster Vista User s Manual The video decoder input panel provides simultaneous connection of both a composite video source INPUT 3 and an S Video source INPUT 4 If connecting a composite video source use the Composite BNC connector or the RCA phono jack at INPUT 3 do not use both as inputs See Figure 2 19 AUDIO for INPUT 1 STANDARD ON VISTA ONLY To control audio levels in an audio visual system connect pre amplified line level audio inputs to the IN 3 left and right channel audio inputs located near the top left corner of the rear input panel Then connect external audio amplification equipment to audio OUT for sound output Audio connection cables require standard RCA type phono plugs NOTE If you wa
63. 22 controller Figure 2 31 Assorted Networks NOT split Note that communication parameters such as baud rate must be set to match the particular controlling device before connecting as a netvvork refer to the documentation that came with your controlling device in order to determine the proper baud rate See 3 7 Configuring System Parameters if you need help changing the projector baud rate from its default of 19200 NOTES L To avoid damage connect only properly wired serial communication cables See Appendix D for details 2 It is recommended that each RS 232 communication cable be no more than 25 feet in length Use high quality cables Roadster Vista User s Manual 2 31 INSTALLATION AND SETTUP a a w a a CL c w a a a a a a gt gt gt gt gt gt gt gt 535 5 NN Back up or Split Networks 2 32 Roadster Vista User s Manual In a typical network broadcast serial communications or messages destined for a specific projector travel through all serial ports in each projector regardless of whether the messages originate from an RS 232 or RS 422 source refer back to Figure 2 31 bottom example The communication path depends on the serial cabling connected at each projector You may prefer the option of two separate communication paths RS 232 or RS 422 your network essentially creating a redundant back up communication path that can take over should a failed projec
64. 24x768x60Hz 1024x768x120Hz 1280x1024x60Hz 1280x1024x105Hz 1600 1200 45 2 1 Number Rows 2 Number of Columns 3 Projector Row 4 Projector Column 5 Resize Presets Tiling Setup 1 RGB 2 YPbPr Video 3 YPbPr HDTV Appendix C Menu Tree Color Temp Setup See Select Color Temp Interpolated Red White Level Green White Level Blue White Level Color Enable Copy From Red Green Blue Yellow Cyan Magenta White 3200K 1 Default 5400K 2 Enhanced 6500K lt 3 High Ambient 9300K 4 PAL SECAM User 1 5 Linear User 2 User 3 User 4 s Factory 3200K 1 3200K Factory 5400K 2 5400K Factory 6500K 3 6500K Factory 9300K 4 9300K 5 User 1 6 User 2 7 User 3 8 User 4 9 Interpolated Color Setup 1 Color 2 Tint 3 Select Color Temp 4 Interpolated Color 5 Gamma 6 Color Temp Setup Video Options Video Standard Input Video Black VCR Video Termination 1 Auto 2 Video Auto Still Video Video Film Graphics Motion 3 Graphics HDTV a Input Levels Enable Decoder AGC 1 Auto Input Level 2 Red Pr Black Level 77777 3 Green Y Black Level 4 Blue Pb Black Level 7 5 Red Pr Input Drive Not in this model 6 Green Y Input Drive 1 Red ADP modu 7 Blue Pb Input Drive 2 Crean 8 Clamp Tip 3 Blue 9 Color En
65. 3 12 Deleting a Channel TO DELETE MULTIPLE CHANNELS highlight any channel in the Channel Setup menu and press to go to the Channel Copy Delete submenu Select Delete Unlocked Only and press to delete all unlocked channels Or select Delete All Channels to delete all channels even those that are locked In either case the current channel will remain but will be redefined from projector defaults NOTE For any deletion a confirmation box appears to make sure that you really want to delete Select Cancel default if you don t want to delete after all The basic setups that describe how and where a channel can be accessed are listed in the Channel Setup menu These channel setups can be edited at any time in the Channel Edit submenu From the presentation level press to display the main menu To display the Channel Setup menu press 3 or move the highlight to the Channel Setup option and press Ete The Channel Setup menu will appear edit parameters shown in the Channel Setup menu select the relevant channel and press The Channel Edit menu will appear similar to the sample shown in Figure 3 13 XX gt lt aa a gt gt gt 5 gt X X ss OPERATION editable rs A e K Channel Edit 1 Name pres2 Sync Type S Video Number 02 H Sync 15 73 kHz read only 2 3 Switcher 0 V Sync 59 94 Hz 4 Slot nterlace Yes 5 In Menu 6 7 8 9 Locked Previou
66. 5 Resize Presets Tiled Full Sizev Figure 3 30 Tiling Setup Example of 4x4 Array Resizing the Videowall Image RESIZE PRESETS When your multiple projector tiled array has been defined as described above select a desired tiled resizing method Sections of incoming data will then automatically map to the appropriate rovv column address in your videowall filling the wall with a complete image that is scaled as you have specified NOTES 1 Tiled resizing options are enabled only if you have defined an array of two or more projectors as described above 2 Use the same tiled resizing option for each projector in your array regardless of the number of rows and columns in the array 3 Whether the wall produces a black border or a cropped image depends on the aspect ratio and resolution of the incoming source e For each projector select Tiled Full Size to fully fill all screens in the wall Each section of incoming data will be scaled horizontally and vertically to fill the screen to which it automatically maps See right Note this option does not necessarily maintain aspect ratio Tiled Full Size e For each projector select Tiled Full Width Tiled Full Width to fill the videowall from left to right while maintaining aspect ratio This typically creates a top and bottom black border on the wall and is best suited for HDTV signals See right NOTE FOR LARGE ARRAYS 1 In large arrays havi
67. 94 available from 04 0 3 pCVid 15 73 59 94 05 0 1 p4WH Fred s computer In order to use channels ran on the keypad you must first create them See belovv channel 7 signal type H and V frequencies location or channel name To use a new source with the projector a new channel must be added to projector memory Channel List zl so that the projector will respond properly to an input signal from that source in the future A new channel can be created automatically as described here or it can be copied from an existing channel and then edited as necessary see Copying or Deleting Channels later in this section When you select a direct input press or input npud or leud the existing channels in the projector are searched for matching input and signal parameters If no match to the incoming input signal is found in the currently defined channels a new Roadster Vista User s Manual 3 19 OPERATION wG lt wmaan gt u oxrnszli010O 1 lIUIWIIIIKI I NW I I I II I II I I I I I III lt I9I9IoO lt III I IIY lt lt e pp ls ahI _ 8 lt a h l l amp a5a5 x h X channel is temporarily created based on factory defined defaults for this signal The channel number assigned to this channel is the lowest available number from 01 99 NOTES 1 An automatic channel will be discarded unless one or more of its parameters are changed and will not appear in the Channel List see belo
68. C I select a different video standard from a 6 Decoder Luma Delay 8 complete list available to the projector some will appear disabled depending on the current incoming signal Selecting a specific standard forces the projector to process the signal according to this standard NOTE This option should remain set at Auto for all instances EXCEPT 1 a poor quality input signal or 2 a black and white video signal In order to detect and display such signals select the relevant standard INPUT VIDEO BLACK This control compensates for incoming elevated black levels called setup that are present in certain video signals and ensures that blacks on screen are neither crushed 1 e with dark gray appearing black nor excessively elevated 1 e with black appearing dark gray By default the projector automatically determines the correct setting according to the type of incoming video signal Roadster Vista User s Manual 3 35 OPERATION wG lt wmaan gt u oxrnszli010O 1 lIUIWIIIIKI I NW I I I II I II I I I I I III lt I9I9IoO lt III I IIY lt lt e pp ls ahI _ 8 lt a h l l amp a5a5 x h X 3 36 Roadster Vista User s Manual OIRE ForDVD output with enhanced black SECAM most PAL standards and Japanese NTSC 7 5 IRE Por most NTSC video signals For some types of video you can override the setting The control is disabled for other types
69. DMD projectors that use Digital Light Processing DLP technology from Texas Instruments to achieve high brightness multimedia and video projection All models are compatible with standard international video formats and can interface with IBM compatible PC Macintosh computers and workstations Vista models are ideal for mounting in 1 1 The Projectors c gt S Co large audience venues In which there may high levels of ambient light such as in corporate boardrooms auditoriums and lecture halls The Roadster offers this same high level of performance but with additional ruggedness enabling frequent transport changing installations and easy stacking of multiple projectors This robust projector is well suited for use in outdoor stages and arenas Vista and Roadster model shown Roadster features include Native resolution of 1024 x 768 X models or 1280 x 1024 S models scaleable Brightness ANSI lumens 10 Vista X3 S3 3000 Roadster X4 S4 4000 note X4 S4 discontinued Vista X5 S5 5000 Roadster X6 S6 6000 note Vista S5 discontinued e Roadster X9 S9 8500 Contrast Ratio Vista X3 X5 Roadster X4 X6 300 1 ANSI 500 1 full on off e Roadster X9 400 1 ANSI 500 1 full on off Roadster S9 400 1 ANSI 800 1 full on off e S models with 700W or 1200W lamp power supply 300 1 ANSI 800 1 full on off Smooth and versatile remote control
70. EMEDY Symptom CAUSE REMEDY Symptom CAUSE REMEDY Roadster Vista User s Manual Colors in the display are inaccurate 1 The color tint gamma color space and or color temperature settings may require adjustment Review all settings and refer to 3 6 Adjusting the Image and 3 7 Configuring System Parameters The display is not rectangular I 3 Check leveling of the projector If necessary try relocating the projector or screen so that the lens surface and screen are approximately parallel Is the vertical offset set correctly Adjust as necessary using the vertical offset knob on the front of the projector The Vertical Stretch option may need adjustment Also check pixel tracking The display is noisy I Display adjustment may be required Adjust pixel tracking phase and filter Noise is particularly common on YPbPr signals from a DVD player The video input may not be terminated Make sure the video input is terminated 75 S If it is the last connection in a loop through chain the video input should be terminated at the last projector only The signal cables carrying the input signal may be of poor quality Use only good quality signal cables The distance between the input source device and the projector may be too great If the distance between the input source device and the projector is greater than 25 feet signal amplification conditioning may be required The input signa
71. I I A I I I I IA AAI a c 558 3 38 Roadster Vista User s Manual only a certain color while adjusting use the Color Enable option described below 6 Delete the Auto checkmark and leave the Input Levels menu IMPORTANT Do not use Input Levels to adjust color temperature This will distort Contrast and Brightness functions as well as color temperature CLAMP TIP This option full name sync tip clamping can brighten the image produced from certain high resolution high frequency graphic sources Enter a checkmark if the image appears unusually dim if there are horizontal streaks across the image or if there is significant color drift Delete the checkmark if the image is either sufficiently bright or overly bright NOTE The sync tip clamping option is not used for video sources or any RGB source with sync information on the video e g sync on green COLOR ENABLE Select which color or colors you want to see useful while working with color temperature white levels or input levels NOTES L Input levels apply for the current source only but for any color temperature used 2 Assuming that color temperature has been set up based on the internal test patterns you can then set up input levels for a given source so that it matches the color temperature of the internal test patterns PEAK DETECTOR The Peak Detector is fast method of defining individual input levels and may improve the accuracy of inp
72. IIII I II AI Ke I lt z O sLQIEaeE RKE EE D EEZI lt LZ 2IE Y EE ww s Use the hex socket ball driver provided with the projector to loosen the 3 lens mount screws securing the lens flange to the mount loosen these screws only do not remove Accessibility is illustrated in Figure 4 11 e IF MANUAL ZOOM LENS Access to the 3 lens mount screws is likely blocked by the toothed zoom ring Manually rotate the zoom ring until its access holes align with the screws beyond then insert the hex socket ball driver as shown See Figure 4 11 e IF MOTORIZED ZOOM LENS As shown in Figure 4 11 the 3 access holes on the zoom gear will be skewed away from the lens mount screws see Before You Begin instructions Insert the hex socket ball driver through the holes at approximately 30 to access each screw Aim down for 4 o clock screw aim up for 8 o clock screw FIXED LENS MANUAL ZOOM MOTORIZED ZOOM loosen 3 screws loosen 3 screws loosen Approx 1 3 screws lt Figure 4 11 Accessing the Lens Mount Screws STEP3 Rotate Lens and Remove Figure 4 12 1 ROTATE THE LENS SLIGHTLY See below Using both hands rotate the lens barrel counterclockwise until the screw heads align with the larger end of their slots on the lens flange 2 PULL LENS OUT Carefully pull the lens assembly straight out of the projector and set aside 4 10 Roadster Vista User s Manual STEP 4 MOTORIZED ZOOM ONLY STEP 5 MAINTENA
73. IN 2 standard on Vista only 2 Optional digital interfaces cannot be used in a Marquee Case Power Supply or Switcher 3 Connect analog HDTV signals directly to INPUT 1 or to any RBG input module installed at INPUT 2 the optional HDTV Input Module used in earlier Christie projector models is not needed or recommended 4 See Appendix F Optional Input Modules for a brief description of each interface ca gt gt gt gt gt gt gt gt 3 3 3 3 G X SSS INSTALLATION AND SETUP Connecting a switcher Connecting Multiple Switchers You may wish to use one or more external Marquee Signal Switchers or a third party switcher in order to significantly increase the number of sources you can select If you are using a Marquee Signal Switcher connect the switcher s RGB output to INPUT 1 and connect an RS 232 serial communication cable between the switcher and the projector serial port labeled SWITCHER see Figure 2 24 The switcher communication link permanently set at 9600 baud enables you to access inputs connected to the switcher in the same manner as those connected directly to the projector For most other third party switchers connect and access sources according to the documentation provided with that switcher Use high quality shielded cables NOTE Make sure any Marquee Signal Switcher connected directly to the projector is set as Switcher 1 If it is not unplug the switcher and turn the thumbwheel to 1 before
74. IN 2 IN3 IN 4 O R INPUT 2 INPUT 3 INPUT 4 COMPOSITE VIDEO S VIDEO Y C Y C K T Ove dule 8 Vi LOOP 241 1 Loop Mo 04600 NPUT 1 REMOTE RED GREEN BLUE HOR COMP VERT RS 232 IN 7 ZE a Z Z Z srarus 6 6 O CO REZ REZ REZ REZ REZ ss c OO power From Composite To next projector Video Source or or vice versa or display device previous projector Figure 2 21 Connections for Composite Video Loop Through N INSTALLATION AND SETUP S Video Loop Through CONNECTIONS See Figure 2 22 From your source connect an S video source signal to INPUT 4 using either the 4 pin mini DIN or the 2 adjacent BNCs labeled Y and C Connect a second cable from whichever INPUT 4 connector is free to one of the S video inputs of the next display device or projector Continue this looping method for each projector using either 4 pin mini DIN or the 2 adjacent BNCs as input into INPUT 4 then using the other connector s as an output 1 e loop through Whether you use 4 pin mini DIN or the 2 adjacent BNCs as input or output depends on the type of cable you have on hand and what type of connectors are on each end If desired connect one audio signal to any projector as usual audio is standard on Vista models only VIDEO TERMINATION In the Image Settings Video Options control
75. Input Module Digital Micromirror Devices used in this projector for processing red green and blue color data Located at INPUT 3 and INPUT 4 this device converts NTSC 3 58 NTSC 4 4 PAL PAL N PAL M or SECAM to RGB video The sharpness of a display from a video source A type of rear projection screen which spreads the light striking it Screen gain is less than 1 but audience viewing angles are increased An adjustment that affects the display of an image Such display settings include contrast brightness tint blanking size offsets and others A very rapid variation in image brightness caused by a frame rate that is too slow See Interlace The frequency at which complete images are generated For non interlaced signals the frame rate is identical to the vertical frequency For interlaced signals the frame rate also known as field rate is one half of vertical frequency The intensity of visible light per square foot The luminance brightness which results from one foot candle of illumination falling on a perfectly diffuse surface H RII III lt II lt I II lt IIK IIII I lt IZKW IIIEI IIIKII I IIAIAI II I I I I I I I I IO PI9I IEEI E EIIIAI I II IAIAI II IIAI I I II sIAI II I A I IIYII II AI IHI IIII I IIAI lt IIIISSSS GLOSSARY Gain or Screen Gain Help Screen Horizontal Frequency Horizontal Offset Hot Spot ILS Input Input Signal Interface
76. LEDs come on at the rear of the projector Check that the power cord is properly connected at the wall outlet and that you are using the original high current cable provided with your projector 3 Does the green Status LED flash with each key press If not the projector is not receiving the keypad s IR signals Ensure the keypad is directed at either the front or rear of the projector or at the screen Also make sure that these paths are not blocked Try the built in keypad n WAINTENANCE Symptom CAUSE REMEDY Symptom CAUSE REMEDY Symptom CAUSE REMEDY 6 The batteries in the IR remote keypad may be weak Refer to 4 3 Replacing Keypad Batteries for instructions The IR keypad may have been disabled by a change in protocol See 2 70 Keypad Protocols and Conversion and 3 7 Configuring System Parameters Use the key on the built in keypad to turn the projector on The projector is on but I can t see display of source input I 2 3 4 Was the lens cover accidentally left on Remove lens cover Is the correct AC power source connected See Section 5 for specifications Is the shutter closed Is the proJector In standby Press to clear Is an active source connected properly Check the cable connections And is the correct source selected Press nputi input nput3 or to select See 2 4 Source Connections and 3 5 Working with Inputs and Channels for detalls Are there test patterns or menus pres
77. Lens Offset n OPERATION Press to access remote Lens Control motoriz ntrol of _ focus 1 Focus 3140 EEE i Zoom 5711 Lens Horizontal Offset 4881 Lens Vertical Offset 2664 Intelligent Lens System 1 Calibrate Lens Center Lens and zoom and other related functions In the Lens Control menu All slidebars can be adjusted with L4 and or set with a specific value entered from the keypad Figure 3 4 Lens Control Menu 2s NOTE Since the direction of lens travel affects the final true position of the lens setting a lens position focus zoom or an offset to a specific value may cause the lens to reverse its direction of travel depending on its starting point so that it approaches the setting from the necessary direction Any even numbered setting is approached from above the slidebar values will decrease any odd numbered setting is approached from below the slidebar value will increase FOCUS Adjust the image clarity If focus is not uniform throughout the image bore sight is likely poor Contact your dealer for service ZOOM Enlarge or shrink the image note requires a Roadster Vista zoom lens HORIZONTAL OFFSET Shift the lens and image left or right Note that slidebar values will not reach extremes of O or 9999 This is normal VERTICAL OFFSET Shift the lens and image up or down Note that slidebar values will not reach extremes of O or 9999 This is no
78. NCE Rotate zoom gear clockwise fully Face the front of the new motorized zoom lens still out of the proJector with cut out at bottom Manually rotate the zoom gear fully clockwise See Figure 4 13 The access holes will be aligned with the flange slots IMPORTANT Before continuing make sure focus tabs cannot move this indicates that the focus gear is properly engaged with its motor If the tabs do move freely the focus motor visible just inside the lens opening at the bottom has likely popped forward during rough transit and is no longer engaged with the gear The motor must be as far into the projector as possible move focus tabs slightly while pushing the Figure 4 13 motor back fully maximum movement is Gear rotated fully approximately TA clockwise Insert New Lens NOTE Remove small rear cap Keep front cap ON AA Remove rear lens cap e CUT OUT AT BOTTOM Orient the lens flange cut out to the bottom of the lens opening e INSERT LENS The 3 slots on the lens flange align with the 3 lens mount screws insert the lens so that screw heads slip through the large BOTTOM ends of the flange holes See Figure 4 14 e ROTATE LENS Rotate the lens barrel clockwise until the screw heads lock into the small ends of the lens assembly slots See Figure 4 14 NOTE For a motorized zoom lens the rotation will skew the access holes away from the lens mount screws Screws will still be accessible however
79. OTE ED GREEN BLUE VERT SWITCHER RS 232 IN RS 232 OUT STATUS lt gt A m OO POWER SYNC ne 9 pin D style connections From 772 or previous projector J To next projector Figure 2 29 Adding Another Projector via RS 232 RS 422 NETWORK To control multiple projectors with a computer controller having an RS 422 interface first set them all to the same baud rate needed then chain the projectors together by connecting the RS 422 PORT 2 connector of the first projector already connected to the computer controller to the RS 422 PORT 1 connector of the next projector in the chain From computer Two Way Controller IMPORTANTI or previous projector To next Use the RS 422 port ONLY if your proj system supports RS 422 serial communications Connecting to Use the RS 422 port with incompatible either equipment may DAMAGE the equipment INPUT 2 INPUT 3 INPUT 4 COMPOSITE VIDEO S VIDEO Y C 306 000 Decoder LW Loop 1 L LOOP Mo a le 804600 INPUT 1 REMOTE ED GREEN BLUE VERT SWITCHER RS 232 IN RS 232 OUT srarus UAD faa OO s POWER k SYNC Figure 2 30 Adding Another Profector via RS 422 2 30 Roadster Vista User s Manual N INSTALLATION AND SETUP For either type of network continue connecting projectors in this manner until you v
80. OTE When certain RGB signals are first connected the projector may not initially recognize them as RGB and will incorrectly decode their color information as YPbPr video These signals can include e RGB signals in NTSC PAL SECAM frequency ranges Scan doubled sync on green e Scan quadrupled sync on green For these signals change the Color Space to RGB which will define a new channel for future use Roadster Vista User s Manual 3 31 OPERATION wG lt wmaan gt u oxrnszli010O 1 lIUIWIIIIKI I NW I I I II I II I I I I I III lt I9I9IoO lt III I IIY lt lt e pp ls ahI _ 8 lt a h l l amp a5a5 x h X 3 32 Roadster Vista User s Manual Color Setup Color Setup Select this submenu to work with 1 Color 500 EF aspects of color adjust for saturation and overall hue In video i Select Color mise signals or adjust gamma or 4 Interpolated Color 6500K temperature in any signal Gamma Default v 6 Color Temp Setup COLOR Color adjusts the color saturation level or the amount of color in a video image When set to the image appears black and white and when set too high the colors appear overpowering and unrealistic Use 4 and to adjust Color until the desired saturation level is displayed For a shortcut to Color slidebar press at any time TINT Tint adjusts color hue to obtain tru
81. PRIORITY 7 R 7 bl 4 COMPOSITE o N L z VIDEO INPUT MODULE AUDIO IN 801004 Composite S video Features Q BNC connectors for composite RGB signals Q 4 pin mini DIN connectors for S Video signals Q buffered loop through video outputs NOTES 1 This interface is not a decoder NTSC PAL or SECAM signals must connect to the video decoder installed at INPUT 3 INPUT 4 2 The audio connectors are not functional Connect audio to the projector s IN 2 audio port if available standard on Vista models only 3 For use with this projector do not connect both composite video and S video signals to the Composite S Video Input Module connect one or the other even when plugged into a switcher The PC250 Analog Input Module may be installed in this projector a Marquee Signal Switcher or a Marquee Case Power Supply The module receives analog RGB input signals from IBM PC compatibles or Macintosh computers Video inputs are 75S terminated Video outputs are provided for buffered loop through to another display device PC250 ANALOG INPUT MODULE AA OOOOO a G looooo OOOOO OR MAC NOT BOTH PC250 Analog Features Q accepts VGA or MAC RGB video Q 15 pin D connectors for video Q active loop through video outputs NOTES 1 This interface does not accept VGA and MAC signals simultaneously 2 The audio connectors are not functional Connect audio to the projector s IN 2 audio port if available
82. Povver Supply accepts the following input modules for use with this projector RBG500 RGB400 Active Loop Thru RGB400 Buffered Amplifier Composite S Video and PC Analog Digital inputs cannot be used Q retaining clip to secure AC adapter non slip feet Q supplied with 110 or 220 volt AC adapter Oo Roadster Vista User s Manual F 5 A AC Requirements 2 1 Advanced 10 bit ADP 3 39 Noise and Filtering 3 40 Anamorphic 3 27 And Tiled Image 3 54 Arrow Keys 3 8 Aspect Ratio 2 7 3 25 Audio 5 2 Input 1 2 16 Input 2 2 22 Input 3 2 18 Input 4 2 19 Auto Gain Control See Enable Decoder AGC Auto Input Level 3 37 Auto Power Up 3 43 Auto Setup 3 24 AutoSource Checkbox 3 23 B Back IR Keypad 3 45 Bad Sync 3 55 Baud Rate 2 31 3 44 Blacklevels and Drives 3 37 Blanking 3 29 Brightness 3 31 5 1 Brightness Key 3 9 3 31 Broadcast Key 3 46 Broadcasting 3 10 3 52 C Calibrate Lens 3 11 Ceiling Mounting 2 14 Center Lens 3 12 Channel Locked 3 23 Name 3 23 Number 3 20 3 23 Channel Copy Delete 3 21 Channel Edit Menu 3 22 Channel Key 3 7 3 19 Channel Selection 3 20 Channel Setup Menu 3 20 And Enter Key 3 21 Index And Function Key 3 21 Channels Creating automatically 3 19 Creating in Channel Setup Menu 3 21 3 22 Definition of 3 19 Deleting in Channel Setup Menu 3 22 Maximum Number 3 18 Checkbox Toggles 3 16 Clamp Tip 3 38 Color Adj 3 32 Color and Un
83. RGB signal inputs 0 Buffered signals to a remote destination NOTE The audio connectors are not functional Connect audio to the projector s IN 2 audio port if available standard on Vista models only The RGB400 ALT Input Module may be installed in this projector a Marquee Signal Switcher or a Marquee Case Power Supply The module receives analog RGB input signals from computers or other RGB source devices Video inputs are 75S terminated Video outputs provide buffered loop through to another display device OMO GREEN BLUE HOR COMP VERT RGB400ALT Features Q accepts 3 4 or 5 wire RGB video sync on green composite sync or separate horizontal and vertical sync Q BNC connectors for RGB signal inputs Q buffered loop through video outputs NOTE The audio connectors are not functional Connect audio to the projector s IN 2 audio port if available standard on Vista models only Composite S Video Input Module 38 804608 xx PC250 Analog Input Module 38 804609 xx OPTIONAL INPUT MODULES The Composite S Video Input Module may be installed in this projector a Marquee Signal Switcher or a Marquee Case Power Supply The module receives either composite video or S video input signals from tape or disk players do not connect both types of signals simultaneously Video inputs are 75S terminated Video outputs are provided for buffered loop through to another display device NOTE S VIDEO HAS our
84. TION AND SETTUP a a w a a CL c w a a a a a a gt gt gt gt gt gt gt gt 535 5 NN 2 20 Video Loop Through Roadster Vista User s Manual To loop a single incoming video signal input connected at the video decoder through to another projector or display device use the empty connector s adjacent to this same input as described below Composite Video Loop Through CONNECTIONS See Figure 2 21 From your source connect a composite video signal to INPUT 3 using either the small phono plug or the adjacent BNC Connect a second cable from whichever INPUT 3 connector is free to one of the composite video inputs of the next display device or projector Continue this looping method for each projector using either the phono plug or the adjacent BNC as input into INPUT 3 then using the other connector as an output 1 e loop through Whether you use the BNC or the phono plug as input or output depends on the type of cable you have on hand and what type of connectors are on each end If desired connect one audio signal to any projector as usual audio is standard on Vista models only VIDEO TERMINATION In mage Settings Video Options control make sure Video Termination is checked for the final projector only All other projectors must have this option unchecked in order for the signal to continue For other types of display devices in the chain typically a Hi Z switch position 15 needed
85. The frequency range of the projector s video amplifier The speed at which serial communications travel from their origin In this projector the RS 232 or RS 422 default baud rate of 19200 can be changed to match a controlling device The switcher baud rate of 9600 cannot be changed The time inside one scan line during which video is not generated The blanking time of the input signal must be equal to or greater than the retrace time of the projector In projection brightness usually describes the amount of light emitted from a surface such as a screen It is measured in foot lamberts or candelas per square meter Unit of measure for measuring intensity of light A collection of measurements stored by the projector for a given input source including frequencies pulse width polarity syncs channel number and location user adjustable display settings etc Use channels to switch between a variety of setups quickly automatically recalling previously defined display parameters A list menu of previously defined channels available in projector memory A 1 Roadster Vista User s Manual GLOSSARY Tma_ Q__wpwEE E II I I I II I I I I I I I I lt II II 1 k u ugrsr as lt 4a l l9a gt ll Wt aVthk amp _ a a a gt c Gc _ s sss Channel Number Checkbox Color Shift Color Temperature Component Video Composite Video Contrast ratio Convergence Curved Scree
86. VEI 4 I I I W U IEI I3I ELI 5 STEP9 Close the lamp door e Swing the door down and secure the 2 screws If necessary push the X9 S9 air deflector on the lamp door slightly to the left when closing it must clear door frame and internal components STEP 10 Replace the left side panel e Align the bottom of the left side panel with two pins at the bottom edge of the projector and swing up into place Secure with 5 screws NOTE The lamp module is calibrated for maximum performance and brightness in this projector Do not attempt to re align or adjust an installed lamp module STEP 11 Power up the projector and reset the lamp timer In the Main menu select the Lamp option In the Lamp menu select the Change Lamp option enter the new serial number in the S N text box see Section 3 Operation if you need help entering the number When the new number is recorded the lamp timer will automatically reset to 0 hours and begin to log time IMPORTANT If you neglect to enter a serial number the lamp timer will not reset to O and will therefore be inaccurate The lamp life limit may then expire prematurely NOTES D Once entered the new lamp serial number is also automatically added to the Lamp History submenu read only 2 Lamp life data is required for warranty claims Filter Replacement It is a good idea to replace the air filter whenever the lamp module is replaced or Procedure more freq
87. YPbPr Input levels R B G Y with sync 1 0V p p 2 dB R G B without sync 0 7V p p 2 dB Pb Pr 0 7V 2 dB DC offset 5V Nominal impedance 75 ohms Maximum return loss VSWR 1 2 1 dB 200 MHz Input frequencies higher than the maximum panel refresh rate will be displayed at a lower rate Analog Video Signal formats Composite CVBS S Video Y C Video standards NTSC NTSC 4 43 PAL PAL M PAL N PAL 60 amp SECAM Input level Composite 1 0 Vp p 3db including sync tip Input level S Video Luma Y 1 0 Vp p 3db including sync tip Input level S Video Chroma C 630 mV p p nominal burst DC offset 5V Nominal impedance 75 ohms Maximum return loss VSWR 1 2 1 dB 6 mHz Sync INTERLACED OR PROGRESSIVE SCAN FORMAT Input level OIN a SN DC operating range 0V 5V Impedance for composite or separate H amp V 75 ohms Sync type e Separate H and V Bi level or tri level sync on green e Bi level or tri level composite Polarity Positive or negative Not applicable for sync on green Audio NOTE STANDARD ON VISTA MODELS ONLY Number amp type of inputs 4 pairs of phono plug Nominal input and output level 1 0 V DC offset 2V Impedance 30k ohms 10k ohm Volume control range 60 dB to 20 dB Bandwidth 3 dB 30 Hz to 20 kHz RS 232 Serial Input Number of connectors 3 1 network in 1 network out 1 for switcher control Connector type 9 pin D 5 2 Roadster Vista User s Manual
88. a computer or controller to issue commands use the correct RS 232 software command to broadcast Tiling an image means that multiple adjacent Tiling Setu displays work together to form a single image 1 Number of Ross 2E like a tiles in a mosaic This videowall concept 2 Number of Columns 2 contrasts with other multiple projector 3 Projector row 20 applications in which each display is a 4 Projector Column 66 11 complete and independent image Use the 5 Resize Presets Default Tiling Setup menu as described below accessed via the Size and Position menu or Configuration Geometry menu to configure a maximum of 16 displays 4 x 4 into one single image videowall or tiling array Defining the Videowall NUMBER OF ROWS Use the slidebar to define the number of rows 1 4 present in your videowall Each projector must have the same setting NUMBER OF COLUMNS Use the slidebar to define the number of columns 1 4 present in your videowall Each projector must have the same setting PROJECTOR ROW AND PROJECTOR COLUMN For each projector use these two slidebars to define the projector s unique row and column location within the videowall Any videowall begins with the top left corner display as Row 1 Column 1 See Figure 3 30 OPERATION EXAMPLE Tiling Setup 1 NumberofRows 4157777 2 Number of Columns 4 P 3 Projector row 1 4 Projector Column 2
89. able gt 4 Yellow 0 Peak Detector 5 Cyan 6 Magenta 7 White Channel Edit 1 Name Sync Type 2 Number H Sync 3 Switcher V Sync 4 Slot Interlace 5 In Menu 6 Auto Source 7 Locked 8 Previous Channel 9 Next Channel 7 See next page Status Auto Setup C 1 Roadster Vista User s Manual MENU TREE R sIIIII lt I G IIKI I II I WN I KXKI ZIIT TX I I I III I O MI II II I I I II I IO I IIII 4I 4IAI4I 6I0OI 4I Z E IAI4 E EE I I E EI EI4 IeENA EI IIEBAB Lp P I T lt v DE EE l l NI Continued 1 Front 1 English 2 Rear 2 French 3 Inverted Front 3 Espa ol Image Orientation 4 Inverted Rear 4 Deutsch 1 1200 Language 5 Italiano 2 2400 Menu Preferences 3 9600 Communications 7 Geometry 6 57600 Color and Uniformity Baud Rate Auto Power Up Front IR Diagnostics Calibration Back IR Reserved Wired Keypad Service Broadcast Key Projector Service Password Required gt Keystone Lens Control Tiling Setup Reserved Test Pattern Configuration 4 3 Top Left 4 3 Inset 1 16 9 Top L Menu Preferences 16 9 Top Left Menu Preferences 16 9 Inset 1 Menu Location 16 9 Inset 2 Horizontal Shift Custom Vertical Shift Display Channel List Display Slidebars 2 Screen lt Display Error Messages Large M
90. age The maximum number of alternate white and black horizontal lines that can be distinguished on a screen when a photographic target is placed between the lens and a light source and illuminated by that source Resolution projector Retrace Time Horizontal Rise Time RGB Video RS 232 RS 422 S Video Scan Frequency Scan Line SECAM Slidebar Source Source Setup Spot Size Switcher Sync n GLOSSARY The maximum number of pixels that the projector can display horizontally and vertically across an image such as 1024 x 768 called XGA The minimum time required for a CRT projector to move the position of the scanning spot from the right edge to the left edge The time required by the video amplifier of the projector to increase its output from 10 to 90 of the maximum value The video output analog or digital of most computers Analog RGB video can have 3 4 or 5 wires one each for red green and blue and either none one or two for sync For three wire RGB the green wire usually provides sync See TTL Video A common asynchronous data transmission standard recommended by the Electronics Industries Association EIA Also called serial communication A less common asynchronous data transmission standard in which balanced differential voltage is specified RS 422 is especially suited to long distances The output from certain video tape players and video equipment S Video separates syn
91. age appears over a blank display Correct the source connection The horizontal or vertical scan frequency of the input signal may be out of range of the projector Refer to Section 5 Specifications for scan frequency ranges The sync signal may be inadequate Correct the source problem The input signal type may conflict with the input module Install use the correct module for the source Pixel tracking phase filter etc may need more adjustment The display is faint 1 2 3 4 A Check Input Levels option turn Auto input Level to off then on again Brightness and or contrast may be set too low Adjust as necessary Gamma may be poor Recommended setting for most signals is Default The projection room may be too bright Lower the intensity of projection room lighting and reduce light reflections as much as possible The projector may be too far from the screen Move the projector closer The location of the audience with respect to the screen may not be ideal Make sure the audience is within the viewing angle set by the projector and screen position and the screen type The source may be double terminated Ensure the source is terminated only once Symptom CAUSE REMEDY Symptom CAUSE REMEDY Symptom CAUSE REMEDY Symptom CAUSE REMEDY Symptom CAUSE REMEDY Symptom CAUSE REMEDY Symptom CAUSE REMEDY N MAINTENANCE 8 source if non video may
92. amp Limit a message can appear on screen to warn that the lamp needs to be replaced To make sure that this warning appears enter a checkmark in the Lamp Message checkbox located in the Lamp submenu Lamp Replacement You will need a long 10 Phillips screwdriver for this procedure Procedure A WARNING A Lamp replacement is to be done by a qualified service technician only A WARNING A Never attempt to remove a hot lamp A hot lamp is under great pressure and may explode causing personal injury and or property damage Allow to cool completely and handle by the housing only A WARNING Make sure to use the correct wattage lamp supplied by Christie 4 4 Roadster Vista User s Manual n iV AINTENANCE NOTE All illustrations for this procedure assume a non inverted projector STEP1 Turn off the projector Turn the projector off and allow the cooling fans to stop automatically before proceeding with Step 2 STEP 2 Unplug the projector When the cooling fans have stopped unplug the projector STEP 3 Remove the left side panel See Figure 4 2 Remove the 5 screws securing the projector s left side panel Pa e Lower the panel slightly to clear g two pins at the bottom edge of the projector Remove 5 screws EA e Pull the panel off to expose the lamp door near the front corner q 2 Lower panel to clear 2 pins then pull panel straight off Figure 4 2 Remove the left
93. and Guidelines Labels and Markings Projector Location This projector is CSA approved and is designed for safe and reliable operation However safe operation cannot be assured by design alone installers maintainers and users must maintain a safe operating environment for the system Please read through and understand the following warnings and guidelines promoting safe usage of the projector A wARNING A Always REMOVE the lens when shipping a projector A WARNING A Never look directly into the projector lens The extremely high brightness of this projector can cause permanent eye damage A WARNING A 2 For protection from ultraviolet radiation keep all projector shielding intact during operation Observe and follow all warnings and instructions marked on the projector The exclamation point within the equilateral triangle alerts the user to important operating and maintenance servicing instructions in the literature accompanying the projector The lightning flash and arrowhead symbol within the equilateral triangle alerts the user to non insulated dangerous voltage within the projector s enclosure that may be of sufficient magnitude to constitute a risk of electric shock Operate the projector in an environment which meets the operating range specifications in Section 5 Specifications Do not operate the projector close to water such as near a swimming pool Do not place the projector on an unstable car
94. and hold again or use xor Or simply press or Meno Menu Press to display the Main menu A list of several options appears for access to specific functions such as Channel Setup or Image Settings Press again to remove all menus and return to presentation level Enter Press to select a highlighted item to toggle a checkbox checked vs unchecked or to accept a parameter adjustment and return to the previous menu or image Exit Press to return to the previous level such as the previous menu NOTE does not save changes within text editing boxes including number editing of a slidebars or within pull down lists It acts as a cancel in these cases Arrow Keys The arrow keys have a variety of functions depending on the situation Some typical uses are described below See also Editing Text later in Section 3 Use 4 or to change a slidebar value hold as desired for continuous adjustment note the adjustment increments and range depend on the parameter being adjusted Use 4 or to change to a different option within a pull down list without having to display the list first Use 4 or to jump between pages such as in Help or lengthy pull down lists Use the or keys to navigate within a menu pull down list or text box or to increase or decrease the value in the second bottom slidebar of a double slidebar You can also use or in conjunction with certain toggle keys 1 e those including a
95. as described in Hoisting above make 5 sure to use at least one safety strap on strap per iect each projector in the stack See Figure 2 5 bee gt A WARNING A E x Use Christie Hoisting Stacking SS hardware only GE DA Figure 2 5 Hoisting a Stack Minimum Configuration SHOWN INVERTED Roadster Vista User s Manual 2 5 INSTALLATION AND SETUP 1 2 6 Installation Type Screen Type Roadster Vista User s Manual Choose the installation type which suits your needs front or rear screen floor mount or Inverted mount Front Screen Floor Mount Installation ADVANTAGES CONSIDERATIONS Easy to set up Shares floor space with audience Can be moved or changed quickly Easy to access Front Screen Inverted Mount ceiling Installation Does not take up audience space Installation is more permanent Projector is unobtrusive It is more difficult to access the projector Projector cannot be accidentally moved Projector is completely hidden Projector is easily accessed Usually good ambient light rejection Projector is completely hidden Requires separate room Usually good ambient light rejection Installation cost is usually higher Rear Screen Floor Mount with Mirror ADVANTAGES CONSIDERATIONS Projector is completely hidden Requires separate room Usually good ambient light rejection Installation cost is usually higher Requi
96. ay data from the incoming signal in a different aspect ratio Under some conditions in X models adjusting Vertical Stretch also adjusts Keystone NOTE If Size 1000 1000 No Resizing and Size x Vertical Stretch value 1 000 000 adjusting Vertical Stretch also adjusts keystone simultaneously Requires X model Pixel Track SHORT CUT Press and adjust the top slidebar Pixel tracking adjusts the frequency of the pixel sampling clock indicated by the number of pixels per line so that all pixels generated by a particular source are sampled Proper pixel tracking ensures that the image quality whether good or poor 1s consistent across the screen that aspect ratio 1s correct and that pixel phase can be optimized below Roadster Vista User s Manual 3 27 OPERATION wG lt wmaan gt u oxrnszli010O 1 lIUIWIIIIKI I NW I I I II I II I I I I I III lt I9I9IoO lt III I IIY lt lt e pp ls ahI _ 8 lt a h l l amp a5a5 x h X 3 28 Roadster Vista User s Manual NOTE By default the projector will sample at the correct frequency for most sources Pixel tracking is adjusted most effectively using a good test pattern such as a smooth gray consisting of a clear pattern of tiny black and white dots or a similar half on half off graphic image such as the Windows shutdown screen Steady flickering or several soft vertical stripes or bands across the entire image indicates
97. bars etc with the appropriate setting in the Menu Preferences Menu 2 The status of the key is displayed in the LCD window on the rear panel of the projector Help Press for detailed information about any current menu and highlight Press again to exit From presentation level press to access the General Help menu consisting of Using Help Setup Keys Source Input Selection Stat Pwr LEDs and Using 3D Press to leave General Help and return to presentation level Test Press to display one of the available test patterns Press again to display the next available pattern in the sequence will exit after the last pattern or press at any time to remove the current test pattern from the screen and return to presentation level NOTE For a complete list of all test patterns see the Geometry menu description later in Section 3 Keypad operating settings protocols The remote keypad and the optional wired keypad both store keypad operating settings called protocols in memory In some advanced applications such as when you want to use two separate keypads to control two projectors independently you may want to override the original protocol set at manufacture which is A or B for one of the keypads See section 2 70 Keypad Protocols and Conversion for complete instructions Roadster Vista User s Manual 3 13 OPERATION I KV I lt IIIIIIIII IWIIIIII I IINI IQICK G I I IIIIII IIII3 lt I lt lt I
98. be overpowering and unrealistic Use lt J and until the desired color saturation level is displayed The key has no effect when the ADP option is installed Tint Press to adjust the red green color hue for true color reproduction of NTSC video signals or HDTV signals For best results adjust tint while displaying a proper external test pattern from the source otherwise it is recommended that tint remain at its default setting Use 4 and until the desired tint is displayed Detail Press to adjust the sharpness of a video image it is of limited use for non video Use 4 and until the display is as sharp as desired keeping in mind that any level of detail above 3 will also Introduce a certain degree of noise in the image Set below 3 to filter the signal and remove noise from a noisy source Contrast Press to change the amount of white in your images Use L4 and until you reach the desired level of contrast for best results start low and increase so that whites remain bright but are not distorted or tinted and that light areas do not become white 1 are crushed Conversely low contrast causes dim images See 3 6 Adjusting the Image Image Settings subsection Brightness Press to increase or decrease the amount of black in the image Use lt J and until you reach the desired level of contrast for best results start high and decrease so that dark areas do not become black 1 are crushed
99. c 5 5 p p p p l EX D w ww X GS SSSSSPECIFICATIONS Power Requirements Lamp RS 422 Serial Input Number of connectors Connector type Wired Control Input Optional wired keypad Input level A General Voltage range auto switching for X3 S3 and X4 S4 Voltage range auto switching for X5 S5 X6 S6 and X9 S9 Line frequency all Max inrush current X3 S3 X4 S4 X5 S5 and X6 S6 Max inrush current X9 S9 Max current rating for X3 S3 and X4 S4 Max current rating for X5 S5 and X6 S6 Max current rating for X9 S9 Max power consumption for X3 S3 and X4 S4 Max power consumption for X5 S5 and X6 S6 Max power consumption for X9 S9 A Line Cords X3 S3 and X4 S4 X5 S5 X6 S6 and X9 S9 2 6 pin XLR 3 pin XLR connector High 2 0V min Low 0 7V max 100 to 240 VAC 10 200 to 240 VAC 10 50 60 Hz nominal 60 amps 85 amps 11 5 amps 100V 8 5 amps 200V 12 amps 200V 1150 watts 1700 watts 2400 watts 10 heavy duty high current 12 heavy duty high current Length Rating Gauge 10 250V 16 AVVG A Plugs X3 S3 and X4 S4 X5 S5 X6 S6 and X9 S9 X3 S3 or X4 S4 NEMA 5 15P 15A 125 250V Type X3 S3 X4 S4 Type X5 S5 X6 S6 Type X9 S9 Adjustment range for X3 S3 and X4 S4 Adjustment range for X5 S5 and X6 S6 Adjustment range for X9 S9 Operating angle Warm up period to full brightness Rated life X5 S5 X6 S6 or X9 S9 NEMA 5 15P 15A 125 250V NEMA 6 15
100. c and luminance from color information typically producing a higher quality display than composite video The horizontal or vertical frequency at which images are generated One horizontal line on the display A video output format of some video tape and disk players used primarily in France SECAM Sequential Couleur 4 M moire signals are similar in resolution and frequency to PAL signals The primary difference between the two standards is in the way color information is encoded A slidebar is a graphical display of an adjustable setting The numerical setting often represents a percentage but can be a specific unit such as degrees Kelvin The device such as a computer or VCR connected to the projector for display A source is identified at the projector as neut or nputi or as other user defined numbers A source may have numerous corresponding channels defined and recognized by the projector See Input See Channel The diameter of the smallest dot that can be generated by a CRT projector This projector has a fixed spot pixel size A signal selector such as the Christie Marquee Signal Switcher that can be connected to a projector for the purpose of adding more sources This term refers to the part of the video signal that is used to stabilize the picture Sync can occur in three forms 1 Composite sync the horizontal and vertical components are together on one cable 2 Sync on green the sync is pa
101. ching channels and sources during a presentation do not enter a checkmark Roadster Vista User s Manual 3 41 OPERATION wG lt wmaan gt u oxrnszli010O 1 lIUIWIIIIKI I NW I I I II I II I I I I I III lt I9I9IoO lt III I IIY lt lt e pp ls ahI _ 8 lt a h l l amp a5a5 x h X 3 42 Roadster Vista User s Manual NOTE The Channel List and input dialog box cannot be hidden when a menu is displayed DISPLAY SLIDEBARS Enter a checkmark to superimpose a small slidebar over the current image whenever an adjustable parameter is selected directly with a key the option does not affect slidebars in menus such as Piel Position cont or Bright If Display slidebars is unchecked these slidebars can still be accessed but will be hidden during adjustment DISPLAY ERROR MESSAGES Choose in what way you want to be notified of errors detected in either the incoming signal or projector Select Screen or to see a brief on screen messages or select RS232 to be see messages via RS232 and RS 422 serial communication only To disable error message display select Off LARGE MENU FONT Enter a checkmark to enlarge menus and their text You may have to adjust Menu Location to accommodate the increased menu area Communications This submenu of the Configuration menu is fully described in a separate System Communications subsection later
102. cian FILTER SIDE PANEL Louvered grille for air intake Remove to replace air filter AUDIO IN OUT Vista For connecting pre amplified line level audio Standard on Vista models only OPERATION REAR DETAIL Status Display Rear Infrared Sensor Audio Inputs Audio Output standard on Vista only RS 422 Ports Keypad pe z JA AUA UOU L O ri Input Panel RGB Input Serial In Remote Status LEDs S Video AC Input Handle masea Keypad Optional Input Switcher Serial Out Hard Reset Composite Video RS 232 RS 232 COMPOSITE S VIDEO INPUT Accepts a composite video and S Video signal from devices such as VCRs RGB INPUT Accepts RGB and sync signals from devices such as computers as well as composite video S Video or YPbPr component signals RS 232 SERIAL INTERFACE WITH LOOP THROUGH Allows one or more projectors to be remotely controlled by a computer or controller and provide
103. composite video This is the same as entering 0 33 Input 4 Press to select the source connected to INPUT 4 on the projector S Video This is the same as entering 141 Input Press when you want to display from a specific source location such as a switcher connected serially to the projector s switcher port The first digit represents the number you have assigned to your switcher usually 1 9 or 0 for one of the four inputs on the projector The second digit represents the switcher s slot number 1 9 For example display data from switcher 1 slot 2 NOTES 1 Although you don t need to use the input key unless a switcher is connected to the projector you can also use to access the four input slots on the projector itself use as the first digit representing the projector as the switcher then U 2 3 or 4 as the second digit the desired input slot number 0 in combination with higher numbers is an invalid entry 2 See 3 5 Using Channels and Inputs for a detailed explanation of inputs NOTE key behavior during a presentation depends on whether or not the Display Channel List option is selected in the Menu Preferences menu You can choose to have on screen feedback when you press eu or you may prefer to enter the desired source location blind i e without on screen feedback See Preferences later in this section Channel Press to select a specific source setup channel
104. create side borders EXAMPLE Select ANAMORPHIC to display an entire non HDTV wide screen anamorphic image in its native Anamorphic 16 9 aspect ratio Known as letterbox the image will fill For non HDTV anamorphic only the screen from left to right but will not use all vertical pixels available top and bottom will be black If you do not choose Anamorphic when a non HDTV anamorphic image is present the default image will be stretched vertically characterized by obvious distortion and thin people NOTE 1 SXGA resolution shown 2 Use Anamorphic for regaining a 16 9 display of non HDTV anamorphic sources only typically found on some DVDs for example For HDTV the Default setting will produce the same result e All TILED resizing choices are selectable only if you have defined a tiled group of projectors in the Tiling Setup submenu See 3 70 Using Multiple Projectors Size Size controls both the image width and height in tandem maintaining the original aspect ratio proportion of data from the incoming signal Under some conditions in X models adjusting Size also adjusts Keystone NOTE If Size 1000 1000 No Resizing and Size x Vertical Stretch value 1 000 000 adjusting Size also adjusts keystone simultaneously Requires X model Vertical Stretch Vertical stretch adjusts the height the image while keeping the width constant Use Vertical Stretch to displ
105. ctions is defined as such in software and that lens mount Roadster Vista User s Manual 3 11 OPERATION I IIIII I II II IIIIIIIIHIIII I IX WQVI I I I I II K I I IIAIHIII III I I I I lt 2I I A 4I I lt 6 I EU I AEHOUIE N R c F F F F wc 555588 3 12 Roadster Vista User s Manual movements remain accurate to this reference Regular calibration can correct for slight eventual mechanical drifting of movements over time It is particularly recommended whenever the projector is bumped or subjected to vibration and it is required whenever a new lens is installed and after certain service procedures During calibration the lens mount will move in various directions for approximately 30 seconds detecting the center of focus and offset ranges and the extremes for zoom A small Lens Calibrating message appears on screen during calibration Calibration is complete when lens mount movement stops and the menu reappears note that the lens returns to the previous settings NOTES 1 Calibration with a fixed lens installed causes the zoom calibration to time out possibly delaying the completion of calibration by a few seconds This is normal 2 If calibration with zoom lens installed takes longer than about 30 seconds to complete make sure the focus motor is engaged as described in 4 5 Replacing the Lens CENTER LENS This option removes most vertical and horizontal offset and returns
106. d near the top left corner of the rear input panel Then connect external audio amplification equipment to audio OUT for sound output Audio connection cables require standard RCA type phono plugs INSTALLATION AND SETUP YPbPr Signal Connect a YPbPr signal component video to INPUT 1 as shown in Figure 2 18 COMPONENT VIDEO Left amp Right Left amp Right Audio Inputs Audio Outputs pre amplified To Amplifier phono INPUT 2 INPUT 3 INPUT 4 COMPOSITE VIDEO S VIDEO YPbPr signals are also known as O ve O e Component O Y R Y B Y L LOOP sul 1 Loop Module 804600 INPUT 1 REMOTE RED GREEN BLUE HOR COMP VERT SWITCHER RS 232 IN RS 232 OUT 1 VY A A A A Z srarus e 9 s s O o Power O 1 sync I Signals Pr from YPbPr Source Figure 2 18 Connecting YPbPr Signal NOTES 1 If for some reason the projector fails to recognize a YPbPr signal specify this Color Space option within the Image Settings menu See 3 6 Adjusting the Image
107. d what you can do to enhance display performance For any new installation you will likely have to safely lift or hoist the projector into place Keep in mind the following guidelines for safety Lifting The Roadster model includes a set of side handles for convenient brief hand transport l j ae A Hand carry 1 projector max such as when a single projector is lifted or Use BOTH handles carried over short distances by 2 people or for the addition of safety straps when hoisting see Hoisting below Note that these handles are not intended to support the entire weight of the projector for extended periods of time nor can a set of handles support the weight of more than a single projector In particular never hoist or suspend the projector from these handles alone Vista models do not have handles A WARNING A Do not use the side handles to suspend the projector Hoisting Safely hoisting the projector into place requires hoisting hardware available in a Christie Hoisting Stacking Kit specially designed for the projector as well as appropriate nylon webbed safety straps and rigging equipment Never hoist a projector by its feet handles or any other component Figure 2 3 A IMPORTANT A It is recommended that you remove the lens before hoisting a projector Roadster Vista User s Manual 2 3 INSTALLATION AND SETUP 2 4 Roadster Vista User s Manual TO HOIST INVERTED 4 1 2 13 x 172 Roadster
108. device 3 Generally the 12V pin 5 is not connected Consult the documentation for your device N d ol Ue e Connect Tx to Rx 5 e Connect Tx to Rx 4 Rx Connect Rx to Tx 5 12V e Connect Rx to Tx 6 GND 1 From projector to projector RS 232 Standard RS 232 cable with 9 Pin D Connectors Proj Network OUT rl Network IN Shielded Multi conductor Cable female D 2 Roadster Vista User s Manual E SERIAL COMMUNICATION CABLES m From projector to projector RS 422 w Shielded Multi conductor RS 422 Cable w with 6 pin XLR Connectors r Male proj port 1 or 2 Wiring Swap cable A WARNING A Do not connect 12V at pin 5 or damage to equipment may result Wiring Extension cable FEMALE to another cable Roadster Vista User s Manual D 3 SERIAL COMMUNICATION CABLES 4 From projector to switcher new installation Standard RS 232 cable with 9 Pin D Connectors Switcher IN 7 57K male port Shielded Multi conductor Cable female port Li From projector to switcher in existing Marquee installation For adding a projector to an existing installation in which the switcher OUT port is used such as with Marquee installations add a gender changing adapter at the projector port as shown Standard RS 232 cable with 9 Pin D Connectors Female female gender change adapter null modem Sv
109. digit this digit replaces all old digits 2 If you press any non numbered key the number entered up to that point is accepted and updated as the new value 3 Press to cancel editing of numerical values NOTE See Section 2 Installation and Setup for a full explanation of how to connect a variety of sources to the projector The projector stores and automatically recalls up to 99 different channels source setups for a variety of inputs This memory feature allows you to define and conveniently use a wide variety of customized setups rather than having to repeatedly re configure the projector for different presentations Each physical source 1 input can have several different channels associated with it INPUT An input simply describes a physical location for an incoming signal connection These connections are always either on the projector itself one of the four inputs at the rear of the projector or on any switcher connected to the projector s switcher port describes the source signal according to two specific criteria only to which switcher it is connected and to which slot it is connected and is identified by a 2 digit number entered on the keypad The first digit specifies the switcher 0 9 the second specifies the slot 1 9 Note that the projector is always considered switcher 0 EXAMPLES use source connected to switcher 1 slot 3 0 1 use source connected to the projector slot 1 1 e Input
110. dster Vista User s Manual 4 3 MAINTENANCE Remove the old batteries and properly discard Walt a minute or two and place the new batteries In the compartment orienting the positive negative of each battery according to the labels in the compartment When batteries are in place replace the cover by inserting its bottom edge first and snapping the top into place Do not force Battery Compartment Figure 4 1 Replacing Keypad Batteries NOTE Always wait a minute or two when replacing batteries so that the internal electronics discharge and can recognize the change ee NOTE For this procedure you will need the appropriate Roadster Vista Mirage 4 4 Replacing the Lamp and Filter Replacement Kit manufactured by Christie Lamp and Filter The high brightness of your projector is provided by a 700W X3 S3 X4 S4 models or 1200W X5 S5 X6 S6 models or 1700W X9 S9 models Xenon lamp permanently mounted inside its own protective housing In any model when the bulb approaches 1000 hours of usage this lamp assembly needs to be replaced How Old is The Lamp The number of hours logged on the current lamp appears both in the Lamp menu and the Status menu In the Status menu do not confuse Lamp Hours with Lamp Counter which indicates the number of hours logged during the current rental period only and is normally used just for Roadster rental projectors NOTE As the lamp nears its limit as set in L
111. dth of the screen Q Larger screens require greater attention to lighting conditions e When laying out the projection room consider positioning the projector and screen in a manner which will achieve maximum audience coverage and space efficiency For example placing the screen along the larger wall in a rectangular room will reduce audience coverage Figure 2 11 shows two examples of how audience coverage is maximized SQUARE ROOMS RECTANGULAR ROOMS Corner placement of screen Screen placement along short wall ields best audience coverage ields best audience coverage Prime Audience Area Prime Audience Area Figure 2 11 Screen Locations for Maximum Audience Coverage Installation type screen type and lighting all affect where the projector is positioned In addition both throw distance the distance between the projector and screen and vertical position the height of the projector in relation to the screen must be determined for every new installation Both depend on the screen size and lens type you are using Make sure that the room can accommodate the required position of the projector for the chosen screen size Throw distance is the distance between the projector s front feet and the screen For any installation an accurate throw distance must be determined in order for the image to be of the right size for your screen the farther the projector is from the screen the larger the image NOTE If your projector
112. duced power level to the lamp at all times choose a specific Power wattage Lamp modes are described below e Max Brightness The lamp will always burn as brightly as possible driven by maximum power of 700W in the 3 93 4 54 1200W in the X5 S5 X6 S6 and up to 1700W self adiusting in the X9 S9 Keep in mind that the maximum brightness for any lamp gradually diminishes with age images will become dimmer over time The current light output level stated as an arbitrary value 1 e unrelated to lumens appears in the Intensity box e Intensity Brightness will remain close to a specified level for as long as possible Once you select this option enter a number representing the intensity level brightness you wish to maintain the projector will automatically adjust power as needed to closely maintain this intensity over time Note that an intensity value is simply an arbitrary value from 0 9999 unrelated to lumens levels in your model See Intensity below e Power The power watts supplied to the lamp will remain at a desired level throughout the life of the lamp Once you select this option enter the number of watts representing the power level you wish to maintain See Power below i In X9 S9 a new lamp needs less than full power to achieve maximum brightness and will in fact limit Incoming power as required to run at 75A During the first few hundred hours of life the lamp arc gradually changes and vol
113. e projector from responding to a particular wired keypad protocol or you can ensure that the projector responds to either protocol default You can also prevent the projector from responding to the keypad entirely In the pull down list select the desired protocol NOTE The wired keypad for this projector is set at manufacture to Protocol A See 2 10 Keypad Protocols and Conversion for information about changing the keypad protocol ADDING A WIRED KEYPAD PROTOCOL To add a protocol select the A or B option CHANGING A WIRED KEYPAD PROTOCOL As a safeguard you cannot accidentally select an option in the Wired Keypad list that would disable the wired keypad during use since such options are automatically disabled in the list In other words you cannot switch to the opposite protocol or select OFF using the wired keypad Instead if you want to quickly change to the other protocol you may find it more convenient to use one of the other keypads the built in keypad or the IR remote to execute the protocol change for the wired keypad The projector will now recognize Roadster Vista User s Manual 3 45 OPERATION wG lt wmaan gt u oxrnszli010O 1 lIUIWIIIIKI I NW I I I II I II I I I I I III lt I9I9IoO lt III I IIY lt lt e pp ls ahI _ 8 lt a h l l amp a5a5 x h X 3 46 Roadster Vista User s Manual only the opposing wired keypad protocol Or if you prefer use the wired ke
114. e color reproduction of NTSC video signals or HDTV signals Use lt J and until the desired balance or red to green is displayed in your image It is best to adjust tint while displaying an external test pattern otherwise it is recommended that tint remain at its default setting For a shortcut to Tint slidebar press at any time SELECT COLOR TEMP Select Color Temp applies either a 1 3200K preset color temperature 3200K 5400K 6500K or 9300K or 2 5400K any previously User defined color temperature Color gt 3 6500K temperatures are measured in degrees Kelvin and represent 4 9300K coloration reddish or bluish of the whites displayed by the 9 User1 projector the lower the temperature the more reddish the 6 User2 whites the higher the temperature the more bluish the whites Y 9 Interpolated NOTE The custom temperatures User or Interpolated Color can be defined in the Color Temperature Setup menu Until defined these custom choices all default to 6500K See 3 8 Configuring System Parameters INTERPOLATED COLOR Use this option if you need a specific color temperature that lies somewhere between one preset color temperature and another Adjust the slidebar to define a new temperature which will be interpolated from the neighboring presets for example 7841 is interpolated from 6500 and 9300 This slidebar is disabled unless you have a source connected and have selec
115. e reached the last projector in the chain so that only the last projector has an empty RS 232 OUT or RS 422 PORT if applicable See examples below
116. e top and bottom edges of the screen For details see 3 6 Adjusting the Image i Expand vertical software control Figure 2 7 Adjusting a 4 3 Video Image Using a 4 3 Screen with S Models If you are using a 4 3 screen with S models which produce 5 4 images images will by default slightly overlap the screen vertically To remedy reduce Vertical Stretch so that the too tall 5 4 image no longer spills over the top or bottom of the screen Figure 2 8 This control eliminates the need for simply moving the projector farther from the screen which would result in black borders for all sources See 3 6 Adjusting the Image NOTE The Vertical Stretch adjustment may soften the image slightly but is not noticeable in most cases Default Reduced Vertical Stretch Top of image Top of screen Bottom of screen Bottom of image 4 Figure 2 8 Using a 4 3 Screen for a mix of 5 4 and 4 3 sources S models The high brightness output of this projector is certainly well suited for locations where ambient lighting is less than optimum for projection yet there are still many simple things you can do to optimize your installation Visiting a movie theater can give you an idea of what makes an ideal projection environment Walls floors and furnishings are dark and matte finished A projection room should not have white reflective ceilings or non directional lighting such as fluoresc
117. e unplugging the power cord make sure the internal lamp cooling fans have shut off The fans automatically shut off when the projector has adequately cooled down Slots and openings in the projector provide ventilation To ensure n iV AINTENANCE 4 2 4 3 Servicing Cleaning Lens Lamp Case Replacing Keypad Batteries reliable operation of the projector and to prevent overheating these openings must never be blocked or covered The projector should never be placed near or over a radiator or heat register The projector should not be placed in an enclosure unless proper ventilation is provided For best results ensure that the projector bottom is above any lip that may be present on a cart extend projector feet as necessary Do not push objects of any kind into the projector through the ventilation openings They may touch dangerous voltages or short out components resulting in a fire or shock hazard Do not spill liquids of any kind into the projector Should an accidental spill occur immediately unplug the projector and have it serviced by a qualified service technician If any of the following conditions exist immediately unplug the projector from the power outlet and refer service to qualified service personnel e The power cord has been damaged e The internal cooling fans do not come on when the projector is first turned on e Liquid has been spilled into the projector e The projector has
118. e you connected in Step 2 The display will resize as needed producing an image as large as possible for the type of source present STEP 6 Adjust Image NON MOTORIZED MODELS e ZOOM With the input image displayed rotate the textured ring on the lens barrel to increase or decrease the image size this requires a zoom lens If you don t have a zoom lens or you can t adjust the image enough the projector may not be positioned at the proper throw distance for your screen size Power down unplug the projector and move it towards or away from the screen See 2 3 Projector Position and Mounting for details e FOCUS At the lens opening turn the focus tab to focus the image clearly e OFFSETS Turn either or both of the knobs adjacent to the lens if you need to align the image with your screen turn the top knob to raise or lower the image turn the bottom knob to shift the image left or right Re check focus OTHER Press to refine other display parameters as described in Section 3 Adjust Image MOTORIZED MODELS NOTE Motorized lens controls are standard on Roadster models only With the input image displayed press on any keypad Scroll menu with and Lens Control zu A 055 x 2 2 Roadster Vista User s Manual Focus 3140 DZ Lens Horizontal Offset 4881 Lens Vertical Offset 2664 Intelligent Lens System 1 Calibrate Lens Center Lens Figure 2 1 Motorized
119. ear panel of the projector provides standard input panels to which you may connect a variety of sources See Figure 2 16 the lower left area INPUT 1 typically accepts an RGB signal from an external RGB source or it can also be used for YPbPr signals or additional video sources The upper right panel the Video Decoder Module accepts only composite video at INPUT 3 or S video at INPUT 4 from devices such as VCRs laser disk players or DVD players There are also several optional interfaces available for connecting other sources at INPUT 2 Such an option installs in the upper left area just below the audio connectors if present For any input including the optional inputs audio with loop through connects at the audio input panel located between the license label area and INPUT 2 audio is standard on Vista only NOTES L Audio connectors are standard on Vista models only 2 For all connections to the projector use only high quality shielded cables Audio Serial Control All Inputs RS 422 IN1 IN2 IN3 IN4 OUT O O lt z s o o OIL O m 5 RS 422 666 775 w Port 2 Video Decoder Optional Input Input Input 2 COMPOSITE VIDEO S VIDEO Input 3 Input 4 e Video Decoder LOOP 9 RZ L LOOP l p 5 0 Module 804600 INPUT 1 REMOTE LU
120. ector at a time Note that the front and rear IR sensors cannot respond to different protocols if you change a protocol for either sensor to anything other than OFF the protocol for the other sensor also changes For example setting Front IR to B also changes the Back IR to B If you want only one sensor to respond to a particular protocol A B or A or B disable the other sensor by setting its protocol to OFF If you want to disable both IR sensors you cannot use the IR remote keypad to select the second OFF setting This safeguard prevents accidentally disabling a keypad while you are using it Instead use either the built in keypad or the wired remote to set the remaining active sensor to OFF The projector will no longer respond to an IR remote keypad IMPORTANT Keep at A OR B unless you are sure of the current IR keypad protocol NOTES L The IR remote keypad for this projector is set at manufacture to Protocol A See 2 10 Keypad Protocols and Conversion for information about changing the keypad protocol 2 A key press from a conflicting protocol will cause a single yellow flash on the Status LED located in the lower right corner of the rear projector panel Wired Keypad Like the IR remote keypad the optional wired keypad is either a Protocol A keypad default or a Protocol B keypad Likewise the projector can be set to accept wired keypad data accordingly responding to A or B If desired you can prohibit th
121. ed in this projector a Marquee Signal 38 804606 xx Switcher or a Marquee Case Power Supply The module receives analog RGB input signals from computers or other RGB source devices r sync R HORICOMP VERT AUDIO IN RGB INPUT MODULE 801001 Roadster Vista User s Manual F 1 OPTIONAL INPUT MODULES M RGB400BA Input Module 38 804610 xx RGB400 Active Loop Thru F 2 Input Module 38 804607 xx Roadster Vista User s Manual RGB500 Features Q accepts 3 4 or 5 wire RGB video sync on green composite sync or separate horizontal and vertical sync up to 500 MHz bandwidth Q BNC connectors for RGB signal inputs NOTE The audio connectors are not functional Connect audio to the projector s IN 2 audio port if available standard on Vista models only The RGB400 Buffered Amplifier Input Module may be installed in this projector In a Marquee Signal Switcher or in a Marquee Case Power Supply Connect three four or five wire RGB video signals of up to 400 MHz bandwidth signals typically produced by high resolution computer or workstations The buffering capability of the module enables the incoming signal to be sent to a remote destination Inputs are 75S terminated r 5YNc R GREEN BLUE HOR COMP VERT AUDIO IN RGB INPUT MODULE 801001 RGB400BA Features Q accepts 3 4 or 5 wire RGB video sync on green composite sync or separate horizontal and vertical sync Q BNC connectors for
122. een this source and the AGC DECODER LUMA DELAY This control affects any incoming composite or S video signal delaying the luma signal intensity in relation to the chroma color In the image increasing the luma delay will move luma seen as a shadow where colors overlap to the right slightly with colors remaining in place Decreasing this delay will move the shadow slightly to the left If necessary for your current source adjust so that no shadows occur with adjacent colors Input Levels NOTES 1 It is recommended that only experienced users use the Input Levels submenu the projector automatically optimizes input levels for all but the most unusual of sources 2 Before attempting an input level adjustment check that overall contrast and brightness settings are near 50 and that color temperature is properly set up on an internal grayscale test pattern 3 There must be at least one white pixel present in the image for proper Auto Input Level function Leave this control off n OPERATION Input Levels Always OFF before levels that is the n drives and blacklevels 1 Auto Input Level open y OE the three 2 Red Pr Blacklevel 50 2 1 d d 3 Green Y Blacklevel 50 2 Levels adjust Colors red green an 4 Blue Pb Blacklevel 50 2 277 automatically blue ensure that 5 Red Pr Input Drive 50 2 2711 1 7 20 222 images from analog 6 Green Y Input Drive 50 2 NOTE I
123. eight side in order for the lamp to function safely To make small corrections to the projector s level rotate each leg as necessary to raise or lower For angled installations see Special Mounting under 2 3 Projector Position and Mounting earlier in this section w gt gt 5 gt 5 0 l l ls j US R SSS INSTALLATION AND SETUP Me Once the projector is properly set up and producing an image you are ready to make 2 8 Zoom Focus t Lens Offset Zoom Focus Lens Offset 1 Intelligent Lens System ILS quick lens adjustments Refer to 3 3 Using the Keypad and 3 4 Navigating the Menus if you are unfamiliar with using the keypad and menu system NON MOTORIZED If you have a zoom lens installed turn the textured ring of the lens barrel to decrease or increase the size of the image at the current throw distance MOTORIZED If you have a zoom lens installed press to display the Lens Control menu Select the Zoom option 2 and adjust image size as desired with 4 or Refer back to Figure 2 1 A VVARNING A Keep fingers away from the lens opening when operating the motorized zoom function NON MOTORIZED Near the lens opening turn the lens focus tab until the image 1s as sharp as possible MOTORIZED Press to display the Lens Control menu Adjust image clarity as desired with lt or gt Refer back to Figure 2 1 NOTES 1 Initially your image may be so blurry you cannot recog
124. emote Two Way Controller to control the projector For operating details please see the Two Way Controller User s Manual included with this accessory 2 Old VistaGRAPHX Roadie style keypads can be used with this projector but the key codes listed on the back are different and do not apply Keep in mind the following guidelines 1 Press keys one at a time there are no simultaneous key presses required 2 For any key having an ower for example hold the key for approximately 1 second in order to toggle the function with a single key press For other keys or to use a key in conjunction with or FoF a momentary press similar to a mouse click is sufficient 3 Press the lightbulb key to temporarily illuminate the backlight for the keys without sending any other command 4 lt gt and repeat their arrow actions when held down For other keys release and press again to repeat an action In a network pause between adjustments to ensure that the last projector can keep up with the commands 5 If you press a key while the projector is busy with another action such as during a power up the key press may not take effect When you turn on the projector it begins operating at presentation level such as an image from the most recently used source signal The projector temporarily leaves presentation level whenever you use the keypad to work with control settings display menus or on line
125. ent If so check your source connections again The room lighting may be too bright Lower the intensity of the room lighting Reduce light reflections as much as possible Increase contrast and or brightness of image The projector may be too far from the screen Move the projector closer Is the Status LED flashing a pattern of yellow and red lights while the Power LED is steady red This indicates an internal system error that may prevent the projector from operating If the problem persists contact a qualified Christie service technician The projector does not respond to the infrared remote keypad I 2 Does the built in keypad work If so check that the keypads are enabled Does the green Status LED flash each time a key is pressed If not the projector 15 not receiving the keypad s IR signals Ensure the keypad is directed to either the front or rear of the projector or towards the screen The viewing path between the IR keypad and the projector or screen may be blocked Ensure there is a clear line of sight between the keypad and the projector or screen The batteries in the IR remote keypad may be weak Refer to 4 3 Replacing Keypad Batteries for instructions on how to replace the batteries There may be unusual lighting conditions in the room affecting IR keypad operation Determine if such conditions exist and correct When broadcasting in a network enter numbers directly on the keypad rather than holding
126. ent the lens barrel of a zoom lens optional rotates to adjust the size of the image without moving the projector Minimum and maximum image sizes depend on which zoom lens is installed see Section 5 Specifications FOCUS Accessed manually in some models via 2 tabs on the lens or with a keypad if a motorized lens is present focus adjusts the sharpness of the image at the current throw distance LENS OFFSET Operated manually in some models or with the keypad if a motorized lens 1s present vertical and horizontal offsets shift the lens and move the image up or down and left or right See Section 2 Installation and Setup for the offset ranges for any given lens These are also listed on page 5 1 SHUTTER Closing the shutter blocks the lens internally and turns the image to off The shutter is controlled with the keypad NOTE OPTIONAL IN SOME MODELS EYEBOLTS Raad te Insert in feet holes for suspending a single inverted 2220 only SIDE HANDLES Raadte For safety straps or for brief hand transport Raaaster models only STACKING SLOTS Raadte For stacking of 2 models NOTE Stacking requires a separate hardware accessory kit See Section 2 A wARNING A When stacking projectors you must use Christie stacking hardware available separately in the slots LAMP SIDE PANEL For accessing the Intertor lamp door and replacing the lamp module NOTE Lamp replacement requires a qualified service techni
127. ent lights The white ceiling spreads light making the room appear brighter Keep lighting and reflections to a minimum If it is not possible to eliminate fluorescent lights consider using incandescent spot lighting or parabolic reflectors egg crates to direct light down to the floor Light dimmers or rheostats allow further control Outside windows are undesirable in any projection room A small crack between curtains on a sunny day can wash out a projected image If you do have windows make sure that window coverings are opaque and overlapping some window coverings are designed to provide up to 100 percent blockage of outside light Ideally the material should have a matte finish HANI INSTALLATION AND SETUP Other Considerations To minimize the effects caused by unwanted light from door and aisle ways carefully choose the position of your projector and screen Figure 2 9 shows an installation where poor screen placement allows too much unwanted light to enter the screen In Figure 2 10 screen and the projector are positioned so that unwanted light is minimized III 7 III unwanted light unvvanted light 1oop window Figure 2 9 Poor Screen Placement o Prime Audience re o o window Figure 2 10 Better Screen Placement Even with all lighting removed it is still possible that room reflections within the room can slightly degrade the
128. entation for an illustrated explanation Language Choose from English French Spanish German and Italian language The menus will change immediately upon selection Menu Preferences Choose the options in this menu to Menu Preferences adjust the appearance content and or 4 Many Location 4 3 TopiLeft v location of on screen menus Horizontal Shift 5 HE displayed in presentation level Vertical Shift 6 10 aun Display Channel 6 1 Display Slidebars 1 Display Error Messages All v Large Menu Font C MENU LOCATION Use the pull down list to choose a pre defined or customized default location for the display of on screen menus 5 f Figure 3 22 Menu Preferences Menu To create a custom menu location choose a preset that is closest to the desired area Then adjust the slidebars of Horizontal Shift and Vertical Shift to move the menu to the desired location To prevent cropping of larger menus avoid locations too close to a corner or edge HORIZONTAL SHIFT AND MENU SHIFT Shift your menus as desired creating a customized menu location DISPLAY CHANNEL LIST Enter a checkmark if you want to see a scrollable channel list whenever you press from your presentation These channels must be marked with a list icon in the Channel Setup menu This option also enables on screen feedback when using the key If you prefer to hide the channel list and input dialog box while swit
129. entering a checkmark wait for the six values to stabilize then delete the checkmark and exit BLACKLEVELS AND DRIVES To check your image and adjust these controls 1 Make sure overall Contrast and Brightness are both set to near 50 NOTE Not required for Auto adjustment 50 approx 50 approx 2 Check the color temperature setup using an internal grayscale test pattern adjusting as desired to obtain a neutral grayscale NOTE Not required for Auto adjustment 3 Make sure you are using an analog source not connected to INPUT 3 or INPUT 4 as Input Levels are not applicable for digital sources or sources going through the decoder A grayscale is recommended 4 If the blacks and or whites appear OK input levels do not need adjustment If black levels are too high and or whites are too low which is rare you likely have a noisy source that is producing skewed input levels Continue with Step 5 5 Temporarily enable Auto in the Input Levels submenu Wait for all 6 values to stabilize Alternatively do not use Auto reduce blacklevels manually instead Judge by eye and change one or more of the six levels as necessary to obtain proper blacks and whites You may want to see Roadster Vista User s Manual 3 37 OPERATION j Y IIIKI I HI UW amp I III I4II 9T III CRkY G k NE I IW IEIE I IEI lt Y ZDIIII W I I III I w II II I I I II I E II
130. enu Font S eO N OOP O Diagnostics amp Calibration 1 Test Pattern gt See s Fleeze Image Color amp Uniformity lt 3 Color Enable 4 Odd Pixel Adjust gt Odd Pixel Adjustment o 5 Reserved 2 Reserved s oe 6 Reserved Red Pixel Offset 3 Reserved wee 1 Off lt 2 Checker Green Odd Pixel Offset 3 Gray 16 Blue Odd Pixel Offset Color Temp Setup lor T Set 4 Gray 256 ini Red Odd Pixel Gain Sele l S 3200K 5 White Green Odd Pixel Gain Select Color Temp 5400K 6 Gray Blue Odd Pixel Gain Interpolated 6500K 7 Black 2 Color Enable Red White Level 7 f f User in 7 User 2 0 Color Bars 1 User 3 Geometry Color Enable User 4 Copy From Interpolated Tiling Setup 1 Number of Rows 2 Number of Columns 3 Projector Row 4 Projector Column 5 Resize Presets 5400K 6500K 9300K User 1 User 2 User 3 Lamp Hours Lamp S N Lamp Message Lamp Limit Lamp Mode Max Brightness Status read only Power 2 Intensity User 4 Intensity 3 Power Factory 3200K Model Lamp History Factory 5400K Serial Factory 6500K Lamp Hours amp Counter dicated Lamp Serial Number Factory 9300K Projector Hours 3 Text editing box Lamp History Chan Name Chan Number Read only list Switcher Slot IPM Interconnect Panel Driver LCD HW SW Optim
131. er Input Module Composite S Video Input Module PC250 Analog Input Module Serial Digital Input Module Digital HDTV Input Module DVI Input Module Other Advanced Digital Processing ADP Module Roadster Vista User s Manual 5 5 Appendix A Glossary This appendix defines the specific terms used in this manual as they apply to this projector Also included are other general terms commonly used in the projection industry Active Line Time Ambient Light Rejection Analog Video Aspect Ratio Auto Source Backlash Zone Bandwidth Baud Rate Blanking Time Brightness Candela or Candle Channel Channel List The time inside one horizontal scan line during which video is generated The ability of a screen to reflect ambient light in a direction away from the line of best viewing Curved screens usually have good ambient light rejection Flat screens usually have less ambient light rejection The video output of most computers and video tape machines Analog video can generate a large number of colors The ratio of the width of an image to its height such as the 4 3 aspect ratio common in video output The ability of the projector to automatically recognize and synchronize to the horizontal and vertical scan frequencies of an input signal for proper display The extra travel distance required for accurate lens mount positions in a Roadster Vista or Mirage projector having a motorized lens mount
132. erature for a connected source INTERPOLATED COLOR Select this option if you need a specific color temperature that lies somewhere between one preset color temperature and another Adjust the slidebar to define a new temperature which will be interpolated from the neighboring presets for example 7841 is interpolated from 6500 and 9300 It can be used any time and appears as a 4 digit temperature when in use NOTE This option is disabled unless you have a source connected and have selected Interpolated Color in the Select Color Temp pull down list WHITE LEVELS These 3 controls are adjustable only if a User choice is selected in which case User 1 2 3 or 4 appears at the top of the Color Temperature Setup menu Their current values are shown for the active color temperature Changing a white level here changes the drive contrast for that color essentially creating a new color temperature that is warmer or cooler etc For maximum overall brightness always keep at least one white level at 100 When you are satisfied with the new User temperature it can be used immediately upon exit or it can be selected from either the Image Settings menu or the Color Temperature Setup menu as usual You can re define a User color temperature at any time using the Color Temperature Setup menu COLOR ENABLE Select which color or colors you want to see useful while working with color temperature white leve
133. erature that has 9 User been altered and you want instead to use 6 User2 the original factory calibrated color 1 Users temperature without clearing the entire ry 3200K proyector memory you can use the s A Factory 5400K Copy From option in the Color of the projector Factory 6500K Temperature Setup menu to set up a Factory 9300K User temperature with settings from a permanent factory preset Figure 3 19 Presets and Factory Presets 1 Select the User color temperature you wish to update at the top of the Color Temperature Setup menu such as User 2 2 From the Copy From list select the matching temperature labeled Factory such as Factory 5400K These are the calibrated color temperatures set at manufacture they remain intact for the life of the projector 3 The setups for the User color temperature you selected at the top of the Color Temperature Setup menu will now be updated replaced by those for the permanent factory calibrated temperature you selected in the Copy From list Again a User temperature can be altered at any time if desired Video Options Not applicable to graphics sources Video Options VIDEO STANDARD The projector Video Standard TA v I 2 Input Video Black automatically detects the video standard 3 VCR i present and displays the name of this 4 Video Termination 6 17 standard here Press to view or 5 Enable Decoder AG
134. es and status INFRARED SENSORS The infrared IR sensors on the front and rear of the projector receive infrared signals from the IR keypad for remote control of projector functions For proper operation make sure that these sensors are not blocked HARD RESET Emergency access for powering down the projector in the event of a system failure Insert a pen point or small screwdriver en hoc keypad appears in three locations 3 3 Using the Keypad Roadster Vista User s Manual e Built in to the rear of the projector e Infrared IR Remote for tetherless control up to 100 feet away e Wired Remote optional tethered to the rear of the projector n OPERATION While each keypad is identical in layout and provides complete control of the projector you may find one keypad more convenient than another for your specific installation and application Built in built in keypad is located at the rear of the projector An LCD window above this keypad
135. es for zoom lenses appear in graphs only Table E 1 Throw Distance Formulas Lens Throw Ratio Throw Distance Formula ft 5 Diagonal Screen Size ft 0 8 1 Vista GRAPHX 79 x screen width lt ft 81 1 24 x ereen width oft 82 1 5 2 2 1 zoom Min 1 52 x screen width ft 57 5 40 Max 2 26 x screen width lt ft 44 5 40 2 2 4 1 zoom Min 2 23 x screen width lt gt ft 61 Max 4 09 x screen width lt ft 36 2 5 4 1 zoom Min 2 44 x screen width lt gt ft 90 Max 3 92 x screen width lt ft 72 4 7 1 zoom Min 4 03 x screen width lt ft 57 ku Max 7 13 x screen width lt ft 27 4 7 ZOOM VistaGRAPHX Min 3 93 x screen width lt gt ft 66 ae Max 6 85 x screen width lt ft 51 NOTES 1 Make sure to use HORIZONTAL screen size in all formulas 2 The 0 8 1 lens is not recommended for use in S models Roadster Vista User s Manual E 1 THROW DISTANCE E 2 Roadster Vista User s Manual 0 8 1 Fixed Lens and 1 2 1 Fixed Lens 0 8 1 Lens Throw Screen Distance ft 3 98 4 37 4 77 4 45 O1 5 6 5 T 1 5 co 5 93 8 33 8 73 9 12 9 5 10 10 5 1 7 12 12 5 13 13 5 14 14 5 15 15 5 16 16 5 17 17 5 18 18 5 19 19 5 20 9 91 10 31 10 71 11 10 11 50 11 89 12 29 12 68 13 08 13 48 13 87 14 27 14 66 15 06 15 45 15 85 16 25 16 64 L6 7 5 9 95 10 105
136. etup 77 01 EA 04 p4WH 48 73 4 60 014 02 02 iDig 1stdisplay Setup menu press 3 or 03 A 0 1 66 33 72k 60 00 move the highlight to the 4 Channel Setup option and N location signal iype H sync V sync press Ente The Channel A locked auto source that appears in the Chan list S etup menu vvill appear An unlocked auto source that does not appear in the list see sample at right Figure 3 10 AlI Channels Appear in the with the active channel Channel Setup Menu highlighted WHAT APPEARS IN THE CHANNEL SETUP MENU As shown in Figure 3 10 this menu lists all channels defined so far and indicates how they are connected to the projector The far left column contains current channel numbers defined The values in the far right columns indicate horizontal and vertical frequencies if a name has been defined for this channel it appears here instead Other columns contain details pertaining to each channel setup such as its switcher number slot location a variety of icons indicating access to the channel and an abbreviated description of each signal type See Editing a Channel Setup for details 3 20 Roadster Vista User s Manual n OPERATION Copying or Deleting Channels SIGNAL TYPE Either channel list whether the key list or the Channel Setup menu identifies signal types in a shortened form as defined below These descriptors indicate what signal information the pro
137. f more than one channel exists for the input the image will be displayed according to the setup parameters for the first channel with matching characteristics CHANNEL A channel is a collection of measurements locations and settings that tailor a display to your specific needs Since source types and applications can vary greatly you will likely want to adjust and define a wide variety of parameters such as brightness contrast tint size etc in order to customize and optimize the display coming from a particular source For example the display settings you choose for a VCR source may be very different from those you choose for a high resolution computer source or one signal may simply vary from another signal used earlier through the same input location Once you have adjusted a display parameter such as pixel tracking or contrast all current settings are collectively stored in the projector s memory as a unique 2 digit channel such as 0 9 You can have numerous distinct channels available for the same input any of which can be selected by using the key on the keypad followed by the 2 digit channel number NOTE The key may display a channel current channel list or not depending on what you have Channel 02 defined within the Menu Preferences menu 01 0 2 pDig 64 09k 60 12 see Menu Preferences later in this section 02 04 i3LG 33 72 59 94 Shovvn at right is a sample channel list 03 0 4 iSVid 15 73k 59
138. f there is a 1 pixel wide pattern present adjust Odd Pixel Adjustment gain for the current color Stop when the pattern disappears and the area is smooth 6 Repeat for each color adjusting offset then gain for each NOTES 1 Adjust offset before gain since offset affects gain 2 A value of 128 represents no change in normal odd pixel offset or gain 3 Odd Pixel Adjustment eliminates I pixel on I pixel off patterns only not any type of larger patterns Reserved No function for these options Service The Service submenu offers the ability to enable or disable service passwords and to work with factory defined color temperatures and other functions This submenu is password protected and intended for use by qualified service technicians only Use the checkboxes and pull down Communications lists in the Communications 1 Baud Rate 19200 submenu alter methods or 2 FrontIR AorB v types of communication to and 3 BackIR AorB v from one or more projectors 4 Wired Keypad AorB _ vi NOTE Changes made to the 5 Broadcast Key Communications submenu will be 6 Projector 6 000 saved upon exit of the menu it STU CTI m Figure 3 24 Communications Menu Baud Rate The baud rate setting determines the speed of communication to and 1 1200 from the projector By default the projector baud rate is set to 19200 2 2400 Setting the correct speed is important when you are co
139. ged and then projected to the screen through a single front lens where all pixels are perfectly superimposed as a sharp full color image How The Projectors Work ee Included with Vista and Roadster 15 an infrared IR remote keypad a power cord a 1 2 Components 9 64 hex socket ball driver eyebolts Roadster only and a Roadster Vista User s Manual Make sure that you received everything 9 64 Hex Socket Driver Line Cord Figure 1 1 Components SHOWN Raadt WITH ADDED LENS Differences Between Roadster and Vista Models Motorized Lens Shutter Audio Handles amp Slot Covers Stacking Slots Eyebolts Roadster U U discontinued U U U U Standard MODELS and AVAILABILITY The Roadster line and the Vista line both offer models differing in light output and or image resolution All combinations are documented in this manual however the following models are no longer manufactured Roadster X4 S4 Vista SS ee whetherthe projector is under warranty or the warranty has expired Christie s 1 3 Purchase highly trained and extensive factory and dealer service network is always available to Record and quickly diagnose and correct projector malfunctions Complete service manuals and Warranty updates are available to service technicians for all projectors Registration Should you encounter a problem with the projector and require assistance contact your dealer or Christie In many cases any necessary se
140. h may be smaller or larger than the native resolution of the projector All Size Vertical Stretch H Position V Position or Blanking values will change accordingly For example for a source with a native resolution of 800 x 600 No Resizing will center a small image within a black border Conversely an HDTV image is wider than both 1024 and 1280 and will be cropped on the sides or in the case of 10801 HDTV cropped at top and bottom too With No Resizing signals with non square pixels such as video connected to INPUT 3 or INPUT 4 produce distorted images that are too tall or too wide See below No Resizing If 800 x 600 signal If NTSC PAL SECAM If HDTV If HDTV 1080i Hi I I 800 variable borders image cropped at sides image cropped all around e Select FULL SCREEN to use all pixels 1024 x 768 Full Screen in X models 1280 x 1024 in S models displaying the image regardless of source or original aspect ratio See right NOTE SXGA resolution shown For all sources Select FULL WIDTH to fill the display from left to Full Width right Depending on the source this may create top EXAMPLE and bottom borders 820 Image SSS 1280 OPERATION e Select FULL HEIGHT to fill the display from top to Full Height bottom Depending on the source this may
141. hange a lens follow the steps below NOTES L You will need a 9 64 3mm or 3 5mm hex socket ball driver supplied with projector or allen key for this procedure For motorized zoom lenses you may also need a remote keypad and flashlight 2 Top or bottom references assume a non inverted projector as illustrated 3 If you are installing a VistaGRAPHX lens first make sure its VistaGRAPHX Lens Adapter is present on the lens Such an adapter flange secures to the projector in the same manner as the flange described below but accommodates a screw mount lens Before removing a motorized zoom lens you must adjust zoom in order to reach lens mount screws accessible through holes in the zoom gear 1 POWER UP AND CALIBRATE THE LENS MOUNT if not already done 2 ADJUST ZOOM GEAR TO 1000 FOR ACCESSING SCREWS Press zoom adjust Set to 1000 Turn off the projector cool and unplug Before removing or installing any lens turn off the projector and allow fans to stop before unplugging Make sure that the lens cap is on A WARNING A Unplug the projector D gt Figure 4 10 Install lens cap Loosen the 3 lens mount screws NOTE If there is no lens installed skip to Step 4 Roadster Vista User s Manual 4 9 MAINTENANCE I III II 9I I I lt I III I lt KZII I II IIVIKC lt I KIZIII II I zI II lt I lt I I I II I lt IIIII u4 I SI IIIIII I II IEI 4 IYI YI
142. has suddenly frozen or an unknown menu has appeared 1 You may have accidentally entered a special engineering code using the key in combination with certain numbers or you may have selected the Freeze Image option Press as necessary to cancel the function and return to presentation level 2 the screen blacks out inexplicably it is possible that excessive voltage noise on the AC or ground input has interrupted the projector s ability to lock on to a signal Turn the projector off wait for the lamp fans to stop and unplug Plug in again and power up as usual The display is not sharp or clean 1 More display adjustment may be required focus brightness contrast pixel tracking pixel phase and detail 2 If you are using a BNC T connector try using a distribution amplifier to boost signal levels 3 Is the video input signal properly terminated Set in Video Options menu The screen size may be too large As screen size increases magnification increases reducing brightness and clarity See lens specifications in Section 5 5 The source input signal may be of low quality Try another source Roadster Vista User s Manual 4 15 MAINTENANCE I II lt I I CI I I I I II I I IIIII IC CI I I III IIIIZI I UI I I E E 6 I H lt c K I I II I I I IIIAI IEFZIC I IIAII lt E v3 n w wc 4 16 Symptom CAUSE REMEDY Symptom CAUSE R
143. he official standard for PAL and SECAM video signals LINEAR This setting is a straight linear transition from black to white For normal source signals it results in a picture of low contrast with highly elevated low and mid level grays It should be used only with sources that have their own pre applied gamma control COLOR TEMPERATURE SETUP Use the Color Temperature Setup submenu to apply alter add or copy a color temperature or if you want to use an unaltered factory default color temperature This menu is duplicated in other locations By default the projector can utilize any of four calibrated factory set color temperatures 3200 5400 6500 or 9300 expressed in degrees Kelvin For most applications these temperatures will display accurate and realistic colors from a variety of sources They can be selected at any time from the Select Color Temp list in the Color Setup submenu However if you require extra color temperatures you can also add up to five custom color temperatures four User and one Interpolated Color by defining them within the Color Temperature Setup menu each defaults to 6500K until then Any User or Interpolated Color temperature created here is immediately applied or it can be selected at any time from the Color Setup menu as usual regardless of your source or channel Use of the Color Temperature Setup menu is described below NOTE For best results use an inter
144. he output of Max Brightness mode LAMP HISTORY This read only option lists the most lamps most Lamp History recently installed and recorded in the projector Lamp History SIN Hours automatically updates whenever you record a new lamp serial s U 5678 27 number the new lamp is added to the bottom of the list Use CHANGE LAMP Lamp to record the serial Lamp Hours 1999 number for a newly Lamp S N 1234 installed lamp 1 Lamp Message 2 Lamp Limit 2000 EF 3 Lamp Mode Power In the Lamp S N 4 Power 700 New SIN entry Lamp History window use the 5 77 SIN Hours 6 Lamp History amp History 1234 1999 number text entry 7 ChangeLamp Lamp 5 415678 5678 0 keys record new lamp serial number and press again to accept Figure 3 28 Recording the New Lamp Serial Number and resets Lamp Hours to 0 the change See Using Slidebars and Other Controls if you need help entering the number Once entered the new lamp serial number will be added to the Lamp History menu and the Lamp Hours timer will reset to 0 Lamp Mode and Lamp Limit remain as they were for the previous lamp and can be changed at any time NOTE Enter a serial number only if you have just installed a new lamp This will help ensure that lamp timer is not reset on an old lamp and that the number of hours logged on the lamp will be accurate A important Always DO record the serial number of a NEW lamp This read only menu
145. he screen must be at least 13 3 feet 4m Aspect ratio describes the proportion of the screen and is expressed as the ratio of width to height such as 4 3 or 5 4 see right Although image size and image aspect ratio can both be adjusted quickly through projector software it is still a good idea to choose a screen aspect ratio which is most appropriate for your intended applications Ideally to exactly fill a screen with an image the aspect ratio of the screen should correspond to the aspect ratio of the image which depends on the source in use For example standard video from a VCR has a 4 3 ratio approximately whereas a high resolution graphics signal typically has a 5 4 aspect ratio By default images from your projector will be as large as possible and with the exception of graphics sources will maintain their aspect ratio NOTE With a few exceptions sources with less than 1280 x 1024 resolution have a 4 3 aspect ratio The normal aspect ratio for 1280 x 1024 sources is 5 4 Roadster Vista User s Manual 2 7 INSTALLATION AND SETUP 2 8 Ideal Room Lighting Roadster Vista User s Manual Using a 5 4 Screen with S Models With one exception XGA images will by default resize to fill an SXGA screen with S models The exception illustrated in Figure 2 7 is that video signals will retain their aspect ratio fill the screen by increasing Vertical Stretch to slightly expand the image to th
146. help For example pressing after startup displays the main menu presentation level is no longer active although the image still appears in the background Press again or to return or leave the menu system and return to presentation level Specific keypad commands are explained below Power ON OFF Press and hold for approximately 1 second to turn the projector on or off with a single key press Or press followed immediately by or if you want to guarantee the correct toggle useful if you are unsure of the present status With multiple projectors use with to direct the power up or power down command to a specific projector or to broadcast as desired NOTES L Whenever the projector is turned off the lamp cooling fans remain on for about five minutes to cool the lamp Never unplug the projector during this time or as a shut down as it can lead to premature lamp failure 2 Avoid turning a projector back on until it has been off for a few minutes hot re strikes of the lamp may reduce lamp life _ L m a a a a a gt R gt gt gt gt gt gt a a p wa w X sss OPERATION Input 1 Press to select the source connected to INPUT 1 on the projector data input This is the same as entering lo OJ Input 2 Press to select the source connected to INPUT 2 on the projector an optional interface This is the same as entering o z Input 3 Press to select the source connected to INPUT 3 on the projector
147. hout traveling through the menu system For example simply press to immediately display the same contrast slidebar accessed with the Contrast option in the Image Settings menu Direct slidebars are listed below LIST OF DIRECT SLIDEBARS Use the arrow keys to adjust a direct slidebar or press and enter a specific number from the keypad then or lt or to save or to cancel When you are done press to save and return to your presentation NOTES L You can still adjust a direct slidebar as usual if the menu display is turned off see or Menu Preferences menu the slidebar just won t be visible 2 A direct slidebar disappears if it is not used within 5 seconds Checkboxes Conditions are present if its adjacent checkbox contains a checkmark To toggle the checkbox simply highlight and press Exte or highlight and use to check and lt J to uncheck For a checkbox that is 9 Broadcast Keys numbered simply enter the number of the option to toggle the checkbox Pull down lists To see a pull down list of options available for a given parameter labeled with a v you can e Highlight it and press e Or enter the menu option number n OPERATION Editing Text Indicates current Configuration selection 1 Image Orientation Front _ 4 Front 2 Language English 2 Rear 3 Menu Preferences 3 Inverted Front lt New Selection 4 Communications 4 Inverted Rear 9 Geometry 6 Color and U
148. ial command Use the following as a guide STATUS LED Off Normal Steady Yellow Initializing Single Green Flash Keypress or serial command received Single Yellow Flash Wrong protocol Continuous Yellow Flash Lamp expired replace the lamp Red amp Yellow Pattern System Error See 3 11 Error Conditions STATUS 2 2 e000 gt hes 29 oe _ J bc POWER nanannnnnnnnn o ULULULULUL L eeee G z POVVER LED Off Projector is unplugged Steady Yellovv Povvered dovvn Steady Green Normal stand by or cool down Steady Red System Error code on Status LED identifies error Figure 3 2 Reading the Status LEDs NOTE A steady red power light accompanied by a coded pattern of red and yellow flashes from the status light indicates an internal system error Consult the rear LCD display for an explanation and see 3 11 Error Conditions Should the problem persist contact a qualified service technician available through your dealer REMOTE WIRED KEYPAD CONNECTOR 3 pin XLR For optional tethered remote control of the projector BUILT IN KEYPAD Alternative location for entering commands NOTE The keypad can be inverted by a qualified service technician Contact your dealer LCD STATUS DISPLAY Visual feedback for monitoring projector activiti
149. iformity Menu 3 42 Color Enable 3 34 3 38 Color Key 3 9 Color Setup Menu 3 32 Color Space 3 31 Color Temperature 5 1 How to Copy 3 34 Interpolated 3 34 Modifying a Setup 3 34 Presets and Factory Presets 3 35 User 3 34 Color Temperature Setup 3 33 Communications Menu 3 42 3 44 Component Video 2 17 Components 1 2 Location and Use 3 1 Composite Video Connecting 2 18 Extra 2 22 Loop Through 2 20 Configuration Menu 3 41 Contrast 3 30 Contrast Key 3 9 3 30 Contrast Ratio 5 1 Custom Sizing 3 26 D Dark Interval 3 40 Decoder Luma Delay 3 36 Detail 3 31 Detail Key 3 9 3 31 Diagnostics and Calibration 3 43 Display Channel List 3 41 Display Error Messages 3 42 Display Slidebars 3 42 DVI DFP Input Module 3 30 Roadster Vista User s Manual INDEX 1 E Enable Decoder AGC 3 36 Enter Key 3 8 Error Messages 3 54 Bad Sync 3 55 H Sync or V Sync 3 55 Input Signal Errors 3 55 Invalid User Entry 3 55 No Signal 3 55 System Warnings Errors 3 55 Errors 3 54 Exit Key 3 8 F Features 1 1 Filter Air Replacement 4 8 Filter Air Warning 4 2 Filter Image Adjustment 3 28 Filter Motion 3 39 Flat Panel Sources 3 30 Flying the Projector 2 3 Focus 2 2 2 7 2 25 3 2 Troubleshooting for Motorized 4 14 Folded Optics 2 15 Formats Video 5 2 Freeze Image 3 43 Front IR Keypad 3 45 Full Height 3 27 Full Screen 3 26 Full Width 3 26 Function Key 3 12 G
150. in Section 3 Geometry From the Configuration submenu select the Geometry Geometry submenu to adjust your display shape 1 Keystone 50 07 work with lens define a multi screen mapping 2 n of Incoming source material or to work with test A Tiling Setup patterns The Reserved option has no function 5 Test Pattern Off KEYSTONE and TILING SETUP Refer to Figure 3 23 Geometry Menu descriptions under Size and Position earlier in this section Controls are duplicated here for convenience during setup LENS CONTROL For a full description of the Lens Control submenu see 3 3 Using the Keypad es key and 2 8 Zoom Focus and Lens Offset TEST PATTERN Use the pull down list to select and display an 94 og internal test pattern Select OFF to turn off the display of a test 2 Checker pattern Gray16 Gray256 White Gray Black Convergence 13 Point Color Bars Geometry SHORTCUT Use key s se IC s Color and Uniformity Use the options in the Color and Uniformity submenu Uniformity Reserve to define color temperature primary color hues and or 2 Reserved to achieve consistent brightness throughout all display 3 Color Temp Setup areas This submenu is typically used in multiple projector applications that require precise matching n OPERATION between adjacent displays for Roadster Vista models only Color Temp Setup is available COLOR TEMP SETUP See Image Sett
151. ings This function is offered in multiple menu locations for convenient access Auto Power Up Enter a check mark to enable the projector to automatically power up after losing power due to a power failure or due to unplugging the projector during operation Note that unsaved display adjustments may be lost Diagnostics and Calibration From the Diagnostics and Diagnostics and Calibration Calibration submenu you can 1 Test Pattern Geomet v access several options for testing 2 Freeze Image and setup of images You can 3 Color Enable White v work with test patterns and 4 Odd Pixel Adjustment specific colors freeze an image for inspection and or access the Odd Pixel Adjustment menu for precision settings of offset and gain TEST PATTERN Refer to description under Geometry submenu COLOR ENABLE Refer to description under mage Settings FREEZE IMAGE Enter a check mark to freeze stop an image at a single frame This diagnostic tool is useful if you need to examine in detail a still version of the incoming image that cannot be frozen at the source For example in moving images it is sometimes difficult to observe artifacts such as external deinterlacing resizing and signal noise Remove the checkmark to return back to normal ODD PIXEL ADJUSTMENT For sources with Color Space set to Odd Pixel Adjustment RGB only 1 Red Odd Pixel Offset 128 5 Adjust 2 Green Odd Pixel Offset 145
152. inimum 450 watts in the X3 S3 X4 S4 800 in the X5 S5 X6 S6 and 1200W in the X9 S9 the intensity settings will be inaccurate and cannot be maintained Note also that lamp power of 550W or higher is required for any 700W lamp having more than 500 hours on it Make sure your Intensity setting is high enough to keep the corresponding lamp power at 550W or higher For best results in matching intensity over in tiled images choose an intensity setting that enables all lamps to operate at less than the maximum number of watts available in your projector but above 550VV See Power above Precise behavior with newly installed lamps in X9 S9 is described in footnote 1 on the previous page Because a new lamp in X9 S9 can emit maximum brightness without initially requiring maximum power adjusting Power or Intensity slidebars beyond this point produces no additional light output This is normal for these models Roadster Vista User s Manual 3 49 OPERATION wG lt wmaan gt u oxrnszli010O 1 lIUIWIIIIKI I NW I I I II I II I I I I I III lt I9I9IoO lt III I IIY lt lt e pp ls ahI _ 8 lt a h l l amp a5a5 x h X 3 50 p s 3 9 Projector Status Roadster Vista User s Manual NOTES L Lamps become more stable over time thus a specific intensity is more easily maintained as the lamp ages 2 Intensity can be set only if the lamp is in Intensity mode 3 Intensity cannot exceed t
153. ips for Lens Settings and ILS NOTE Accurate ILS performance requires a calibrated lens mount Calibrate after installation of a lens and repeat if the lens is moved or bumped See Section 3 When defining the focus zoom horizontal offset and vertical offset slidebar settings for a given channel keep in mind the following considerations for optimized LS performance e The lens mount must be calibrated When decreasing 4 values are always even 1004 1002 1000 etc When increasing gt values are always odd 1001 1003 1005 etc e Lens movements begin slowly and subtly before reaching full speed changes may not be evident on screen until after a second or two of lt J or gt When holding lt or gt lens movement gradually accelerates e As with any setting you can directly enter a value using the numbers on the keypad if desired Press before and after e Because of how gears function movement to an even value is always approached from a higher value even if the direction of lens movement must reverse to do this Likewise an odd value is approached from a lower value This protocol helps ensure LS accuracy In general Q decreasing to an odd value movement will reverse its approach 0 If increasing to an even value movement will reverse its approach e To make small adjustments for ILS recall always maintain the current odd or even status for the new value this wi
154. is provides enough time for the internal lamp cooling fans to cool the lamp and to automatically shut off Cool completely before handling A wARNING A Use only lamps supplied by Christie FILTER Replace the side filter every 1000 hours or sooner If this filter is not replaced air flow may become restricted and cause the projector to overheat See 4 4 Replacing the Lamp and Filter for the complete replacement procedure A WARNING A Use only filters supplied by Christie Only use attachments or accessories recommended by Christie such as the specific power cord supplied Use of other attachments or accessories with this projector may result in the risk of fire shock or personal injury Ai WARNING A Use oniy the AC povver cord supplied Do not attempt operation if the AC supply and cord are not within the specified voltage and povver range See Section 5 Do not allow anything to rest on the power cord Locate the projector where the cord cannot be abused by persons walking on it or objects rolling over it Operate the projector at the specified voltage only Do not overload power outlets and extension cords as this can result in fire or shock hazards The projector 1s equipped with a three wire plug having a third grounding pin This is a Safety feature If you are unable to insert the plug into the outlet contact an electrician to have the outlet replaced Do not defeat the safety purpose of the grounding type plug Befor
155. is tilted in relation to the screen as is sometimes the case for large venues or elevated installations throw distance still represents the smallest measurement between the screen and front feet HANI INSTALLATION AND SETUP Vertical amp Horizontal Position Throw distance 1s roughly equal to the horizontal width of the screen multiplied by the type of lens you are using For example if you are using a 0 8 1 lens proper throw distance will be approximately 0 8 x the screen width Once you know your screen size and lens you can estimate throw distance needed see example in Figure 2 12 Screen x Lens Type Approx Throw Distance Figure 2 12 Estimating Throw Distance IMPORTANT For proper SEE APPENDIX E placement in an installation always refer to the throw distance formula and or graph for your lens as listed in Appendix E Keep in mind that due to lens manufacturing tolerances for lens focal length actual throw distance can vary 5 between lenses described as having the same throw ratio THE VERTICAL POSITION of the projector in relation to the screen also depends on the size of the screen and the lens type Correct vertical position helps ensure that the image will be rectangular in shape rather than keystoned having non parallel sides and that image focus and brightness both remain optimized In addition vertical position of the image can be offset that Is moved up or done either by turning the top
156. ith a mobile cart avoid sudden stops excessive force and uneven surfaces that may cause the projector and cart combination to overturn The table or cart should be reasonably level Fine adjustments to the projector level can be made by adjusting the height of the projector legs refer to 2 7 Leveling for details Special Mounting Note that projector can be rotated and mounted at any vertical angle i e you can tilt the face of the projector up or down as much as desired for your installation The side to side tilt however must not exceed 15 see Figure 2 15 This limit ensures that the arc lamp in the projector operates properly and safely Always make sure that exhaust air from the projector does not vent towards the lens otherwise you may detect heat waves in your projected image Figure 2 15 Horizontal and Vertical Tilt Ranges You must use the proper ceiling mount fixture or stacking kit for your projector For more information contact your dealer 2 14 Roadster Vista User s Manual N INSTALLATION AND SETUP 2 4 Folded Optics Source Connections In rear screen applications where space behind the projector is limited a mirror may be used to fold the optical path See right The position of the projector and mirror must be accurately set if considering this type of installation call your dealer for assistance The r
157. izes Sets to Default Decoder Pixel Tracking Contrast amp Brightness sl n Resizing Presets lt Default No Resizing Full Size Full Width Full Height Anamorphic Tiled Full Size Tiled Full Width Tiled Full Height Tiled Anamorphic Auto Setup ACM Pixel Phase Auto Input Level off Size Blanking Vertical Stretch Detail Position Filter Input Levels Luma Delay if analog source C 2 Roadster Vista User s Manual Appendix D Serial Communication Cables When connecting a Roadster and or Vista projector to a computer another projector or a Marquee Signal Switcher use the appropriate serial communication shielded cabling as illustrated From projector to computer RS 232 For computers having a 9 pin AT type serial port Standard RS 232 cable with 9 Pin D Connectors Proj FEMALE 1 Computer p Shielded Multi conductor Cable From projector to computer RS 232 For computers having a 25 pin serial port Standard RS 232 cable 9 Pin male to 25 pin female Proj Network IN Computer female male 0000000000 000000000000 Shield Roadster Vista User s Manual D 1 SERIAL COMMUNICATION CABLES W h E o v D X X X s i From projector to RS 422 compatible computer Proj RS 422 male Shielded Multi conductor Cable Male proj port 1or2 e Wiring varies among computers Consult the documentation for your
158. jector On some PCs you may be able to change the settings to generate a compatible signal If the frequencies shown in the Status menu are incorrect check the cabling to see where the problem is When the projector encounters a system malfunction either a System Warning message or a System Error message may appear Both types of messages are accompanied by a steady red Power LED and a flashing red and yellow error code on the Status LED This condition indicates the need for service by a qualified service technician NOTE System messages appear on screen only if Display Error Messages has been set to Screen or All System Warnings A system warning message indicates that a system malfunction has been detected see Status LED Codes below A system warning message replaces any input signal message and disappears when the input signal status changes While the projector Roadster Vista User s Manual 3 55 OPERATION II I IIIIIII IGIII II I lt I I6 GI lt lt E I xI amp H E I I II I III IIII I amp IOE9 gt IEYII EI IoI lt amp YIIEI U OIEI lt IzUYaF ELLI IEIz E EYEH HER III lt I lt I AUC T5 Y QIAIIAIAIAI III II9IIIAIAIA9 IwAII I amp IzI I AIIAIAII 3 56 Roadster Vista User s Manual will remain operational the message indicates the presence of a serious problem that should be reported to the manufacturer You can press to remove the mes
159. jector used to identify a match for a given channel and are preceded by either an T interlaced signal or p progressive signal See Table 3 1 Table 3 1 Abbreviations for Signal Type SEUL Signal Type Composite 4 wire on HC input Composite 4 wire on V input Sync on green 1 29 Dig Digital If you have more than a handful of channels use 4 and to see the remaining channels not visible in this initial display To copy delete or edit any of the channels listed in the Channel Setup menu highlight the desired channel and do one of two things e Press if you want to copy the selected channel or delete this or other channels See Copying or Deleting a Channel below e Press if you want to edit channel setups 1 non image related parameters for the selected channel See Editing a Channel Setup below TO COPY A CHANNEL highlight the desired channel in the Channel Setup menu then press to go to the Channel Copy Delete submenu Select Copy and press Erte a new channel will be created It is identical to original which still remains but it is identified with the next available number from 01 99 If you change your mind and do not want to copy the current channel press to cancel and return to the previous menu Copying channels is a quick method for creating numerous channels each of which can then be edited and adjusted for a variety of presentations in the future Roads
160. knob on the front of the projector the one nearest to the IR sensor in non motorized projectors or through software In motorized projectors Offsets range up to 130 depending on the specific lens whether it is motorized or not what amount of zoom is In effect and whether or not you are also offsetting horizontally See Table 2 1 for the maximum percentage of the image that can be displayed above or below the center of each type of motorized lens These image offsets are also illustrated in Figure 2 13 NOTE Shown are approximate motorized offset ranges manual offsets may differ Table 2 1 Maximum of Image Offset from Lens Center Lens Type Max Recommended Image Offset 191 2100 aroa 2100 126 0100 NOTE VistaGRAPHX lens Threaded lens adapter required Motorized ZOOM feature is not available for VistaGRAPHX lenses The 0 8 1 lens is not recommended for use in S models Roadster Vista User s Manual 2 11 INSTALLATION AND SETUP HU r wc wc F R c lt c c lt s 0 6 4 6 DA Maximum amount of display above center of lens 91 This is a VslaGRAPHOI lens Maximum amount of display below center of lens 100 nsn ss 996 100964 A PTA Maximum amount of display above center of lens 104 gt 10096 Maximum amount of display below center of lens 100
161. l identity for projectors 1s Communications required whenever you want to Baud Rate 38400 communicate with a single projector FrontIR AorB vi within a multiple proyector application Back IR AorB v see key description in 3 3 Using the Wired Keypad A or B v sed a Sas ha Keypad If you make a mistake in a assigning or changing the projector 7 Split Network number press to cancel Current projector number To assign a new number enter up to 3 digits For complete Information about 10 9 controlling multiple projectors see 3 10 Using Multiple Projectors Split Network Enter a checkmark if you have a network in which each projector is connected via both its RS 232 and RS 422 serial ports Figure 3 25A At each projector serial communications will then remain on either its RS 232 or RS 422 path depending on the controller rather than being broadcast to all 3 remaining serial ports Should a projector or path ever fail the other path will be available as a back up The Split Network feature is unnecessary when only a single serial link is connected between any two projectors Figure 3 25B and will cause communication errors if these single links vary from RS 232 to RS 422 anywhere in the network Likewise if you have two serial links connected between any two projectors failure to use the Split Network checkbox can also cause a communication error n OPERATION 3 8 Wo
162. l may be of poor quality If the source is a VCR or off air broadcast detail may be set too high Keep near 4 for most sources I cannot access the bottom lamp screw in order to remove the lamp I The vertical offset 1s too substantial causing the moveable Internal component to block access to the screw Decrease the vertical offset to move the component up and out of the way NOTE If your projector has a motorized lens mount and cannot power up due to an expired lamp or power supply problem the motorized Junctions must be disabled and then vertical offset adjusted manually Contact your dealer or the manufacturer Section 5 Specifications NK NVOTES 1 Due to continuing research specifications are subject to change without notice 2 5 1 Specifications All Roadster All Vista Display Lenses Specifications apply to all models unless otherwise noted 3 Roadster X4 S4 and Vista S5 are no longer manufactured Panel Resolution and Refresh Rate Pixel format H x V on 3 DMD panels 1280 x 1024 SXGA or 1080 x 768 XGA Refresh rate panel 23 97 78 Hz Brightness in maximum output conditions Vista X3 S3 3000 ANSI lumens Roadster X4 S4 4000 ANSI lumens Vista X5 S5 5000 ANSI lumens Roadster X6 S6 6000 ANSI lumens Roadster X9 S9 8500 ANSI lumens Contrast Ratio in maximum contrast conditions Vista X3 X5 Roadster X4 X6 300 1 ANSI 500 1 full on full off All 700W or 1200W S models 300 1 ANSI 80
163. ll prevent the lens from reversing at a point very near to the requested setting and settling in the area of extra travel known as the backlash zone an area which is not recognized by the JLS For accurate tweaking of an odd setting press gt If even press 4z FOR EXAMPLE f the current setting is 1001 and you enter 1002 the lens must move slightly beyond the requested setting before quickly reversing back down to 1002 Although 1002 will appear in the menu the physical location of the lens will not be accurately recalled by the LS Instead if you need to slightly increase a current odd setting such as 1001 either press as often as necessary or go to a nearby odd setting 1003 1005 etc rather than switching to an even setting 1002 1004 etc This technique will prevent the lens from reversing and settling in the backlash zone N INSTALLATION AND SETUP Try to release the lt or key before reaching a desired lens setting then continue as necessary with small incremental adjustments in the same direction If you overshoot slightly do not reverse and tweak into place unless you have overshot beyond the backlash zone which can vary from 10 to 600 increments depending on the function Otherwise the 7LS function will not recognize the final tweaked value when you return to this channel and lens performance will appear inaccurate In general use small incremental fine tuning
164. lp 2 Setup 3 Keys 4 Source Input Selection 5 Stat Pwr LEDs 6 Using 3D Figure 3 7 Accessing General Help Topics Whenever the projector is not at presentation level such as when there is a slidebar menu message or test pattern displayed you have limited time in which to make a keypad entry before the projector returns to presentation level and the graphic disappears These time outs vary depending on the current display as shown in the following chart Slidebar from menu 15 minutes If a menu option includes this icon settings for the option apply universally to any incoming signal Most of the function menus allow you to change settings by using slidebars checkboxes and pull down lists To select a slidebar toggle a checkbox status or view a pull down list do one of the following within the function menu e Enter the menu option number corresponding to the setting you wish to change for example press 8J for Vertical Stretch in Size amp Position menu Or move the highlight to the desired parameter and press Erte Or move the highlight to the option desired and press 4z or gt e Or bypass menus entirely and use a single key to immediately access an adjustment note applies only to options having their own key such as Color Tint Detail Contrast Brightness Volume Pixel and Position Once selected change the setting as desired see below and press to save and return to
165. ls COPY FROM Use this option to replace the currently selected User color temperature setup with that of another This function can be particularly useful as a starting point for a new User color or for accessing an unaltered factory default It is disabled for all color temperatures except User See Figure 3 18 Color Temperature Setup 1 Color Tem User2 F F 3 1 3200K 4 2 5400K 3 6500 4 9300 6 Color Enable 5 User Select a temperature 7 Copy From 6 User2 irU 7 7 7 User3 It will replace the 8 User4 setup for the current 9 Factory 3200K Se temperature User2 in th l Stable for the life Factory 5400K Of the profector Factory 6500K Factory 9300K Figure 3 18 Copy From w_c Kmmp a a a c a a a gt apa xw X Xss OPERATION To create a starting point To set a starting point for a new custom user color temperature select a user temperature then highlight Copy From and select a temperature that is similar to what you want Adjust white levels from there as desired To use a factory default The preset color temperature setups 3200K 5400K 6500K and 9300K can be altered from within the password protected Service menu only note that although such an I 1 3200K alteration changes the setup and Setup can be 2 5400K appearance for a preset it does not 3 6500 change 1 5 name If you suspect that you 4 9300K are using a preset temp
166. m percentage of the image that can be projected above or below the lens center without degrading the image quality Vertical offset ranges depend on the type of lens in use and whether or not the image is offset horizontally at the same time The signal that is used by display devices such as projectors to generate an image This term also refers to the output of video tape disk players and computers An optional device that converts NTSC 3 58 NTSC 4 4 PAL PAL N PAL M or SECAM to RGB video A specific type of video signal such as NTSC PAL SECAM This projector can automatically recognize and interpret the incoming standard and display accordingly Screens do not reflect equally in all directions Most light is reflected in a conical volume centered around the line of best viewing Maximum brightness is perceived if you are within the viewing cone defined by the horizontal and vertical viewing angles The color temperature of white used by the projector The area of an image that is white only For example a full white field is an image that 1s white everywhere A 10 white field is a white area usually rectangular that occupies 10 of the image the remaining 90 is black A high end digital component video signal A high end analog component video signal Sometimes called YUV Component or Y R Y B Y the YPbPr signal by passes the video decoder in this projector See YPbPr The adjustment of image size by means of a
167. mage sources other than 7 Blue Pb Input Drive 50 2 271 must have decoded video have 8 Clamp Tip O maximum contrast 9 Color Enable White v 7 7 without crushing black Peak Detector or white By default and in an Auto Setup from the Main menu the projector automatically determines the best input levels by monitoring image content and adjusting the controls appropriately further adjustment is typically not required to obtain proper blacks or whites NOTE This automatic adjustment requires at least 1 white pixel in the image Without a white pixel input levels may produce skewed colors particularly in non video images Figure 3 20 Input Levels Submenu However for a very unusual source exhibiting overly high blacklevels most often caused by a noisy source that causes blacklevel spikes an experienced user may prefer to use the Input Levels menu see Figure 3 20 These adjustments which are actually a calibration process to compensate for differences in sources and cabling enables an experienced user to perfect the source image input levels Note that Input Levels are of limited use with digital signals but offer some ability to tweak poorly mastered source materials AUTO INPUT LEVEL Keep off for virtually all sources default Temporarily enter a checkmark only if you are an experienced user and you have an unusual source that you feel needs further color temperature and or input level adjustment After
168. mal stress that can lead to premature lamp failure never unplug the line cord while the lamp cooling fans are running and never unplug to power down The projector is set up at the factory for use in a front screen floor mount orientation If your initial installation is ceiling mount or rear screen displayed images may be upside down and or reversed To correct you must change the image orientation from within the Menu Preferences menu you may 14 prefer to do this before Select Rear and check 18971 that the display looks like this no11 b ft vril hysically installing the pay 4692 b ft vril projector in its final position orientation 4 IUAGL 6q KEIL Select Inverted Rear and check 2 IUAGL 6Q LLOU In the Menu Preferences that the display looks like this S Keg Menu highlight and select V Houq the Image Orientation pull down list Select from Rear r elect Inverted Front and check JUOJ4 Invred Rear da your Intended Installation juod See Section 3 Operation for further Information For most installations the lens surface of the proJector is parallel to the screen this prevents major keystoning of the image 1 e an image with non parallel sides In a l isu Z addition the projector must x be kept level from side to Figure 2 25 Adjusting the Feet H
169. n DDI DMD Decoder Detail Diffused Screen Display Setting Flicker Frame Rate Foot candle Foot lambert A 2 Roadster Vista User s Manual A number that uniquely identifies a specific channel retained in projector memory The projector can retain up to 99 channels A menu item that indicates whether an option is currently in effect checked or not unchecked A change in the tint of a white field across an image The coloration reddish white bluish greenish etc of white in an image measured using the Kelvin degrees K temperature scale Higher temperatures output more light See YCbCr or YPbPr The output of video tape players and some computers characterized by synchronization luminance and color signals combined on one output cable The degree of difference between the lightest and darkest areas of the image The alignment of the red green and blue elements of a projected image A projection screen which is slightly concave for improved screen gain Curved screens usually have screen gains which are greater than 1 but viewing angles much less than 180 Curved screens are not recommended for use with this projector A direct digital interface signal can be supplied to the projector via an optional digital input module installed in INPUT 2 For example you can input an SMPTE 259M signal using a Serial Digital Input Module or input an SMPTE 272M signal from a Digital HDTV Serial
170. n asterisk symbol to ensure a toggle only in the desired direction When turning the projector on for instance you may be too far from the projector to know whether it is really off or if the shutter is merely closed If you press and hold it for approximately 1 second in hopes of turning the projector on the projector will actually turn off if the projector was already on Instead to avoid the risk of toggling in the wrong direction quickly press and release normally the function key you wish to toggle in this case Power Then immediately within 2 seconds press either or as desired The specific toggle will occur Toggle keys are labeled with an asterisk on the keypad They are listed below uu a a gt gt R gt gt R R R gt a a a aow awsa a a gt gt X ss OPERATION Detail close the shutter NOT PRESENT IN ALL MODELS open the shutter NOT PRESENT IN ALL MODELS put the projector in standby mode leave standby turn the projector on turn the projector off turn the audio if connected and menu display on turn the audio if connected and menu display off turn the menu system on turn the menu system off Color Press to adjust the color saturation level 1 e the amount of color in a video image Lower settings produce less saturated colors a setting of O produces a black and white image for example If the color level is too high colors will
171. nal grayscale test pattern when working with color temperature Color Temperature Setup Disabled unless Interpolated 1 Color Tem 6500K color temp is selected 2 f Select from list 3 1 Disabled 4 1 3200K unless 5 2 5400K User is gt 3 6500K eee 6 Color Enable White 4 9300K ee 7 5 User1 6 User2 Replace the current User temperature if shown 7 User3 at the top of the menu with this color temperature 8 User4 9 Interpolated Figure 3 17 Color Temperature Setup Menu Roadster Vista User s Manual 3 33 OPERATION wG lt wmaan gt u oxrnszli010O 1 lIUIWIIIIKI I NW I I I II I II I I I I I III lt I9I9IoO lt III I IIY lt lt e pp ls ahI _ 8 lt a h l l amp a5a5 x h X 3 34 Roadster Vista User s Manual SELECT COLOR TEMP See Figure 3 17 Upon opening the Color Temperature Setup menu the current temperature appears as the top option You can change to a different color temperature here as desired just as in the Image Settings menu Note that selecting a User color temperature enables the White Level options in the Color Temperature Setup you can adjust them as desired to define or change a User color temperature see White Levels below Likewise selecting Interpolated Color here activates the Interpolated Color slidebar for defining or changing an interpolated color temp
172. need sync tip clamping Enter a check in the Clamp Tip box found in the Input Levels submenu The display is reversed and or upside down 1 The projector s image orientation is not set correctly for the current installation Refer to 2 6 Operating Orientation to set the projector s image orientation to match your installation The upper portion of the display is waving tearing or jittering 1 This can sometimes occur with video or VCR sources If you are using a VCR make sure that the VCR option is checked in Image Settings Video Options Portions of the display are cut off or wrap to the opposite edge 1 Reduce top bottom left or right blanking from within the Size and Position menu Check size and position adjustments 2 Resizing may need adjustment Adjust until entire image is visible and centered The display appears compressed or stretched 1 The frequency of the pixel sampling clock is incorrect for the current source 2 The Size and Position options may be adjusted poorly for the incoming source signal See 3 6 Adjusting the Image Display quality appears to drift from good to bad bad to good 1 The operating temperature of the projector may be fluctuating Watch that the projector is not located too close to heating air conditioning vents The source input signal may be of low quality 3 The horizontal or vertical frequency of the input may have changed at the source end The display
173. ng 3 or 4 rows the center row s will automatically fill 2 Screens with very little or no image will be blanked cropped Roadster Vista User s Manual 3 53 OPERATION wG lt wmaan gt u oxrnszli010O 1 lIUIWIIIIKI I NW I I I II I II I I I I I III lt I9I9IoO lt III I IIY lt lt e pp ls ahI _ 8 lt a h l l amp a5a5 x h X 3 54 3 11 Error Conditions Roadster Vista User s Manual For each projector select Tiled Full Height to MALL a fill the videowall from top to bottom while maintaining the incoming aspect ratio This typically creates a black border on the left and right edges of the wall See right NOTE FOR LARGE ARRAYS 1 In large arrays having 3 or 4 columns rows the center screen s will automatically fill 2 Screens having very little or no image will be blanked cropped e For each projector select Tiled Anamorphic Tiled Anamorphic to fill the videowall from left to right while maintaining the incoming widescreen anamorphic aspect ratio of 16 9 This typically creates a black border at the top and bottom edges of the wall See right NOTE FOR LARGE ARRAYS 1 In large arrays having 3 or 4 columns rows the center screen s will automatically fill 2 Screens having very little or no image will be blanked cropped Large Displays and 10 bit Processing When
174. ng of Invalid User Entry messages cannot be disabled even if Display Error Messages has been set to Off Input signal errors messages appear when you are in presentation level 1 when there are no menus present and have selected an input on which the projector detects a problem While menus remain operational and pressing any key will temporarily remove the message from the screen you must resolve the signal problem in order to permanently eliminate the message NOTE Input signal messages appear on screen only if Display Error Messages has been set to Screen or All No Signal The message No signal appears when there is no signal detected at the selected input Both HSYNC and VSYNC are inactive and the screen background 1s black Connect or correct the signal or select another input Bad Sync The message Bad Sync is displayed when HSYNC or VSYNC are active but the signal cannot be displayed Such a condition occurs when only one of the two signals Is present or when either signal is unstable or of the wrong frequency Correct the signal or select another input Other Signal Error Messages In addition to the common Bad Sync and No Signal errors you may encounter a signal error message indicating that Hsync and or Vsync are either too fast or too slow When such a message appears check the frequencies shown in the Status menu If they are correct then the signal is not recognized by the pro
175. nges you may have made Or you may prefer to begin with an automated setup in which the projector quickly defines certain parameters for you select Auto Setup from the Main menu These settings can then be fine tuned In Size and Position and Image Settings at any time From your presentation access any of the individual options in these menus by pressing followed by the appropriate two digit number representing their location in the menu system For example press 8 to quickly access the Color Setup option in the Image Settings menu For certain options you may prefer to use a direct key from presentation level to go directly to a particular option rather than traveling through the menu system at all note this is not available for all display parameters For example press to access the contrast slidebar immediately Press to return to your presentation NOTE 1 To hide the direct slidebars only make sure the Display Slidebars option in the Menu Preferences menu is unchecked 2 To hide the entire menu system from view toggle the on screen display OFF press and hold the key If you want the projector to quickly set up the image for you select Auto Setup from the Main menu A confirmation box will ask if you really want to continue in which case display parameters listed in the Table below will be set for you An Auto Setup can save time in setting up an image and you can also make further adjustmen
176. niformity 1 Auto Power Up L 8 Diagnostics and Calibration 9 Reserved 0 Service Figure 3 8 Example of Pull Down List Use Or keys to navigate up and down within the list the current choice is noted with a small Press to choose an option from the list if desired Or of you prefer to quickly scroll through a list without first pulling it down highlight the option and use 4 or gt Press when the desired choice appears NOTES 1 Press 4 or to jump between pages in an extra long pull down list 2 Press while in a pull down list to cancel any change ACTIVATE THE EDIT WINDOW To enter or edit text highlight the desired parameter such as a channel name and press to activate its adjacent edit window Any previously entered text is displayed with its first character highlighted in a square cursor signifying that this character is ready for editing NAVIGATE WITHIN THE EDIT WINDOW Press to move the cursor forward or lt to move the cursor backwards as desired Cursor highlight Move with lt a EDIT A CHARACTER To edit a highlighted character use AJ and IY to scroll through show2 the alphabet numbers spaces and A punctuation available When the character you need appears press to select it the cursor will move to the next character of numbers etc to select and scroll alphabet Press go to next current text if present Note that you can also enter a number
177. nize the Focus menu option Remember that activates the Focus control 1 from here press 4 or to adjust 2 If focus is not uniform throughout the image bore sight is likely poor Contact your dealer for service Lens offsets move the lens and image Try to achieve the desired overall image position and best brightness while maintaining a rectangular image If the brightness looks uneven or the edges do not look perfectly straight the projector may not be in the optimal position for your screen See 2 3 Projector Position and Mounting for full details Lens offset ranges are also listed on page 5 1 NON MOTORIZED To relocate the image turn either or both of the front knobs adjacent to the lens The top knob Vertical will raise or lower the image the bottom knob Horizontal will shift the image left or right MOTORIZED Press to display the Lens Control menu Select either lens offset option 13 or 4 and move the image as desired with L4 or gt Refer back to Figure 2 1 Other display adjustments are available through keypad commands and on screen menus refer to Section 3 Operation NOTE Requires motorized lens Once you ve defined lens settings for the current display you can automatically recall these positions whenever you use this channel This Intelligent Lens System ILS function is particularly useful if you are working with a variety of source types that may differ in size and
178. nput signal it detects Use Auto unless you want or need to override its performance and apply a specific mode instead 2 VIDEO Performs 15 kHz NTSC PAL video de interlacing regardless of signal type Note that this option utilizes 8 bit processing 3 GRAPHICS HDTV Performs basic de interlacing and scaling regardless of signal type Note that this option utilizes 8 bit processing 4 MINIMUM DELAY Not used in this projector 5 ADVANCED 10 1 ADP Uses 10 bit processing instead of the standard 8 bit processing provided in the projector resulting in smoother and clearer details in video images This feature requires installation of optional internal hardware the Advanced Digital Processing Module and is disabled unless this module is present It activates full source to screen 10 bit processing for a digital video source typically connected via the optional Serial Digital Input Module or the Digital HDTV Input Module INPUT 2 Images from analog signals INPUT 1 3 or 4 will also be noticeably improved however these signals are first converted with 8 bit processing before routing through the ADP module Motion Filter This control is most useful for smoothing out moving gt 1 Auto images from interlaced sources In most cases the 2 Still Video proper Motion Filter setting is automatically A determined according to the type of incoming source 5 Graphics signal However if your source is noisy and or 6
179. nt to loop a composite signal through to another projector or display device see Video Loop Through later in this section Left amp Right Left amp Right Audio Inputs Audio Outputs pre amplified m To Amplifier phono plugs Use phono plug or BNC for input NOT BOTH INPUT 2 INPUT 3 INPUT 4 COMPOSITE VIDEO S VIDEO Y C Z ZA O 9 SZ SS Video Decoder LW Loop Module 804600 INPUT 1 REMOTE RED GREEN BLUE HOR COMP VERT 7 Q Z Z A A Z status 62 9 EO EO s s SY YF O o Power O From Composite From Composite Video Source Video Source Figure 2 19 Connecting Composite Video S Video INSTALLATION AND SETUP The video decoder Input panel provides simultaneous connection of both a composite video source INPUT 3 and an S Video source INPUT 4 If connecting an S Video source use the 4 pin mini DIN connector or the Y and C BNC connectors luma and chroma at INPUT 4 do not use both as inputs See Figure 2 20 Left amp Right Left amp Right Audio In
180. ntrolling the 3 9600 projector with an external device such as a computer or another 4 19200 projector via an RS 232 or RS 422 port You must set the projector baud rate at these ports to match the baud rate of the controlling gt 7 115200 device If you are unsure about what baud rate to choose refer to the documentation for the controlling device In an existing network if you discover that a projector has the wrong baud rate make sure to use the pull down list and select the correct baud rate with the key do not just scroll this control with lt J and keys NOTE 1 The baud rate setting does not affect the switcher port which is always 9600 baud 2 See Serial Port Connections and Appendix D for more information about cable connections between devices 3 On early models the 2 highest baud rates are unavailable for downloading projector MAIN software n OPERATION Front IR Back IR 1 AorB As described in Section 2 the standard IR remote keypad is capable of 2 A sending data to the projector in either one of two protocols called A or gt 3 B B Likewise the front and rear IR sensors on the projector can be set to 4 Off accept IR data accordingly responding to A B or both The projector s A or B default is adequate for most single projector installations Select a specific protocol to prevent interference when you are controlling two protectors in the same area and want to work with one proj
181. o SYNC input labeled VERT See Figure 2 17 NOTES 1 If for some reason the projector fails to recognize as an RGB signal specify this Color Space option within the Image Settings menu See 3 6 Adjusting the Image 2 To connect YPbPr signals such as from DVD or analog HDTV sources to INPUT 1 use the red green and blue BNCs as described in YPbPr Signals later in this section Left amp Right Left amp Right Audio Inputs Audio Outputs pre amplified To Amplifier INPUT 2 INPUT 3 INPUT 4 COMPOSITE VIDEO S VIDEO Y JOO ideo Decoder La LOOP 21 1 Loop Module 804600 INPUT 1 REMOTE GREEN BLUE HOR COMP VERT SWITCHER RS 232 IN RS 232 OUT STATUS 6 6 6 66 lt gt S G 2 ZF O o power sync BNC connectors RGB and Sync Signals from Source Figure 2 17 Connecting RGB Input AUDIO for INPUT 1 STANDARD ON VISTA ONLY To control audio levels in an audio visual system connect pre amplified line level audio inputs to the IN 1 left and right channel audio inputs locate
182. of projectors having a motorized lens mount to automatically return to lens settings previously defined for a particular channel A physical connection route for a source signal described by a 2 digit number representing 1 its switcher projector location and 2 its slot in the switcher projector Signal sent from a source device to the projector A device such as the Serial Digital Input Module that accepts an input signal for display by the projector A method used by video tape players and some computers to double the vertical resolution without increasing the horizontal line rate If the resulting frame field rate is too low the image may flicker depending on the image content A small push button device for controlling most projector settings and operation For more information refer to 3 3 Using the Keypad A distortion of the image which occurs when the top and bottom borders of the image are unequal in length Side borders both slant in or out producing a keyhole shaped image t is caused when the screen and lens surface are not parallel or in X models by poor Keystone adjustment The reproduction of the horizontal and vertical size of characters and or shapes over the entire screen When light from a projector is incident on a screen the light reflects from the screen such that the angle of reflection equals the angle of incidence The Line of Best Viewing is along the line of reflection Roadster Vista
183. of video and all graphics sources Generally if black appears crushed when brightness 50 choose 0 IRE If black appears excessively elevated use 7 5 IRE VCR This control determines to what degree the projector tolerates signal disturbances The correct setting is automatically determined and set according to the type of incoming source signal for instance there should be a checkmark for all VCR sources The VCR option may require a change from its auto setting In very rare circumstances only such as if you are having difficulty switching between two unusual and almost identical VGA computer sources Otherwise it is not necessary to change this option VIDEO TERMINATION Enter a checkmark e For all single free standing projectors to terminate the video inputs 3 and 4 75 e For last projector in a network S The Input should be terminated unless C e For all networked projectors except the signal loops through continues to the last one another projector or display device in which case only the last projector in the chain should be terminated ENABLE DECODER AGC The automatic gain control affects decoded video images only Enter a checkmark default for most decoded video sources this activates the AGC circuit to ensure properly bright images Delete the checkmark if a decoded video image exhibits strange color artifacts such as stripes in highly saturated colors indicating an incompatibility betw
184. ojector directly or activate a system of intuitive menus Collections of settings can be defined and retained in the projector s internal memory as a custom channel with up to 99 different channels possible Projector components and functions are illustrated below Refer back to the chart on page 1 2 to determine what is available on each of the various models 414 Covers 4 24 Eyebolts 4 oye Lamp side panel 04 rp Front IR sensor Adjustable feet 4 Remote IR keypad el me 24 Slots 4 for stacking requires optional hardware LCD status window Rear IR sensor Zoom ring Focus tab Integral keypad Vertical offset g yp Horizontal offset Filter side panel Input panel Input Video input Hard reset panel RGB input Serial ports handle Audio input Wired kypd port This component is on Roadster only 2 Status LEDs standard on Vista models only Figure 3 1 Basic Projector Components Roadster Vista User s Manual 3 1 OPERATION IKI IIIWII I I III II OIIMIII I I II lt IIII IIIIII I I lt NIYI II WI lt IIII lt IIKI2 I I II KNK KHHG VE 9 I lII4I Iu I I2I II III I I IAIIAIzImII A I A III AI AIIAIIAIIIAIAI I AII IA YII IMI AI Components Features 3 2 Roadster Vista User s Manual ZOOM Accessed manually in some models or with the keypad if a motorized zoom lens is pres
185. ol the projector with a computer and or other controlling device such as the Two Way Controller having RS 422 capability connect RS 422 serial communication cables between the computer or other device and either or both of the projector serial ports labeled RS 422 these 6 pin XLR connector ports are located near the upper right corner of the projector s rear control panel see Figure 2 28 Use an RS 422 port only if your equipment has RS 422 capability always first consult the documentation supplied with your equipment If using a switcher If using multiple projectors INSTALLATION AND SETUP From computer wa SISSIES Two Way Controller IMPORTANT or previous projector Use the RS 422 port ONLY if your m system supports RS 422 serial communications Connecting to the RS 422 port with incompatible equipment may DAMAGE the equipment INPUT 2 INPUT 3 INPUT 4 COMPOSITE VIDEO S VIDEO ZY oder LW Loop J INPUT 1 REMOTE ED GREEN BLUE lt VERT SWITCHER RS 232 IN RS 232 OUT STATUS ai AA 9 9 0 Power L SYNC Figure 2 28 RS 422 Serial Connection to a Computer A WARNING A Do not use an RS 422 port unless you are using a computer with RS 422 capability The voltage levels of this signal can damage incompatible equipment
186. olled with a common IR remote keypad You can also tile a single incoming image among multiple displays in a videowall with each display making up a portion of the total image In such cases you can switch back and forth between broadcasting to all projectors or controlling each projector individually Make sure you have assigned a unique projector number to each projector present this number will be required in order get the exclusive attention of an individual projector To assign a projector number Press and select the Configuration menu then the Communications submenu Scroll down to Projector and enter a valid three digit number 000 to 999 for identifying the current projector Press to accept the entry or to cancel Repeat for each projector using a unique three digit number for each Once every projector has its own number you can begin to control the network First make certain that only one any networked projector has its Broadcast Keys option selected checked and IR sensors enabled the remaining projectors must have the Broadcast Keys option unchecked and their keypads disabled do this in the Configuration Communications menu The Broadcast Keys projector will then relay keypad commands to the other projectors If using a wired remote make Roadster Vista User s Manual 3 51 OPERATION wG lt wmaan gt u oxrnszli010O 1 lIUIWIIIIKI I NW I I I II I II I I I I I III
187. on that must be set in the Menu Preferences menu AUTO SOURCE If checked default the projector can automatically locate this channel when an incoming input signal matches If not checked the projector can locate the selected channel only when it is directly selected via on the keypad and a change in input signal will not result in a channel change PREVIOUS CHANNEL Select this option to see or change Channel Edit settings for the previous channel in the Channel Setup list NEXT CHANNEL Select this option to see or change Channel Edit settings for the next channel in the Channel Setup list Roadster Vista User s Manual 3 23 OPERATION U IKW IHI I II I I I lt I I I I III EIII III9 9 QICICI 6I 9I I I IIII TWII II II ZHII9II I I I C I IOI IIW K I IZ I lt IO MU HI I LIIILIcIImPPII IUHUIc K 8 3 24 s apa ee ey 3 6 Adjusting the Image Auto Setup Roadster Vista User s Manual Most options for source specific image adjustments can be accessed through two menus Size and Position Meu 11 and Image Settings Menu 2 both of which are listed in the Main menu While in either of these two menus you can change settings affecting the image from the current channel by working with the appropriate slidebars checkboxes and pull down lists will always return to the previous menu or to the presentation if from the Main menu and accept any cha
188. one you are currently using the checkmark will disappear Keypad commands even will then affect this projector To broadcast to multiple projectors press without entering a projector number Keypad commands even Power will then affect all projectors present NOTES 1 The Broadcast Keys option in the Communications menu must be selected for only one any projector in a serial network The keypad in use must be OFF disabled for the remaining projectors See 2 10 Keypad Protocols and Conversion and 3 7 Configuring System Parameters Pixel Press to access the pixel tracking and pixel phase double slidebar Adjust pixel tracking first use lt and to increase or decrease the frequency of the pixel sampling clock to correct consistency of the image For proper phase use and to increase or decrease pixel phase so that any shimmer disappears and the image is stable throughout See 3 6 Adjusting the Image Size and Position subsection for a complete explanation of tracking and phase Position Press to move the image using the double slidebar At the slidebar use 4 and to move the image left or right use and to move the image up or down Lens STANDARD IN ROADSTER ONLY NOTES L Requires a motorized lens In non motorized projectors adjust the lens manually for proper focus zoom and offsets as described on page 2 2 2 For full details regarding motorized lens functions refer to 2 8 Zoom Focus and
189. ontroller standard e g RS 232 to one physical end of the network and the other controller standard e g RS 422 at the other physical end of the network Make sure the Split Network option is enabled in the Communications menu If a projector should then fail anywhere in the network communication with the remaining projectors can be resumed in the opposite direction using the other standard NOTE This configuration requires that both standards be available from a single controller or that you use an RS 232 RS 422 adapter B SPLIT NETWORK WITH TWO CONTROLLERS If you have two controllers one RS 232 and one RS 422 and want one to be a back up connect each controller to the appropriate serial port on the first projector In the network Then connect projectors together using both RS 232 and RS 422 ports as shown Make sure the Split Network option is enabled in the Communications menu Now if either controller fails you can simply switch to the other controller and communicate via the other standard n INSTALLATION AND SETUP A w
190. or aspect ratio since the custom lens settings you ve chosen for any channel will be quickly and accurately applied whenever you use that channel ENABLING ILS v In the Lens Control menu enable the Intelligent Lens System option highlight it and press Este This will add the 4 lens positions focus zoom Roadster Vista User s Manual 2 25 INSTALLATION AND SETUP 19 z 7 F 6mT al FrFljs B 5ssa il ll sxs Fk1k rhha IIRIP9RIII WI8I gI IIgII IWZ IWIII I IIsII lt I I I I I I IIzI_ II lt ITI 6OGIII IU9 I IiIIIOIIOIIOIIIAIXEa APPIIA IIIIII 2 26 Roadster Vista User s Manual horizontal and vertical offset to the current channel settings recorded in proJector memory see 3 5 Using Inputs and Channels if you are unfamiliar with channels The lens will then automatically reposition itself according to these lens settings each time you use this channel The ZLS is a global function any lens settings you subsequently define for other channels will also be recalled whenever you use those channels You can still change lens settings as usual when the JLS is enabled Changes will be recalled the next time you use the channel DISABLING LS To use consistent zoom focus and offset settings for all channels delete the Intelligent Lens System checkmark highlight the option and press Erte The lens will not move until you adjust one of its settings Operating T
191. ost images This option will center and display your image as large as possible for the present source as described below v A graphic image will resize to fill the screen regardless of its original aspect ratio For example 1024 x 768 becomes 1280 x 1024 in S models Roadster Vista User s Manual 3 25 OPERATION wG lt wmaan gt u oxrnszli010O 1 lIUIWIIIIKI I NW I I I II I II I I I I I III lt I9I9IoO lt III I IIY lt lt e pp ls ahI _ 8 lt a h l l amp a5a5 x h X 3 26 Roadster Vista User s Manual v A video image will resize to fill the screen while still maintaining its aspect ratio assumed to be 5 4 v An HDTV wide screen 16 9 image will resize to fill the screen horizontally while maintaining its 16 9 aspect ratio i e there will be black borders at top and bottom commonly called letterboxed v Anon HDTV anamorphic 16 9 image typical of DVDs will be stretched vertically So with the exception of HDTV 16 9 the Default setting produces an aspect ratio that is either almost or exactly 5 4 if S model or 4 3 if X model See examples below If non HDTV If graphics If video If HDTV anamorphic signal approx Image 960 1024 1280 1280 1280 1280 NOTE Shown with S model resolution 1280 x 1024 X models are 1024 x 768 e Select NO RESIZING to display the image in its native resolution whic
192. ow the lens opening has likely been bumped forward during rough transit of the projector disengaging from its gear Remove the lens and push the motor into the projector as far as possible 4 if necessary wiggle the focus tabs slightly so that the motor engages with its gear internally Motorized ZOOM does not work or is limited 1 2 Remote lens functions are standard with Roadster models only Motorized zoom function is not available for VistaGRAPHX zoom lenses 2 5 4 1 or 4 7 1 neither of which have a zoom gear or fixed non zoom lenses Calibrate the lens immediately after installation and again 1f the lens is bumped or moved This will re establish correct ranges for all lens functions ILS performance seems inaccurate I 2 Refer to Operating Tips for Lens Settings and ILS in Section 2 for a full understanding of how to optimize ILS performance A 20 minute warm up of the projector is always recommended The display is jittery or unstable I J If the display is jittery or if it disappears and reappears erratically check that the source 1s properly connected and that its signal is of adequate quality for detection For example it the projector scans the default input for a signal to display and a poor quality or improperly connected source is connected the projector will briefly and repeatedly attempt to display an image If no source is connected the No signal present error mess
193. provides feedback regarding current status and activities of the projector 05 Projector Inputs 1 4 Display from a Wired Kypd only projector input l Lens Pixel f f e Adjust zoom focus e Adjust pixel tracking offsets Requires and phase inputi nput2 input pita motorized lens Position Func cas Pos Pixel Position Lens Func 77 enable Calor shortcut e Adjust color intensity f Detail video only Color Tint Detail 050 i e Adjust sharpness e Adjust red green balance hue Video OSD Contrast Cont Bright Vol Menu e Turn menus on off e Adjust difference toggle between light dark Volume l l Enter Exit e Adjust Vista audio Brightness M d 777 3 m Besley menus of light in image AON toggle Enter e Select a highlighted Lightbulb menu item gt lluminate keys e Change a value Exit e Accept a changed e Return to previous value VOFF Arrow Keys p Channel e Move highlight within e Select channel setup menu Input Chan Proj e Adjust a setting Projector up down e Select projector s 1 2 3 Help Help e Display context Input Select other sensitive help switcher slot location 4 5 6 Test toggle Test e Display selected Number Keys m 7 8 9 Mute test patterns Enter a number Mute such as channel Vista audio on off input projector etc 0 Shutter Siby Power Hide menu Povver Shutter Turn projector on off
194. puts Audio Outputs pre amplified ia To Amplifier phono plugs U IN 2 IN3 IN 4 000 INPUT 2 INPUT 3 INPUT 4 COMPOSITE VIDEO S VIDEO O JOO iaeo 1 LOOP oJ L Loop Module 804600 INPUT 1 RED GREEN BLUE HOR COMP VERT SWITCHER RS 232 IN 6 6 6 Ge qaz l sync From S Video From S Video Source Source Use 4 pin mini DIN or BNGSs as inputs NOT BOTH Figure 2 20 Connecting S Video AUDIO for INPUT 1 STANDARD ON VISTA ONLY To control audio levels in an audio visual system connect pre amplified line level audio inputs to the IN 4 left and right channel audio inputs located near the top left corner of the rear input panel Then connect external audio amplification equipment to audio OUT for sound output Audio connection cables require standard RCA type phono plugs NOTE If you want to loop an S video signal through to another projector or display device see Video Loop Through below Roadster Vista User s Manual 2 19 INSTALLA
195. r graphic images 7 MOTION For video images that did not originate from film or for moving computer generated images NOTE Applied for RGB HDTV interlaced signals Dark Interval Not available in this projector Invert Stereo3D Not available in this projector White Boost Not available in this projector PLL Loop Gain See description in Size and Position Noise Reduction requires optional ADP Module Select the amount of image noise reduction desired with O applying no noise reduction default and 10 applying maximum noise reduction The higher the value the softer the image Horizontal Filter requires optional ADP Module Select the amount of horizontal filtering desired for the current source Note that the default setting of 0 allows the projector to optimize the amount of horizontal filtering according to the current source and is the recommended setting for most situations You can override this by selecting a value from 1 10 with 1 applying no filtering and 10 applying maximum filtering High filtering levels will soften the image slightly particularly evident along vertical edges Vertical Filter requires optional ADP Module Select the amount of vertical filtering desired for the current source Note that the default setting of 0 allows the projector to optimize the amount of vertical filtering according to the current source and is the recommended setting for most sit
196. res less space behind screen than other rear screen installations Front Screen Installations While there are two basic screen types flat and curved generally flat screens are recommended for this projector Flat screens offer a gain of about 1 with a viewing angle just less than 180 Incident light reflects equally in all directions so the audience can see the display from various angles Because of the low gain flat screens are most effective when ambient lighting is reduced although this difference may be negligible given the high brightness output from this projector Flat Screen gain 1 Viewing Angle N Audience Coverage Figure 2 6 Audience Coverage with Flat Screen N INSTALLATION AND SETUP Screen Size Screen Aspect Ratio NOTE Lenses for this projector are designed primarily for use with flat screens but the projector depth of field range allows the lens to be focused on curved screens as well While focus remains sharp in the corners there may be significant pincushion distortion primarily at the top of the screen Rear Screen Installations There are two basic types of rear screens diffused and optical A diffused screen has a surface which spreads the light striking it Purely diffused screens have a gain of less than 1 The main advantage of the diffused screen is its wide viewing angle similar to that of a flat screen for front screen projection Optical screens take ligh
197. ription and Use 3 5 Specifications 5 4 Keypad Wired 3 6 3 45 Keystone 2 11 3 29 L Lamp Cleaning 4 3 Mode 3 48 Recording Serial Number 3 50 Specifications 5 3 Lamp Counter 4 4 Lamp History 3 50 Lamp Hours 3 47 Lamp Limit 3 48 Lamp Menu 3 47 Lamp Message 3 47 Lamp Modes Intensity 3 48 Max Briehtness 3 48 Power 3 48 Lamp Replacement Warning 4 2 Lamp Replacement Procedure 4 4 Lamp Serial Number 3 47 4 8 Language 3 41 LCD Status Display 3 4 LEDs Status 3 4 3 56 Lens Calibration 3 11 Centering 3 12 Cleaning 4 3 Motorized Functions 3 10 Offset Adjustment 2 25 Types Available and Specs 5 1 Lens Control Menu 3 11 Lens Installation Replacement 4 9 Lens Key 3 11 Leveling 2 1 2 14 2 24 Special Mounting 2 14 Lifting 2 3 Locked Channel Checkbox 3 23 Luma Delay 3 36 M Main Menu 3 14 Menu Channel Edit 3 22 Channel Setup 3 20 Color and Uniformity 3 42 Color Setup 3 32 Color Temperature Setup 3 33 Communications 3 42 3 44 Configuration 3 41 Diagnostics and Calibration 3 43 Geometry 3 42 Image Settings 3 30 Input Levels 3 36 Lamp 3 47 Lens Control 3 11 Main 3 14 Menu Preferences 3 41 Odd Pixel Adjustment 3 43 Service 3 44 Size and Position 3 25 Status 3 50 Tiling Setup 3 52 Video Options 3 35 Menu Font Size 3 42 Menu Key 3 8 Menu Location on Screen 3 41 Menu Navigation 3 14 Menu Preferences Menu 3 41 Menu System Navigation 3 24 Minimum Dela
198. rking with the Lamp NOTES 1 Requires double serial links RS 232 and RS 422 between all projectors in a network 2 Set each projector s Broadcast Key OFF 3 Keypads cannot broadcast in a split network use controller s instead 4 Do not use a split network when downloading new projector software to a network Communications Communications Baud Rate 38400 Baud Rate 38400 FrontIR AorB FrontIR AorB v Back IR AorB vi U Back IR AorB v Wired Keypad A or B v Wired Keypad A or B v Broadcast Key Broadcast Key x Projector Projector 003 ON mb 7 Split Network OFF mu 7 Split Network 7 CABLE CONNECTIONS CABLE CONNECTIONS RS RS 422 m sss Tel NOTE Required for downloading new Sees projector software to a network RS 232 RS 232 m a a _ _ 01 232 RS 232 RS 232 Either Either Figure 3 25 Split Network Checkbox ON vs OFF VVhenever you Install a new lamp in the m proyector you must access the Lamp submenu Lamp Hours 20 available from Main and record the lamp Lamp SIN 987654321 serial number in the proyector s memory You 1 Lamp Message can also choose the lamp operation mode you 2 Lamp Limit 1000 2177 prefer such as maintaining a specific intensity 3 Lamp Mode Power v light output or power level and define the 4 Power 500 expected lamp life Read only Information 5 Includes the lamp serial n
199. rmal INTELLIGENT LENS SYSTEM Enable Intelligent Lens System ILS to add the 4 lens positions focus zoom horizontal and vertical offset to the current channel settings recorded in projector memory see 3 5 Using Inputs and Channels if you are unfamiliar with channels This feature is particularly useful if you are using sources with differing aspect ratios such as anamorphic vs 5 4 When switching to and from such displays the Scroll menu with AON and AOFF 7 Lens Control nu automat cally move to the last Focus 3140 defined position 2 Zoom 5711 gt Adjust with A ana P orea a i 3 Lens Horizontal Offset 4881 uickl 4 Lens Vertical Offset 2664 q ti 7 th 5 Intelligent Lens System op 6 Calibrate Lens A these lens settings in display for focus 7 Center Lens current channel memory zoom and offsets ILS is a global Figure 3 5 Lens Settings and the ILS function any lens settings you subsequently define for other channels will be recalled whenever you use those channels Delete the checkmark if you want to use consistent zoom focus and offset settings for all channels the lens will not move unless you re adjust a lens setting For full details regarding optimization of JLS performance refer to 2 8 Zoom Focus and Lens Offset CALIBRATE LENS Select Calibrate Lens to ensure that the physical mid point for each of the four lens fun
200. rror in flash ROM Download new software Attempting to download code without being in boot mode Invalid interrupt Power off on If persists contact dealer factory LAMP BALLAST Unable to turn the lamp on Lamp is overheated Replace IPM 16 25 Lamp may be on before being turned on 32 Unable to program the Sync Xilinx part 36 l 37 i 36 Write to flash ROM failed 37 General IPM failure 38 Code being downloaded will not fit in ROMs PANEL DRIVER MODULE LIGHT ENGINE ELECTRONICS Unrecognized Panel Driver Module PDM Unable to program a device on Panel Driver programming bus Panel Driver optical system Communication problem 45 Green Formatter flex cable problem 52 Fan 2 failed part of Cooling Module Fan 4 failed side fan top connects to J39 on ICM Low voltage power supply failed to turn on MOTOR CONTROL MODULE not in all projectors Problem communicating with MCM 62 Unable to program the MCM field programmable gate array INTERCONNECT OR CHASSIS I D Unable to access EEPROM on the ICM EEPROM memory has re initialized VIDEO DECODER MODULE INPUT 3 OR 4 Unable to program the video decoder VDM OPTIONAL INTERFACE MODULE If you encounter a system error try resetting the projector by powering it off and on again cooling if necessary Contact dealer factory if error persists Roadster Vista User s Manual 3 57 Section 4 Maintenance 4 1 Warnings
201. rt of the green video Roadster Vista User s Manual A 5 GLOSSARY SSS Sync Width TTL Video Terminated Throw Distance Tint Variable Scan Vertical Frequency Vertical Offset Video Video Decoder Video Standard Viewing Angle White Balance White Field YCbCr YPbPr YUV Zoom A 6 Roadster Vista User s Manual 3 Separate sync or H SYNC and V SYNC the horizontal and vertical components of the sync are on two separate cables The duration of each sync pulse generated by a computer The sync width is part of the blanking time A type of RGB video with digital characteristics A wire connecting a single video source to a display device such as a projector must be terminated by a resistance usually 75S for video The distance between the front feet of the projector and the screen Also called Projector to Screen Distance Always use the correct Christie throw distance formula to calculate the proper throw distance 5 required for your lens Balance of red to green necessary for realistic representation of NTSC signals The ability of a projector to synchronize to inputs with frequencies within a specified range The frequency at which images are generated Vertical frequencies vary amongst sources Also called vertical scan rate The difference between the center of the projected image and the center of the projector lens For this projector this value is expressed as the maximu
202. rvicing can be performed on site If you have purchased the projector fill out the Purchase Record below and keep with your records In addition make sure to complete the Warranty Registration at the Christie website this will ensure that you receive all future product communications promptly Purchase Record Dealer Phone Number Projector Serial Number Purchase Date Installation Date if applicable NOTE The projector serial number is located on the projector s rear identification label 1 2 Roadster Vista User s Manual Section 2 Installation amp Setup This section explains how to Install and set up the proJector If you are familiar with the proJector and want to quickly set it up for temporary use follow the Quick Setup instructions below For a more complete setup follow the instructions and guides covered in the remaining subsections This section assumes that the video decoder is installed NOTE The lens is not installed for shipping For instructions on how to install or replace a lens refer to 4 5 Replacing the Lens Follow these steps for quick setup of the projector in a standard floor mount position 2 1 Quick Setup STEP 1 STEP 2 STEP 3 STEP 4 Position the Projector Set the projector at the expected throw distance projector to screen distance and vertical position See 2 3 Projector Position and Mounting and Appendix E Make sure that the projector
203. ry Adjustments are related so you may have to go back and forth until both bands are Just optimized 6 Repeat Steps 2 5 with the other two remaining primary colors When each primary color shows one optimized black band and white band the input levels wFT G A gt w w lt c lt w _w a wa gt X Xss OPERATION Input Levels 1 2 Red Pr Blacklevel 50 2 3 Adjust corresponding Red 3 4 5 6 Green Y Input Drive 50 2 7 Blue Pb Input Drive 50 2 8 9 0 for this source are correctly set Upon exiting the Input Levels menu the Peak Detector checkbox will clear Auto Input Level blacklevel red green or blue until one black band appears Green Y Blacklevel 50 2 Blue Pb Blacklevel 50 2 Red Pr Input Drive 50 2 4 Aqjust corresponding input drive red green i blue until one Clamp Tip OEY white band appears R Color Enable Red v PP ed N Choose one primary color at a time Peak Detector 1 Enable Peak Detector Figure 3 21 Adjusting Input Levels Using the Peak Detector RED EXAMPLE SHOWN Processing Mode This control determines the gt 1 Auto projector s processing route for 8 bit ony amp 2 Video Not in this the incoming signal 3 Graphics HDTV wee 1 AUTO default The moriul pt projector will automatically select the correct processing mode according to what i
204. ry 2000 TO CHANGE FROM INFRARED TO WIRED Remove battery compartment cover from back of keypad Remove batteries Wait 1 2 minutes Plug the keypad cable available separately into the empty battery compartment Make sure that the battery cover is notched smoothly to accommodate the cable Set keypad protocol as desired using wired jumper settings Replace battery compartment cover Plug into the 3 pin XLR port at the rear panel of the projector TO CHANGE FROM WIRED TO INFRARED Unplug the keypad from the projector Open the keypad back and unplug the keypad cable Wait 1 2 minutes Install batteries see Section 4 Set keypad protocol as desired using IR jumper settings Replace battery compartment cover Roadster Vista User s Manual 2 37 Section 3 Operation Eu s 3 1 Overview 2 0 3 2 Projector Basics This section explains how to use the projector once it has been installed Please read through these pages before using the projector for the first time An understanding of projector features and how to access them will help you to take full advantage of the capabilities of the projector within minutes NOTE Installation involves locating the projector and adjusting it for use at that location If you have not yet installed the projector refer to Section 2 Installation and Setup Most projector functions and adjustments are initiated via keypad commands that either control the pr
205. s Channel Next Channel 4 m Auto Source A V 224 lt Hinttext Figure 3 13 Channel Edit Menu SAMPLE CHANNEL ED T STEP 3 If desired edit the following channel setups in the Channel Edit menu CHANNEL NAME An alpha numeric label can be defined and or changed here Channel names can be up to 12 characters in length CHANNEL NUMBER A channel number from 01 to 99 can be changed here NOTE If you enter a channel number that already exists a dialog message appears indicating that this number is already in use assign a different channel number SWITCHER NUMBER represents the projector itself Or if the input source is connected to a switcher the default will be the lowest switcher number available from 1 9 change here as desired SLOT 1 Input 2 leug 3 Inpu3 or 4 leug for projector inputs or current slot number 1 9 if the source is connected to a switcher LOCKED If checked all of the image settings for this channel are disabled If unchecked default all available image settings can be adjusted as desired You cannot use Auto Setup with a locked channel IN MENU If checked default except for automatically defined channels with unchanged parameters this defined channel will then appear in the list available when key is pressed If unchecked the channel must be accessed via on the keypad or via the Auto Source function NOTE On screen display of the channel list is an opti
206. s For one projector Eyebolt A remove the feet insert 4 Keep eyebolts provided and attach a hoisting rigging frame that with NO SLACK will enable cables to remain vertical at all times Add safety strapping at the side handles before hoisting into place Never hoist or suspend a proyector if there is any slack 0 24 in cabling or straps and keep strap per all cables in place for a flown installation NOTE Use straps and cabling with load capacity adequate for the projector weight See Section 5 For a stack of two projectors remove the small chrome cover near each corner of the lid and install the threaded rods and heavy duty eyebolt couplings provided in the Christie Hoisting Stacking Kit NOTE Follow all instructions provided with the kit Use a minimum of one safety strap per projector i e if you are hoisting a stack of 2 projectors both projectors must have their own safety strap attached See Figure 2 5 Figure 2 2 Minimum Hoisting Configuration for One Projector Raadste ONLY Figure 2 3 Do not hoist by handles or feet Do not angle cables or straps TO HOIST NON INVERTED Roadsters You must use the hoisting hardware available in a Christie Hoisting Stacking Kit specially designed for the projector follow the instructions provide with the kit Hoist with cabling and straps as described for inverted Roadsters abo
207. s a communications connection for Christie s Marquee Signal Switchers RS 422 SERIAL INTERFACE WITH LOOP THROUGH Allows one or more projectors to be remotely controlled by an RS 422 compatible computer or controller such as the Two Way Controller accessory RS 422 communications can travel greater distances than can RS 232 communications but require RS 422 compatible equipment AC LINE CORD INPUT Use the AC supply specified and always use the line cord provided with the projector See Section 5 Never unplug while the fans are running Model AC Power Specifications X S3 and X S4 100 240 VAC 50 60 Hz max 11 5 amps 100V X S5 and X S6 200 240 VAC 50 60 Hz max 8 5 amps 200V X9 S9 200 240 VAC 50 60 Hz max 12 amps 200V A wARNING A Do not attempt operation if the AC supply is not within the specified voltage and povver range Use the specified line cord STATUS POVVER LEDS Two LEDs light emitting diodes located in the lower right corner of the rear connector panel indicate projector Status top and Power bottom During normal operation the Power light is steady green and the Status Roadster Vista User s Manual 3 3 OPERATION I U F lt I lt II lt I lt lt I II II I IIIIIIIWII EI PH IDII II I I I II I I H I III IZ I9III I IO IIAI lt AII IXIRc 55558 3 4 light flashes green each time a key is pressed or when the projector receives a ser
208. s keystoned or exhibits uneven brightness the projector may simply be too high or low in relation to the screen 3 Recommended offset ranges can be exceeded however this may affect image quality 4 Simultaneous horizontal and vertical offset limits the adjustment range of each Offset ranges are reduced when offsetting in both horizontal and vertical directions simultaneously For inverted projectors invert the Vertical Offset illustrations THE HORIZONTAL POSITION of the image can be offset that is shifted left or right of lens center either by turning the bottom knob on the front of the projector the knob farthest from the IR sensor in non motorized projectors or through software in motorized projectors The maximum horizontal offset for lenses that can be installed in this projector is shown in Figure 2 14 This value expresses the maximum percentage of the image that can be projected to one side of the lens center roughly 77 depending on the lens Roadster Vista User s Manual 2 13 INSTALLATION AND SETTJUP0 k mc G j c SC w a wu w w lt c a gt lt D lt c gt lt lt lt x xi s i o Qi Oo oy o S Oi Ji Figure 2 14 Maximum Horizontal Offsets ALL LENSES Mounting For typical front or rear floor mounts mount the projector on a secure table or cart Take care w
209. s no signal present all source dependent adjustments are disabled 2 After 15 minutes of inactivity the projector leaves the menu system and returns to the presentation 3 The Status menu is read only When finished with a function menu do one of the following e Press to return to the previous screen e Press to leave the menu system and return to the presentation If at any time you are uncertain what to do next press to display detailed information about the current menu or highlighted option A scroll bar appears on the right hand side of a help window if there is additional text use the arrow keys to scroll Press again to exit Size and Position Resize Presets No Resizing Size 1000 F Vertical Stretch 1000 gt gt Pixel Track 1600 EP Pixel Phase 1 2 3 4 5 6 Filter 0 Help Help Filter 7 8 9 0 On line Help H Position 700 Adjustment of low pass filter of the image signal V Position 545 WEO Z A higher number adds more filtering reducing the bandwidth of the image Lens Control More From presentation level press to access general Help Topics Scroll as necessary within a topic Press to return to your presentation At the bottom of some menus a line of hint text also appears 3 14 Roadster Vista User s Manual Time outs The Global Icon Using Slidebars and Other Controls OPERATION Help Topics 1 Using Help He
210. s projector as described below RS 232 Ports From most computers connect an RS 232 serial communication cable between the computer and the projector serial port labeled RS 232 IN this 9 pin D connector port is located near the bottom center of the projector s rear control panel see Figure 2 27 Then set the projector baud rate to match that of the computer changing the baud rate is described in 3 7 Configuring System Parameters NOTE Refer to Appendix D for complete cable wiring details Roadster Vista User s Manual 2 27 INSTALLATION AND SETUP 2 28 Roadster Vista User s Manual INPUT 2 INPUT 3 INPUT 4 COMPOSITE VIDEO S VIDEO Z s 306 5 ecoder r 600 L Loop INPUT 1 REMOTE RED GREEN BLUE 7 VERT SVVITCHER RS 232 IN RS 232 OUT STATUS C O POWER 9 pin D style connection lt i To computer Figure 2 27 5 232 Serial Connection to a Computer RS 422 Ports Some computers can provide RS 422 serial communications often through a plug in adapter or external converter rather than the more common RS 232 RS 422 communication has differential transmits and receives and is generally better suited for long distances than is RS 232 communication RS 422 is not compatible with RS 232 connecting one to the other could damage the equipment at either end If you wish to contr
211. sage but for best results you should reset the proyector povver the projector down and up again with the key System Errors A system error message indicates that a serious malfunction has been detected and must be reported to the manufacturer see Status LED Codes below The projector will no longer operate and must be reset power the projector down and up again with the key The Status LED Codes If the Status LED on the back of the projector repeatedly flashes a pattern of yellow and red light while the Power LED glows a continuous red you have encountered a likely system error requiring the attention of a qualified service technician see System Warnings and System Errors above Try resetting the projector by powering it off and on again cooling when necessary Consult Table 3 3 and contact your dealer if the problem persists The specific pattern of flashing indicates the 2 digit code identifying the type of problem encountered the number of yellow flashes represents the first digit and the number of red flashes indicates the second digit For example a pattern of yellow yellow red red red is Code 23 meaning the lamp ballast power supply is overheated These codes are listed in Table 3 3 lt a mua nsN om aa w c ww a gt gt gt gt gt gt gt gt gt gt 3 X Xss OPERATION Table 3 3 System Error Codes Code Description GENERAL 12 Software bug Contact dealer factory CRC e
212. side panel STEP 4 Open the lamp door e See Figure 4 3 Loosen the 2 screws fastening the lamp door shut e Lift the door fully open it will stay up on most models 4 e 25252 2 S a 25954 ache eL r m fe eee he 2 nee s b ri Poea oe s b z Not shown Air deflector on underside of X9 S9 lamp door Do not remove Swing door UP Figure 4 3 Open the lamp door Roadster Vista User s Manual 4 5 MAINTENANCE 4 6 STEP 5 STEP 6 Roadster Vista User s Manual Loosen the spring loaded T bolts The lamp module is secured to its alignment plate with 3 large spring loaded T bolts that lock in and out with a 90 turn they are the largest heads visible on the alignment plate To unlock each T bolt use a Phillips screwdriver to push and turn each bolt 90 The pin behind each bolt will align with its slot and pop the bolt free See below Roadster X4 S4 X6 S6 Vista X3 S3 X5 S5 Lamp Leads Spring loaded t bolts 3 Terminal block Alignment plate Push and turn 90 Roadster X9 S9 Interlock wires secured in clip y Spring loaded t bolts 3 Push and turn 90 Figure 4 4 Loosen the spring loaded T bolts NOTES L In older models if access to the bottom screw is blocked reduce vertical offset of the lens 2 In X9 S9 you may want to remove the side
213. slot 2 on switcher 1 and the RGB output from switcher 3 to slot 3 on switcher 1 Note that slots used in this manner on switcher 1 are no longer recognized as inputs to the proyector if you select a slot location that is connected to another switcher s RGB output the projector will display the no input signal error message Roadster Vista User s Manual 2 23 INSTALLATION AND SETTUP a a w a a CL c w a a a a a a gt gt gt gt gt gt gt gt 535 5 NN FFny Plug the proyector s high current line cord into the line input socket located in the 25 Power Connection 2 24 2 6 Operating Orientation 27 Leveling Roadster Vista User s Manual lower right corner of the rear panel of the projector then plug the 3 pronged end of the line cord into a grounded AC outlet Input voltage to X3 X4 S3 S4 models must be capable of 100 240 V AC For all other models it must be 200 240 VAC Use the proper power source and the high current rated line cord provided See Section 5 Specifications for all power requirements A WARNING A Do not attempt operation if the AC supply and cord are not within the specified voltage and power range Caution for Shutdowns Once the projector is turned off the lamp cooling fans will continue to run for approximately five minutes to ensure that the projector and lamp have sufficiently cooled at which point the fans will automatically shut off To avoid ther
214. standard on Vista models only 3 Trademarks are the rights of their respective owners Roadster Vista User s Manual F 3 OPTIONAL INPUT MODULES M DVI Input Module 38 804635 xx Digital HDTV Input Module F 4 38 804611 xx Roadster Vista User s Manual The DVI Input Module can be installed in the projector at INPUT 2 to display digital video input signals conforming to the DVI Digital Visual Interface single channel standard DVI Input Module INPUT OUTPUT O a Ome a Features Q Q Q The Supports Digital Visual Interface DVI single channel Supports VESA Extended Display Identification Data EDID Provides an active loop through using a DVI connector conforming to the DVI Specification Digital HDTV Input Module can be installed in the projector at INPUT 2 where it accepts a digital 4 2 2 component HDTV signal YCbCr via a single SERIAL IN BNC connector The signal can loop through the SERIAL OUT BNC out to another device such as another projector Inputs are 75S terminated Digital HDTV Module 804611 SERIAL IN SERIAL OUT ERROR Q Lock Q Q SIGNAL Q FREQ Features Q accepts a variety of digital HDTV 4 2 2 component signals YCbCr and 4 serializes into a parallel 20 bit 4 2 2 component signal 10 bits each for Y and CbCr SMPTE 292M compatible Two data rates 1 485 Gb sec or 1 485 1 001
215. ster Vista User s Manual a collection of settings that determine how the keypad operates Once assigned this protocol remains in effect until it is changed that is the keypad will operate as it currently does until you change its protocol Protocols are most useful for multiple projector applications For example you might want to change a keypad protocol if you are working with two projectors and two remote keypads in the same room and need to control each projector independently Figure 2 34 When Keypad A has a different protocol than Keypad B each keypad communicates only with the projector having a matching protocol Or if you have a network of two or more projectors connected together via RS 232 serial ports you may want only certain projectors to respond to a wired keypad thus you can use different protocols to limit responses NOTE Matching the protocol on the projector to that of a keypad is done through a setting in the Communications submenu See 3 7 Configuring System Parameters for further information on how to change the projector s infrared sensor rear and front protocol A protocol for either type of remote keypad IR or wired can be changed through software commands entered on the keypad A new protocol set through software commands remains in effect until the keypad batteries are removed and replaced if an IR remote or until the keypad is unplugged if a wired remote A remote can also be changed manuall
216. t from the projector and redirect it to increase the light intensity at the front of the screen This reduces it in other areas A viewing cone similar to that of a curved front screen installation is created To summarize optical screens are better suited for brightly lit rooms where the audience is situated within the viewing cone Diffused screens may be better suited when a wide viewing angle is required but there is low ambient room lighting Screen size may be from 5 to 40 feet diagonal depending on the lens you are using For instance a 1 2 1 lens can produce a 5 to 25 foot image size whereas a 4 7 1 zoom lens produces an 8 to 40 foot image size Choose a screen size which is appropriate for your lens and application Keep in mind that if the projector will be used to display text information the image size must allow the audience to recognize all text clearly The eye usually sees a letter clearly if eye to text distance is less than 150 times the height of the letter Small text located too far from the eye may be illegible at a distance no matter how sharply and clearly it is displayed To fill a screen with an image the aspect ratio of the screen should be equal to the aspect ratio of the image The aspect ratio of an image Is expressed as the ratio of its width to its height Standard video from a VCR has a 4 3 aspect ratio For example to display a VCR output with a 4 3 aspect ratio onto a 10 foot 3m high screen the width of t
217. t stand or table If the projector is to be ceiling mounted only use a Christie approved ceiling mount fixture A projector and cart combination should be used with care Sudden YN stops excessive force and uneven surfaces may cause the projector and cart combination to overturn Roadster Vista User s Manual 4 1 MAINTENANCE I III II 9I I I lt I III I lt KZII I II IIVIKC lt I KIZIII II I zI II lt I lt I I I II I lt IIIII u4 I SI IIIIII I II IEI 4 IYI YIIIII I II AI Ke I lt z O sLQIEaeE RKE EE D EEZI lt LZ 2IE Y EE ww s 4 2 Lamp and Filter Replacement Power Cord and Attachments Ventilation Roadster Vista User s Manual LAMP Do not operate the Xenon lamp for more than 1000 hours risk of the lamp shattering increases as a result of changes in the quartz glass Also operation beyond 1000 hours significantly reduces brightness output A WARNING A Never attempt to remove the lamp housing directly after use The lamp is under great pressure when hot and may explode causing personal iniury and or property damage Allovv to cool completely The arc lamp operates at a very high temperature and pressure Failure to allow the lamp to sufficiently cool prior to handling could result in an explosion causing personal injury and or property damage After turning the projector off it is important that you wait at least five minutes before unplugging it Th
218. tage automatically increases until the lamp is utilizing the full 1700W This self adjusting behavior results in less lamp drop off over time images are brighter for a larger percentage of overall lamp life 3 48 Roadster Vista User s Manual _c_ wa a a lt n a a a gt a _ _ a apw G h X ss OPERATION POWER The number shown here Indicates how many watts are applied to the lamp In the X5 X4 S3 S4 set from 450 700 watts as desired In the X5 X6 S5 S6 set from 800 1200 watts as desired In the X9 S9 set from 1200 1700 watts as desired For any model keep in mind that lower power levels produce dimmer images When in Power or Max Brightness modes the power level remains constant When in Intensity mode the power level will change as necessary Specifying the maximum power level in Power mode is the same as operating in Max Brightness mode NOTES 1 Power level can be set only if the lamp is in power mode 2 If you are in Intensity mode the power level value will automatically increase over time as necessary to maintain the desired brightness as closely as possible until power reaches its maximum 3 After approximately 500 hours of use all models using a 700W lamp require lamp power of 550W or higher If set too low the aging lamp can cause a projector shutdown Upon your next power up lamp power will automatically maximize and a message box relates Unexpected lamp off Power set
219. ted Interpolated Color in the Select Color Temp pull down list GAMMA NOTE Gamma does not normally require adjustment and is intended for experienced users only The Gamma option affects the shape of the curve determining Gamma what gray shades are available for a given amount of signal 1 Default Input between minimum black and maximum white 2 Enhanced Different curves can Improve performance for certain kinds of 3 High Ambient source input and applications Generally the best gamma curve 4 PAL SECAM is one that produces maximum contrast brightness and color 9 Linear performance for the current signal and ambient lighting conditions n OPERATION DEFAULT default This setting provides good black levels and high contrast under optimum viewing conditions for virtually all types of images including video HDTV and computer graphics ENHANCED This setting elevates middle gray levels compared to Default and provides a more gradual rolled off transition to maximum white Together these differences can improve the appearance of many kinds of images HIGH AMBIENT This setting elevates low gray levels compared to the Default and Enhanced settings In high ambient light conditions details can be seen in the dark parts of an image that would otherwise be difficult to perceive PAL SECAM This setting results in a darker image with higher contrast The gamma curve more closely matches t
220. ter Vista User s Manual 3 21 OPERATION Uum p qa IEE IH IEI III I I I lt I OAENI I I2ZI WWA Z Uw I I lt I I lt YI I II I2 I I IA E8 I I Ie4 O IvI WI lt IAO I HI4 II IA 3 D AIA4NE I IIOII 4I4E A2 O IAS ws Editing a Channel Setup CHANNEL EDIT STEP 1 CHANNEL EDIT STEP 2 3 22 Roadster Vista User s Manual Channel Setup IG 0 1 p4WH 48 73k 60 01 0 1 iDig 33 72kr 59 944 func A Channel Copy Delete Channel Setup 1 new channel 01 EA 0 1 p4WH 48 73k 60 01 2 Delete identicalto 02 0 1 iDig 33 72k 59 94 chan 202 93 5 2 01 156 33 72k 6000 Doa Pa ony 04 A 01 iDig 33 72k 59 94 san alud Figure 3 11 Copying A Channel TO DELETE A CHANNEL highlight the desired channel In the Channel Setup menu then press to activate the Channel Copy Delete submenu Select Delete and press Eme a confirmation window will appear to make sure that you really want to delete this channel Channel Setup 0 1 p4WH 48 73k 60 01 02 iDig 1st display FUNC A 0 1 iSG 33 72k 60 00 Channel Copy Delete 1 Copy Do you wish to delete this channel setup 2 Delete default gt Delete Channel Setup Cancel 3 Delete Unlocked Only 4 Delete All Channels Figure
221. that the keypad functions in a certain manner Step 4 Set the Jumpers Set the jumpers as shown in Figure 2 36 Take care to refer to the correct part of the drawing IR or wired optional Use tweezers or needle nose pliers to remove and replace each jumper as necessary 1 jumper For either remote set between pins 1 and 2 to set as Protocol A Set between pins 2 and 3 to set as Protocol B 2 jumper For either remote set between pins 2 and 3 as shown otherwise the projector will not respond correctly to keypad commands jumper For the IR remote make sure that the jumper is set between pins 2 and 3 as shown For the wired remote make sure that the jumper is set between pins 1 and 2 as shown 4 jumper For the IR remote make sure that the jumper is set between pins 1 and 2 as shown For the wired remote make sure that the jumper is set between pins 2 and 3 as shown Step 5 Replace battery compartment cover Plug into projector wired keypad only and test Roadster Vista User s Manual 2 35 INSTALLATION AND SETUP 2 36 Roadster Vista User s Manual IR Remote Keypad 321 cm PROTOCOL A JP1 or 321 lal PROTOCOL B Locate Jumpers 321 321 JP3 IR 3 2 WIRED KEYPAD
222. the current function menu Slidebars in menus The current value for a given option such as size or vertical stretch appears to the left of its slidebar icon This number may express a percentage or specific units such as pixels degrees Kelvin etc depending on the option Press lt or to gradually adjust the setting up or down both the number and the length of the bar change accordingly for continuous adjustment hold down the desired arrow key Or press to activate a slidebar text box for specific number entry via the keypad then press 4 or and to save or press to cancel Filter 5 Roadster Vista User s Manual 3 15 OPERATION I U F lt I lt II lt I lt lt I II II I IIIIIIIWII EI PH IDII II I I I II I I H I III IZ I9III I IO IIAI lt AII IXIRc 55558 3 16 Roadster Vista User s Manual Double slidebars In double slidebars such as the pixel Adjust with 4 or tracking pixel phase double slidebar adjust the top slidebar H Position 5381 with 4 or as desired s V Position 414 When you have finished with the Adjust with r top slidebar whether changed or not adyust the bottom slidebar with or Yo When you are done press to return to your presentation For fast continuous adjustments hold down the desired arrow key Direct slidebars For quick access you can often use a slidebar or double slidebar wit
223. tor or controller prevent communications via the other path For this setup connect each projector to the next using both RS 232 and RS 422 ports Then enable the Split Communications S Netvvork setting in the BaudRate 38400 Communications menu for FrontIR AorB 4 each projector present so that BackIR AorB v RS 232 communications Wired Keypad A or B v remain on RS 232 paths only Broadcast Key LI amam OFF and RS 422 communications Projector 003 remain on RS 422 paths only ON mb 7 Split Network x Fi 2 32 Each ject 7 5 i Figure 2 32 Enable Split Network either type of message depending on which controller initiates the commands should one path fail the second back up network path can be used Only one network should be active at a given time as determined by the controller whether it is RS 232 or RS 422 Note that the Broadcast Key option is OFF c A important Whenever downloading new projector software to networks use a single route network only DISCONNECT any redundant serial cabling and UNCHECK the Split Network checkbox for each projector Two Different Splits There are two different split network configurations possible Figure 2 33 Set up whichever option best suits your application needs A SPLIT NETWORK WITH ONE CONTROLLER If you have a single controller and want a back up serial link connect one c
224. ts as desired You must have an unlocked channel present to use Auto Setup Table 3 2 Auto Setup Parameters What an Auto Setup Does OPTIMIZES SETS TO DEFAULT Pixel Tracking Contrast amp Brightness Pixel Phase Auto Input Level off Size Vertical Stretch Input Levels if analog source n OPERATION Image Size and Position The two page Size and Position menu Size and Position allows you to Increase or decrease the size m 1 Resize Presets No Resizing of your image change its proportion l l 2 Size 1000 aspect ratio move the image to a specific 3 Vertical Stretch 1000 KX area of the screen and refine other related 4 Pixel Track 1600 M parameters Use Size and Position controls 5 Pixel Phase 0 g to match the image precisely to the screen 6 Filter 0 size and aspect ratio needed for your 7 H Position 700 application 8 V Position 545 9 Lens Control Refer to Using Slidebars and Other 0 More Controls earlier in this section if you need help using any of the following Size and Position 2 slidebars or pull down lists to alter your l Top Blank 018 Image Changes made to the Size and Bottom Blank 0 Position menu are applied immediately Left Blank 0 E and are saved when you exit the menu Right Blank 0 E ress or PLL Loop Gain 10 F i Keystone 50 0 Plug amp Display EDID 6 1280x1024x60Hz v Tiling Setup A 2
225. uations You can override this by selecting a value from 1 10 with 1 applying no filtering and 10 applying maximum filtering High filtering levels will soften the image slightly particularly evident along horizontal edges w a a a a w aa a gt gt gt gt gt gt X OPERATION j 3 7 Configuring System Parameters System Configuration And Diagnostics Use the Configuration menu to Configuration o display and or set global system Image Orientation Front vi operating parameters that are i l 2 Language English v typically In effect regardless of 3 Menu Preferences source or to vvork vvith other 4 Communications settings that are not unique to the 5 Geometry current incoming source 6 Color and Uniformity 11 Auto Power Up C NOTE For experienced 8 Diagnostics and Calibration users technicians only 9 Reserved 0 Service In the Configuration menu you can define a variety of general system parameters to suit your preferences run certain diagnostic tests and access the Service Menu password required Settings in the Configuration menu will typically apply regardless of the type of source your are using Image Orientation Use this pull down list to change the orientation of the image according to the orientation of your projector If the setting is incorrect projected images will be reversed and or upside down See 2 6 Operating Ori
226. uently if operating the projector in a dusty environment The filter is located behind the right side panel STEP1 Turn off the projector cool and unplug Before removing or installing a filter turn off the projector and allow to cool for five minutes before unplugging Make sure that the lens cap is on A WARNING A Unplug the projector STEP2 Remove the right side panel e See Figure 4 8 Remove the 5 screws securing the projector s right side panel e Lower the panel slightly to clear two pins at the bottom edge of the projector e Pull the panel off to expose the filter near the front corner Lower panel to clear 2 pins then pull panel straight off Figure 4 8 Remove the right side panel 4 8 Roadster Vista User s Manual ssi Replacing the Before You Begin MOTORIZED ZOOM LENS ONLY MAINTENANCE Replace the filter Slide the used filter out from under the top tab and replace Make sure the wire side faces IN See Figure 4 9 Replace the right side panel Alien the bottom of the panel with 2 pins at the bottom edge of the projector and swing up into place Secure with 5 screws Filter fits behind tab Figure 4 9 Install wire side IN A WARNING A Use only Christie filters Never operate the projector without the filter installed A variety of lenses can accommodate different throw distances and specific types of installations See page 5 1 for details To c
227. umber and age 6 Lamp History 7 Change Lamp NOTE See 4 4 Replacing the Lamp and Filter for complete instructions on installing a new Figure 3 26 Lamp Menu lamp in the projector LAMP HOURS shows the number of hours logged on the current lamp Whenever you record a new lamp serial number this read only value automatically resets to 0 where it begins to log time for the new lamp Lamp Hours also appears in the Status menu LAMP S N is the serial number recorded for the current lamp When you install a new lamp and enter its serial number the number will appear here NOTE Read only LAMP MESSAGE Enter a checkmark if you want to enable a warning message upon power up that the lamp has reached the specified lamp limit and should be replaced Delete the checkmark if you do not want to see this warning instead when your Roadster Vista User s Manual 3 47 OPERATION wG lt wmaan gt u oxrnszli010O 1 lIUIWIIIIKI I NW I I I II I II I I I I I III lt I9I9IoO lt III I IIY lt lt e pp ls ahI _ 8 lt a h l l amp a5a5 x h X lamp expires only the status Information on the back of the projector will provide the warning to replace the lamp NOTES L It is recommended that the Lamp Message checkbox remain enabled 2 When a lamp warning message appears press to temporarily cancel the message The message will continued to appear upon power up until you install a new lamp
228. ut levels set by the Auto Input level function Enabling the Peak Detector activates a special operating mode that detects only pixels that are considered black or white all other levels are displayed as a mid level gray When used with a 16 step grayscale pattern where the black and white bands are known to be at the edges of the image you can watch these isolated areas while adjusting individual blacklevels and input drives as necessary Images from this source will then display correct blacks and whites without crushing See Figure 3 21 1 Display a 16 level grayscale test pattern from the desired external source and enter a checkmark in the Peak Detector checkbox NOTE The Peak Detector will initially render the grayscale as a uniform gray field before adjustment 2 Display one primary color use Color Enable to select 3 For the current color adjust its corresponding Blacklevel slidebar just until a single band of black appears at one edge of the screen This band represents the first band of the grayscale pattern which should be 100 black Do not adjust too far 4 With the same color still active adjust its corresponding Input Drive slidebar just until a single band of white appears at the opposite edge of the screen This band represents the last band of the grayscale pattern which should be 100 white Do not adjust too far 5 Go back and check the black band adjust the blacklevel slidebar if necessa
229. ve TO HOIST AN INVERTED or NON INVERTED Vista Securely wrap hoisting cabling and safety straps around the whole projector Attach to the proper Christie ceiling mount only never suspend or fly this model NOTE Vista models cannot use the Christie Hoisting Stacking Kit for hoisting into place Stacking See Figure 2 4 A maximum of 2 Roadster projectors can be safely secured together with the Christie Hoisting Stacking hardvvare follovv all instructions provided in the kit For safety one projector should never rest on another without the proper HANI INSTALLATION AND SETUP stacking hardware available separately in place firmly securing the projectors together If you are hoisting a stack secure a safety strap to at least one handle of each projector keep the strap taut NOTE Vista models cannot be stacked A WARNING A Do not stack projectors without using Christie Hoisting Stacking hardware The top projector could slide off and cause injury or death A WARNING A A WARNING A Stacking hardware required Figure 2 4 Stacking Raadste only Requires optional hardware A wARNING A Do not invert only one projector within a stack TO HOIST STACKED Roadsters Secure sua Carell the proj ectors together with Christie korina stacking Hoisting Stacking Kit hardware hardware in all 4 following the instructions provided in corner slots A the kit Hoist with cabling and straps
230. vitcher OUT male port Proj male port Wiring D 4 Roadster Vista User s Manual Appendix E Throw Distance Always consult this Appendix when planning a projector installation See also 2 3 Projector Position and Mounting Calculating Throw Distance Correct throw distance depends on the screen size and lens present the larger the image needed the greater the distance you must allow between the lens and screen Once you know the screen size and lens type present you can calculate the precise throw distance you require by using the Throw distance is measured from appropriate formula as screen to front feet of projector found in this appendix Throw distance is the distance between the projector front feet and the screen This measurement is not necessarily parallel to the floor e the projector and screen may be inclined Screen Front Throw Distance Feet centers NOTE If your projector is tilted up or down in relation to the screen as is sometimes the case for large venues or elevated installations throw distance still represents the smallest measurement between the screen and front feet center axes Pre calculated throw distances for the complete range of lens types and screen sizes appear in the charts and graphs on the following pages Refer to these examples to quickly determine the proper throw distance 45 for your installation and lens NOTE Variable operating rang
231. w 2 If two channels have the same distinguishing source characteristics except for the reversal of sync connectors 1 H sync and V sync are switched they are still defined as distinct channels 3 You cannot define a new channel without a signal present If the incoming signal does match an existing channel the image will be set up and displayed as usual according to the parameters currently defined for that channel USING A CHANNEL You can normally select a channel at any time by pressing see right If you want to prevent a channel from appearing in this list you must edit the channel as described current channel in Channel Edit later in this section Such a Channel 01 channel can still be 01 0 2 pDig Display Enter 2 digit channel selected as shovvn at right 02 0 1 p4WH xga elave l b 03 0 4 iSVid Display3 pressiEnter NOTES 1 The current 1 A 1 channel is highlighted ni lofi type E upon entering the Channel List or if this channel is not displayed in the list the first channel in the list is highlighted 2 Channels created automatically do not appear in the Channel List unless a parameter has been changed What Channels All available channels are listed in the Channel Setup menu which describes how Are Defined So Far each channel can be accessed and which serves as the gateway for editing copying and deleting channels From the presentation level press to 3 gt Channel S
232. y c D a D q 5 q m la a I D d D E s D d 5 s fs a m n l D d D d 2 ye M D d f A D d m a lb SSB lm 5 D eeeee lt eeeee ez c l D IT m e Connect both network cable types Use controller as desired RS 232 messages travel RS 232 route only RS 422 messages travel RS 422 route only a u s u uu a T ss y e ARS 232 J i If a projector fails use the other standard Controller with both RS 232 and RS 422 capability to communicate with remaining projectors B Split Network with Two Controllers RS 422 JRS 422 Proj 002 ss Proj 003 001 o o o 00 ANDNNNNNDN UUUUUVUUUUVU ANNNANNANNNANDNA LULLUTLULUULULULL s en d LULULULULULULULULU ANNANNNNNNANN
233. y you can hard wire new jumper settings inside the keypad so that they remain in effect until you change the hard wiring Note that a hard wired protocol can be temporarily overridden by the software protocol change effective until the keypad is unplugged and plugged in again if a wired remote or until a battery is removed if an IR remote m mananam mamas m s s ss mm eee oe 4 oe I m N 1 eee I un MH I Protocol A Protocol B Keypad Keypad Protocol A is set Protocol B is set in Communications menu in Communications menu Figure 2 34 Independent Keypads and Projectors The standard IR remote keypad or the optional wired remote can be set to one of two different protocols A or B To hard wire a protocol to A or B in either remote follow Steps through 5 N INSTALLATION AND SETUP Step 1 Unplug the keypad from the profector applies to vvired remote only Step 2 Unlatch and open the empty battery compartment on the back of the keypad as shown In Figure 2 35 NOTE A wired keypad opens as shown but a cable passes through the battery compartment cover Battery Compartment Figure 2 35 Opening the Keypad Step 3 Find the 4 jumpers located along the latching side of the battery compartment These jumpers set the keypad protocol and other settings so
234. y 3 39 Motion Filter 3 39 Motorized Lens Functions 2 25 3 10 ee INDEX Disabling 4 16 Mounting 2 14 Moving the Projector 2 3 Multiple Projectors 2 34 3 51 And Tiling an Image 3 52 Mute Key 3 12 N Network Split See Split Network Networks 2 31 Providing a Back up 2 32 RS 232 and or RS 422 2 29 No Resizing 3 26 No Signal 3 55 Noise Reduction 3 40 Numerical Entry 3 18 O Odd Pixel Adjustment 3 43 Offset Knobs 2 2 Offsets 2 25 3 2 Horizontal 2 13 Removing 3 12 Vertical 2 11 Optional Modules 2 22 Options 5 5 OSD Key On Screen Display 3 13 P Peak Detector 3 38 Phase Lock Loop 3 29 Pixel Key 3 10 Pixel Phase 3 28 3 31 Pixel Tracking 3 27 4 16 PLL Loop Gain 3 29 Plug amp Display 3 30 Position Key 3 10 Power Loss 3 43 Requirements 2 24 5 3 Setting for Lamp 3 49 Warning 4 2 Power Key 3 6 Presentation Level Definition 3 6 Processing Mode 3 39 Proj Key 3 10 Projector Angles of Operation 2 14 Cleaning Maintenance 4 3 Components 1 2 3 1 5 4 Dimensions 5 4 Hoisting 3 2 Number 3 18 3 46 3 51 Position and Mounting 2 24 Resetting 3 4 3 56 Service 4 3 Ventilation 2 9 4 2 Protocols 2 34 3 45 Changing 2 34 Changing in Projector 3 45 Roadster Vista User s Manual INDEX 3 Pull Down Lists Use of 3 16 R Resizing 3 25 A Tiled Image 3 53 Default 2 2 Resolution 5 1 RGB Connection 3 3 Frequencies 5 2 RS 232 2 23 2
235. ypad to safely change its own protocol 1 Select the A or B option This will ensure that once your keypad is manually changed see Step 2 it will still be recognized by the projector 2 Unplug the keypad and change the protocol in the keypad as desired Do this either by entering the short cut software command or by hard wiring the keypad as described in 2 70 Keypad Protocols and Conversion 3 Plug the keypad back into the projector Return to the Communications menu and select the new protocol you have just set up in the wired keypad TURNING OFF THE WIRED KEYPAD If you want to disable the wired keypad entirely you cannot use it to select the OFF option This safeguard prevents you from accidentally disabling the wired keypad during use Instead use either the built in keypad or the IR remote keypad to select OFF The projector will no longer respond to the wired keypad Broadcast Key Enter a checkmark if you want keypad commands sent to one projector to be relayed to all projectors in a network Note the key will temporarily override the effect of a broadcast setting and allow you to control a specific projector when necessary Make sure to remove the checkmark if using the split network feature Projector Enter a three digit number such as 001 to assign or change a number to the projector currently in use if the current projector already has a number assigned that number will appear here see right Numerica

Download Pdf Manuals

image

Related Search

Related Contents

Dicota D30917  Samsung SGH-B130 User Manual  Guia do Usuário - ProSys  Vupoint Solutions ACS-FS-C1-VP mounting kit  ケモセーフインフュージョンセット  Billy Goat HW651HSP User's Manual  ARIEL DÉTERGENT LIQUIDE - 20L et 60L  C-300 IM  User`s manual (Canada version)  User Manual  

Copyright © All rights reserved.
Failed to retrieve file