Home

CyberShop End User Manual

1. CyberShop2 1 al View a Utities elt 8 2 KA K A e oll Pi Fig 15 1 Application Toolbar This displays the Summaries dialog SUMMARIES gt Bieri Summary By Group Name Siia i Monthly Sales Chart giil Product Stock Reorder Report Out Of Stock Product Report Product Sales Rating Product Tracking O Sales Ledgers ee O O Se Summary fy ip ree Current Financial Statement Fig 15 2 Summaries dialog 88 Page 89 Income Statement The Income Statement processes all sales information based on all items that were sold and displays details with an expected profit Previewing Income Statement To preview Income Statement 1 Select Income Statement 2 Select the parameter Daily Monthly Weekly Yearly or Specify 3 Set From date Select a date for the month week or year that you want to preview Note that the Specify option in step 2 allows you to set a date range 7 71072014 z 7 71772014 z Fig 15 3 Date Range 4 Click Preview to display a preview of the report If you receive an error message PAN Report width is larger than the paper width Fig 15 4 Error i Set your printer settings Paper Size to A4 ii Set Orientation to Landscape iii Try previewing the report again Thursday July 17 2014 July 2014 Product Name Selling Price Quantity Sold Cost Value Sales Value 30 Days Beauty Secret 800 00 1 000 00 5 600 00 7 000 00 1 400 00 T Keys to pow
2. Select Name The lt ALL gt option displays all Creditors names by invoice numbers Selecting a particular name displays all credits owed to that creditor by invoice numbers Click Preview This displays the creditor s list Supplier Creditors Account Summary Sunday July 20 2014 Order Number Name Date Amount Debit Balance 0056654 GREAT Total N 1 800 00 Grand Total N 1 300 00 1 record s Fig 15 11 Debtors List Click the Print button on the report Toolbar to print the report as shown in Fig 15 6 Product Summary By Group Name If a Group Name is specified for each product during the registration of products on the stock list CyberShop automatically categorizes the products and allows you to view the products categorized by their group names This is important because it helps to simplify stock management Previewing Product Summary by Group Name To preview Product Summary by Group Name 1 2 Select Product Summary by Group Name Select Name parameter 91 3 4 r Product Group Anibiotics v Fig 15 12 Product Group Names Click Preview This displays the Product Summary by Group Name Anibiotics Product Expiry Date Quantity CostPrice Selling Price AMOKSIKLAV SYR S126moRml 44 2001 om ow ow peme a a a e ii a a a pao O A a moe P E noem mE a a e S a T i R E a E wem La a ee man ame m f o g e e es a o 00 Fig 15 13 Product Summary by
3. cccsssccesssecesessseecessecescesseeceseaeseecessuesescesaeeceseaeseecessaeeescusuecesceuaaussescauseecessaesescesaeeseseasaeecssaeesessuaeeceseases PUN MeL VS cle AN MUON E scares tn A TAA PAT AE Gates ons sacs cues anes EE A A O O N N ET A EAE a ES OAE e E A A E A A cree eee E Daleme a Se A aa E E EN EE A EE AE E REMOVING a SMO PINS DETAI trennen E EEA E E EE EE EAE N R Removing a Payment Detail mersiewrarir cerak ain EE E ES EAEE Chanter O POENI OE iridir E E EE A N O N Purchase Orders erreen E EE E E E OTE E AAA creatine a New Parchase Order souserig onina e T E E eee Previewing a Purchase INVOICE arn nna E E E EE EE Printing a Purchase INVOICE siccssasccssssacexesocsnanezinsvnsssosndonsssnenseg sessagussieas seupadeainvesaieetnsdnesauensaiaboadetossetess uesansendansassuveannidsanstduavebesavasdaedesavant ena Ee ateen a E E A AN N E AAE EA AAE I TAE E E E P A areas Deleting a Purchase OrdeT ses sect pa esac atecniee bapa ccssntessececseantunssteastionect en 4sdenceusnenssceeaussanqaoninnaseeraaec eeanerninannuaaniesecnqsieuaeeuneaseeeersacacateeenessenaes Removing a Shopping Detail cccssecssssecessseceecessseseecesssecescenseeceseseseecessuecesceuaeeeesceuaeeceseaesaeecessaeaescesnueseseaeseeeessaesesseauecesesnaeesesags BX Aa O dla cee PEE DE ee ner er seep er Sow NE er rn een per eee eee eee ee Chapter 7 EXPENSES rrrainis ienai ER Aa ob eo sauas tect aa e saai EXPENSE do 6 aa E E O E E E E AE TETT Creatine a
4. Customers Products Ctrl F2 Suppliers Ctrl F6 Employees Departments Positions Product Group Names Ctrl F States Countries Exit Alt Bksp Fig 3 39 File Menu 2 Select States This displays the States dialog as shown below in Fig 3 40 STATES g Fig 3 40 States dialog Creating a New State To create a new State 1 Click New on the dialog Toolbar to reset the entry field 33 Page 34 STATES Fig 3 41 States dialog The Save button is displayed as shown in Fig 3 41 Note the buttons that are disabled Clicking Save re enables them 2 Enter Name This must be unique it does not allow duplicates 3 Click Save on the dialog Toolbar to save the record Note that the New button is displayed as shown in Fig 3 40 If entries are made correctly the record is saved Note the report on the Application Explorer Status Editing an Existing State To edit an existing State 1 Navigate to the State that you want to edit through the Navigation Bar For further information on this go to Appendix A 1 of 5 Records aa gt Fig 3 42 Navigation Bar 2 Enter the necessary changes 3 Click Edit on the dialog Toolbar The EDIT ALERT message is displayed EE EDIT ALERT E 4 Are You Sure That You Want To Apply Specified Changes No Fig 3 43 Edit Alert 4 Click Yes to save or No to cancel saving the changes Note the report on the Application Explorer Status De
5. Removing Items from Shopping Details To remove an item from Shopping Details Ww Shopping Details Products Expiry Date _ Cost Price _ Quantity Cont ae TC Invoice Purchase Bank Report Clear Details Save Purchase Save Details Details 4 me Delete Purchase 7 Keys to power 1980L Delete Details 6732205 o a Apply Current Prices To Stock J Fig 6 12 Shopping Details Spreadsheet Select an item on the Shopping Details spreadsheet to highlight it Press Del or Delete on the keyboard or right click the item to display a context menu and select Delete Details This displays a DELETE PROMPT message E DELETE PROMPT E 7 Are You Sure That You Want To Delete The Selected Record Fig 6 13 Delete Prompt Click Yes to delete or No to cancel deleting the record You must remove all Payment Details on the Order in order remove items from the Shopping Details Note the report on the Application Explorer Status 57 Page 58 Removing Items from Payment Details To remove an item from Payment Details 1 Click the Payment Details tab to select it 2 Select an item on the Payment Details spreadsheet to highlight it Payment Details Date Mode Of Payment Credit___ Debit _ Balance _ ME invoice 0 00 1 000 00 800 00 Purchase Bank Report Clear Payment Save Purchase P ai hi i Payments Delete Purchase Delete Payment Mode OF Payme as FIRST BANK Payment Ty
6. Fig 7 4 Expenses dialog To add more items repeat steps 4 through to 7 Note the Invoice Total E g 300 00 Click Payments tab This displays the payment details Note the Amount To Pay Payments EN 7 71172014 Save Expenses Mode Of Payment Cah Save Payment Delete Expenses Cheque Number 4mount To Pay Delete Payment Fig 7 5 Payments Tab 60 Page 61 10 Set Date if necessary 11 Select Mode Of Payment if necessary 12 Enter Cheque Number if Mode Of Payment is not Cash 13 Enter Amount Paid 14 While the cursor is still on Amount Paid press Enter on the keyboard Or right click on the tab surface to display a context menu and select Save Payment The payment details appear on the Payment Details spreadsheet Note the Amount To Pay set to O for complete payment Payment Details Date Mode Of Payment Credit Debit__ Balance _ 771172014 Cash 300 00 0 00 Payments 7 71172014 z a Fig 7 6 Payment Details Spreadsheet 15 Click Invoice on Application Toolbar to preview the Expenses Invoice Or Click Reports menu and select Invoice or press F6 button on the keyboard EXPENSES INVOICE Name GREAT Address LAGOS Invoice No 1 Wed 05 Dec 2012 DESCRIPTION OF GOODS Fig 7 7 Expenses Invoice 16 Click Print on the report Toolbar to print the Invoice E Zoom fox Print Fig 7 8 Report Toolbar Editing an Existing Expenses Order To edit an existing Expenses Ord
7. Make the necessary changes 7 Ifthe cursor is on Unit Selling Price press Enter on the keyboard Or right click on the tab surface to display a context menu and select Save Details The UPDATE PROMPT message is displayed E UPDATE PROMPT This Details Record Already Exists Are You Sure That You Want To Update It All Changes Shall Be Saved Fig 6 10 Update Prompt 8 Click Yes to save or No to cancel saving the Updates Important Edit is possible only when Status is Not Sent the last column on the spreadsheet above Fig 6 9 Note the report on the Application Explorer Status 56 Page 57 Deleting a Purchase Order To Delete a Purchase Order 1 3 Select an order from the Order ID list as shown in Fig 6 5 and press Enter on the keyboard or Double Click on an order to display the order details To search for an order type the first few letters of the order until it becomes visible and then select it Make sure that only the order ID appears on the Order ID as shown in Fig 6 5 Click Delete on the dialog Toolbar The DELETE PROMPT message is displayed E DELETE PROMPT re Sure That You Want To Delete This Record A Deleting This Record Will Also Delete All Its Shopping Details 4nd Payment Details Do You Want To Continue No Fig 6 11 Delete Prompt Click Yes to delete the Order and all its details and payments or No to cancel deleting the Order Note the report on the Application Explorer Status
8. Note the report on the Application Explorer Status 85 Assigning Permissions to a User To assign Permissions to a User If the User is not displayed navigate to it through the Navigation Bar For more information on this go to Appendix i 2 5 Fig 14 2 Navigation Bar Click Permit This displays the Permissions dialog PERMISSIONS E sae ote O Suppliers View ca j ej Saco oe oO Een e e o D1 Customers Yiew pe O Customers Save orem ome atten E TE O Summary Reports View Siaa I Options view Save Expenses Delete Group Names View Save Dt Pentre C Employees Save Expired Items View Delete Employees Delete O States View Save oo 1 Countiiestview Save O Passwords gm L incana Siema Current Stock Report CO Cash Flow Total Cash Report X Sales By Staff Fig 14 3 Permissions dialog Check mark all the necessary permissions for the user Click Select All on the dialog Toolbar to check all the permissions Click Save on the dialog Toolbar The EDIT ALERT message is displayed EE EDIT ALERT Are You Sure That You Want To Apply Specified Changes Fig 14 4 Edit Alert Click Yes to save or No to cancel saving the permissions Note the report on the Application Explorer Status Editing an Existing User 86 Page 86 To edit an existing User 1 Ifthe User is not displayed navigate to it through the Navigation Bar as shown in Fig 14 2 above 2 Ente
9. Shopping Details Expiry Date Cost Price Quantity ARIZ 180 00 eam S ExpiyDate 6737205 1 10 0 Zz Total Quantity Price 11 800 00 180 00 Apply Current Prices To Stock Unit Selling Price 200 00 800 00 Fig 6 4 Shopping Details Spreadsheet 13 To add more items repeat steps 4 through to 12 14 Click Payments tab This displays the payment details Note the Amount To Pay 54 15 16 17 18 19 20 21 Page 55 PURCHASE ORDERS i Order ID 0056654 New e 6 13 2014 0056654 GREAT 2 a 671372014 z Payment Details Mode Of Payment Credit Debit___ Balance _ 671372014 Cash 1 000 00 800 00 120000 Urs o VASA Fig 6 5 Purchase Orders dialog Set Date if necessary Select Mode Of Payment Select Payment Type if Mode Of Payment is not Cash Enter Number if Payment Type is selected Enter Amount Paid This is the exact amount paid to the Supplier While the cursor is still on Amount Paid press Enter on the keyboard Or right click on the tab surface to display a context menu and select Save Payment The payment details appear on the Payment Details spreadsheet Note the Amount To Pay set to O for complete payment Payment Details Date Mode Of Payment_ Credit Debit Balance _ 671372014 Cash k 1 000 00 800 00 Payments Invoice 7 71072014 Purchase Bank Report Clear Payment Mode Of Payment Cash Be Save Purchase save Payment Amount To Pay
10. Tax Deduction 1 000 00 Loan Deduction 500 00 Gross Salary 52 500 00 Net Salary N 51 000 00 Fig 10 15 Payslip 5 Click Print on the report Toolbar to print the Payslip E Zoom oox Print Fig 10 16 Report Toolbar Editing an Existing PayRoll To edit an Existing Loan 1 Click on the item to highlight it on PayRoll Details soreadsheet This displays the details on the entry fields 2 Make the necessary changes 3 Right click on the tab surface to display a context menu and select Save PayRoll as shown in Fig 10 14 above or click the Save dropdown on the dialog Toolbar and select Save PayRoll The UPDATE ALERT message is displayed E UPDATE ALERT J This Record Already Exists Are You Sure That You Want To Save Changes No Fig 10 17 Update Alert 4 Click Yes to save or No to cancel saving the Updates Note the report on the Application Explorer Status Deleting a PayRoll To Delete A PayRoll 1 Click on the item to highlight it on PayRoll Details soreadsheet 2 Press Del or Delete on the keyboard or click the Delete dropdown on the dialog Toolbar and select Delete PayRoll Or right click the item row on the spreadsheet or the tab surface to display a context menu and select Delete PayRoll The DELETE PROMPT message is displayed 77 Page 78 E DELETE PROMPT 2 4re You Sure That You Want To Delete The Selected Record Fig 10 18 Delete Prompt 3 Click Yes to delete or No to cancel deleting the
11. of items ordered by the customer Alternatively enter the quantity and press Enter on the keyboard to add an item to the Invoice The item and the details of the transaction appear on the Sales Details spread sheet With each item added Note the Invoice Total 3 400 00 Fig 5 5 Invoice Total 6 Toadd more items repeat steps 3 through to 5 as shown Fig 5 6 below 47 SALES ORDERS1 L N OBED 6 13 2014 1 ew m OBED 2 a 671372014 Shopping Details Item Name Selling Price_ Quantity Sub Total 7 Keys to power 200 00 400 00 30 Days Beauty Secret 1 000 00 3 000 00 Save Delete Sales Details Payment Details Unit v Number Of Packs o ID Product Quantity 30 Days Beauty Secret v m m v Selling Price 1 000 00 B eseved stock oO S Fig 5 6 Sales Orders dialog 7 Select Payment Details This displays the tab with the payment details Note the Amount To Pay SALES ORDERS1 aaa Order ID f OBED 6 13 2014 1 N ew m 4 OBED 2 z 671372014 z Payment Details Save Sales Details Payment Details 77872014 z Mode Of Payment Cash lt 5100 00 5100 00 oO EEF Fig 5 7 Sales Orders dialog 8 Select Mode Of Payment 9 Enter Cheque Number if Mode Of Payment is not Cash 10 Enter Discount Amount if required To enter Discount Amount in percentage Click the Discount Amount button ellipsis This displays the DISCOUNT RATE dialog DISCOUNT
12. you receive a message 75 Page 76 ERROR ALERT ad The 10000 Repayment Is Started But Not Completed Therefore Delete Is Not Allowed Delete Operation Aborted Fig 10 11 Error Alert Otherwise the DELETE PROMPT message is displayed EE DELETE PROMPT Mi Are You Sure That You Want To Delete The Selected Record Fig 10 12 Delete Prompt 3 Click Yes to delete or No to cancel deleting the record Creating a PayRoll To create a PayRoll 1 Click PayRoll Tab Payroll Details Total Allowances Total Deductions Su 12 4 2012 50 000 00 2 500 00 1 500 00 Accomodation nomen 2 500 00 Tax Deduction 1 000 00 Loan Deduction 500 00 lt a 52 500 00 51 000 00 Fig 10 13 PayRoll Details Spreadsheet 2 Set Date if necessary 3 Right click on the tab surface to display a context menu and select Save PayRoll as shown in Fig 10 14 below The details should appear on the PayRoll Details Spreadsheet Preview PaySlip Print PaySlip Delete PayRoll Fig 10 14 PayRoll Context Menu 4 Right click on the tab surface to display a context menu and select Preview PaySlip as shown in Fig 10 14 above to display a preview of the payslip as shown in Fig 10 15 below Note Selecting Print PaySlip instantly sends the Payslip to a printer 76 Page 77 1 Asiri Festus Department Accounts Rank Position Accountant Date 12 4 2012 Account Number 0000000 Basic Salary 50 000 00 Accomodation 2 500 00
13. 000 00 Total Debit 50 000 00 988 000 00 672772014 CYBERSHOP SALES Mode Of Payment TELLER 23456732 FIRST BANK PLC B 25 000 0 Fig 2 5 Bank Transactions dialog 2 Enter the necessary changes 3 Click Save on the dialog Toolbar The UPDATE PROMPT message box is displayed E UPDATE ALERT This Record Already Exists Are You Sure That You Want To Update It All Specified Changes Would Be Saved Yes No Fig 2 6 Update Alert 4 Click Yes to save or No to reject saving the changes Note the report on the Application Explorer Status Deleting a Transaction To delete an existing transaction 1 Click on the transaction on the spreadsheet to select it This highlights the transaction and displays its details on the entry fields 2 Press Del or Delete on the keyboard or click Delete on the dialog Toolbar or The DELETE PROMPT message box is displayed 14 Page 15 EE DELETE PROMPT 2 7 4re You Sure That You Want To Delete The Selected Record Fig 2 7 Delete Prompt 3 Click Yes to delete or No to reject deleting the record Note the report on the Application Explorer Status Invoice Management Permission Generally employees are not permitted to delete records especially sales records CyberShop provides utilities to set the permissions The delete function for sales and invoicing is now customized to be operational until payment is made for an invoice This basically means that sales emplo
14. 2014_1 Shops mdb Data Restore Completed Successfully Reconnecting Data Reconnection Completed Fig 13 6 Restore Data Storage dialog 84 Chapter 14 Passwords and Permissions CyberShop uses its passwords and permissions to control access to the application and the various utilities and resources within the software This way important and sensitive business information is protected from unwarranted access To process Passwords and Permissions L Click the Utilities menu and select Security Reports Window Help Security Passwords Ctrl J Calculator Shift F1 Backup Data Store Recover Data Store Delete Options Options Shift F9 Fig 14 0 Utilities Menu Select Passwords This displays the Passwords dialog ADMINISTRATOR View Password Fig 14 1 Passwords dialog Creating a New User To create a new User 1 Click New on the dialog Toolbar to reset the entry fields Get f id esa oooO View Password J Fig 14 1 Passwords dialog Page 85 The Save button is displayed as shown in Fig 14 1 Note the buttons that are disabled Clicking Save re enables them Enter User Name This must be unique it does not allow duplicates Enter Password It allows any combination of alphanumeric values Click Save on the dialog Toolbar to save the record Note that the New button is displayed as shown in Fig 3 5 If entries are made correctly the record is saved
15. 3 4 Click Preview This displays Sales Summary by Staff Report Tuesday July 22 2014 Sales Summary For Thursday July 17 2014 Sales Rep Invoice No Amount Discount Credit Change Sub Total ADMINISTRATOR 3 1 400 00 0 00 1 400 00 0 00 1 400 00 Total 1 400 00 Grand Total 1 400 00 Fig 15 31 Sales Summary Report Purchase Orders Summary Report This is used to preview all Purchase Orders displayed either on a monthly or yearly basis Previewing Purchase Orders Summary Report To preview Purchase Orders Summary Reports 1 Select Purchase Orders Summary Reports 2 Select parameter option Monthly or Yearly as shown in Fig 15 28 3 Set From date Select a date for the month or year that you want to preview 4 Click Preview This displays Purchase Orders Summary Report Sunday July 20 2074 Sales Summary Report For July Date Ref Number Amount Paid Balance 7 13 2014 2 3 400 00 3 400 00 0 00 Total 3 400 00 7 17 2014 3 1 400 00 1 400 00 0 00 Total 1 400 00 Grand Total 4 800 00 Fig 15 32 Purchase Summary Report Expenses Summary Report The Expenses Summary Report displays two types of reports i Summary Reports Displays a preview of all monthly expenses summary ii Unit Based Reports Displays a preview of all expenses based on the individual items on the expenses transaction Previewing Expenses Summary Report To preview Expenses Summary Reports 1 Select Expenses Summary Reports 98 Expenses Summary
16. 800 00 atl Delete Purchase Delete Payment 0 00 Fig 6 6 Payment Details Spreadsheet Click Invoice on the Application Toolbar to preview the Purchase Invoice Or Click the Reports menu and select Invoice or press F6 button on the keyboard 55 Page 56 PURCHASE INVOICE Name GREAT Address LAGOS Invoice No 0056654 Fri 13 Jun 2014 Description OF Goods 7 Keys to power 2015 06 13 180 00 1 800 00 Fig 6 7 Purchase Invoice 22 Click Print on the report Toolbar to print the Invoice E Zoom 100 7 Fig 6 8 Report Toolbar Editing an Existing Purchase Order To edit an existing Purchase Order Shopping Details y Sub Total Selling Price Produc Batch Nu Status 1 800 00 200 00 1980 Not Sent ao 7 Keys to power 1980L 8 zal Purchase Bank Report 671372015 Clear Details Quantity 1 0 0 Save Purchase Save Details Total Quantity Price 1 800 00 Unit Cost Price 180 00 Apply C Delete Purchase Delete Details Unit Selling Price 200 00 ete Fig 6 9 Shopping Details Spreadsheet 5 Select an order from the Order ID list as shown in Fig 6 5 and press Enter on the keyboard or Double Click on an order to display the order details To search for an order type the first few letters of the order until it becomes visible and then select it Note that you can also display the details of an Order or Invoice by entering the Order ID or Invoice Number 6
17. ON ora E E O E E MON NE EE a E AE NENE E A E A i E etn POCIIGE OEREO CCI REPO n E E E EE Outo StOCk Produ REDOLT oriri nar E EET E T E E EEA ENEE ee Product Expiry Summary Report sssnciscacsenciacsssavceriansndecsbinnantnseborneatvavaeidenssoncadaneanssseoesonntauedvacersteseenseuinensebadabeisssbanoiaescwatneienedanadsaaiaerss Producto eS a UNV E E E E Product TFC Es ccscacontsevnstaiconsenadesonoisnisetccsye seers tnsnsumsasibactdeacasseeasisebousaresensdawonspuntelwanialdenassensuasmodslawssasadesnaaceneensmenreatrengvarssadeanesountaresactnes fe ekg Eae E geen E etn ee ee een oe Rn eee nee ee ee ee ee eee ee eee PAT CVs LCS ara seshses tesiasencas a tcetese cee senate E O E asap aes tg eas ac E oe ae eceneaaanisaaeeceaet sales Orders Summary RED OME srana ora EEA E E E E SSS N By e aa E E E E A T Purchase Orders Summary REDOT arsane N ANE EREE KANA AN NEEE aA NR a Expenses Summary REDOT sepsrsrssiniinesen ar eeaagiusaa eanecectscmesecadaags suseaseacansaseeeseuassesGdousaapene evonieactassbentesearenesiutiedcsnieteateeeeenstnas PATROL UT AR O E E E E sto A E A TAERE A a AEE N EO Cash Fow Summary REDOT saree ccs cgeeso eter cSucansasanenracecsayecesnateteasaucnnsesennmasecasecescpiebencsuctaseayie teas ouenatgaeanatnectepascesaauersaueetatenenaeoatenntresaicoend Cash Evaluation Summary Report ccssecesssecescssseeceseseceecesseeseecesssecescouseeseseseaeecesaeseecssuaeeesceseeesesscesseecesseuseceeseaeaeesessaeeeseaeaeesesages MUS CONVENT LRT
18. Oe ees ga ee cy getscccece pert E T ta se eaea sen E A A E E O UOTE FW INC al Se ACI G IV eea r O N E coaaatecasoeeetnarerets pA ore T go bodes Wer cnet mae een nn Fee Ret RSE nea eer Tet se ROTO ane Rice ae CENT REO Laer on eee eer ee Re eT eer nner oe een re eee e1 acer sac AA EEIE AEAT E en vanced a TAEA oes cee AA EEN OSESE cae EEE es AAEN EEA EE en vce eon Page 7 85 86 86 87 87 88 88 89 89 89 91 91 92 92 91 93 93 94 95 96 96 97 97 98 98 99 100 101 102 102 103 104 Page 8 Introduction Welcome to Cozar CyberShop a POS Point Of Sales application that has a unique feature by which you can create orders for multiple Customers from one Sales Point This application is designed by Cozar Microsystems to handle automated sales inventory accounting operations in Retail and Wholesale Outlets With Cozar CyberShop you migrate your sales outlet into the cyberspace where transactions and computations are carried out with utmost ease and accuracy Note that these benefits are assured only when your hardware and related software accessories are in optimal working conditions Note that every operation described in this book assumes that you have already started the application and logged in to the Application Explorer For the initial login the ADMINISTRATOR login password is ad without the quotation Page 9 Chapter 1 Installation This chapter shows you how to install CyberSho
19. Quantity 30Days 30 Days Beauty Secret 4 1980L 7 Keys to power 4 2 item s Fig 15 20 Product Sales Rating Report Click the Print button on the report Toolbar to print the report as shown in Fig 15 6 Checking the chart box displays the chart 94 Page 95 Product Sales Rating By Quantity For July 2014 TOP SEVEN PRODUCT SALES RATING BY QUANTITY 4 0 30 Days Beauty Secret 7 Keys to power PRODUCTS Fig 15 21 Product Sales Rating Chart Product Tracking Product Tracking is very important when there is the need to identify a particular Product on occasion of the product being returned by a customer after Sales You can track a product by the following i Name or ii Batch Number That is if the batch number was made available While tracking you can specify whether to search for the Customer that bought the product or the Supplier from whom the product was purchased Previewing Product Tracking To preview Product Tracking Report 1 Select Product Tracking Product Info Fenner eee EEEE Supplier Enter Name Or Batch Number To Track Fig 15 22 Product Info Parameters Select Name to track with Product Name or Enter Batch Number to track with a registered batch number Select Customer or Supplier to determine what to search for Check Dates to specify a date period as shown in Fig 15 3 Click Preview This displays the Product Tracking Summary Report DHPP 95 Tracked Information For The Prod
20. RATE Fig 5 8 Discount Rate Dialog 48 Page 48 Page 49 Enter the Percent Discount Rate numeric Click OK The Discount Amount is calculated and displayed 11 Enter Amount Paid This is the exact amount paid by the Customer Note the value on the Change the balance amount to return to the Customer 12 While the cursor is still on Amount Paid press Enter on the keyboard Sales Details 1778 2014 z Mode OF Payment Cash lt Invoice Amount To Pay 3 400 00 Save Order Discount Amount fo Save Details Fii Save Payment oo OSC S Delete Order Delete Details Del Delete Payment Payment Details O Issued Fig 5 9 Context menu Or right click on the tab surface to display a context menu and select Save Payment The payment details appear on the Payment Details spreadsheet Note the Amount To Pay set to 0 for complete payment Payment Details Change Balance 778272014 3 400 00 4 000 00 600 00 0 00 Fig 5 10 Payment Details spreadsheet If Auto Print Invoice is on do this in the Set Values section in Chapter 3 the Invoice is instantly sent to the printer Otherwise a preview of the invoice is displayed CYBERSHOP SALES OUTLET Be Healed amp Prosper In Jesus Name Amen Rom 13 7 Ikeja 234 8033667378 234 Q082 22720802 yourmail domain com O AAE 2014 3540F PM 2 Keys to power 200 00 400 00 3 30 Days Beauly 1 000 00 3 000 00 5 TOTAL 3 400 0
21. Selected Record Fig 3 15 Delete Prompt Click Yes to delete or No to cancel deleting the record Note the report on the Application Explorer Status Employee Information In CyberShop Employee information is generally necessary for Payroll and Expenses transactions To process an Employee 1 2 Click the File menu CyberShop2 1 aG view Accounts Utilities Reports Customers Products Ctrl F2 Suppliers Ctrl F6 Employees Departments Positions Product Group Names Ctrl F States Countries Exit Alt Bksp Fig 3 16 File Menu Select Employees Or Click Employees on the Application Toolbar This displays the Employees dialog as shown above in Fig 3 17 EMPLOYEES i Employee ID New Festus Asin 0001 isi Nang S fnstNane gt F Date OfBith 872271990 Delete Bae fias gt Court ieran SOSCS S SYdC an Em QT Account Number Sd Fig 3 17 Employee dialog Creating a New Employee To create a new Employee 3 Ifan Employee record is already selected click New on the dialog Toolbar to reset the fields 4 Enter Employee ID This must be unique no duplicates Enter First Name Last Name and Address Select Sex or gender State and Country Set Date Of Birth Enter Phone s and Email if necessary COND Page 26 10 Enter Account Number Bank Account Number for payslip if necessary Click Save on the dialog Toolba
22. Toolbar The UPDATE ALERT message is displayed MS UPDATE ALERT This Record Already Exists Are You Sure That You Want To Update It All Specified Changes Would Be Saved No Fig 5 14 Update Alert Click Yes to save or No to cancel saving the Updates Note the report on the Application Explorer Status Deleting a Sales Order To Delete a Sales Order Select an order from the Order ID list and press Enter on the keyboard or Double Click on an order to display the order details To search for an order type the first few letters of the order until it becomes visible and then select 1 it to display the details of the order Make sure that only the order ID appears on the Order ID as shown in Fig 5 13 Click Delete on the dialog Toolbar The DELETE PROMPT message is displayed 50 Page 51 E DELETE PROMPT Are Sure That You Want To Delete This Orders Record Deleting This Record Will Also Delete All Its Shopping Details Restocking the Quantities And Payment Details Do You Want To Continue No Fig 5 15 Delete Prompt 2 Click Yes to delete the Order and all its details items are restocked and payments or No to cancel deleting the Order You need the appropriate Permissions to carry out this operation Note the report on the Application Explorer Status Removing Items from Sales Details To remove an item from Sales Details Shopping Details Item Name Selling Price Quantity Sub Total 7 Keys
23. Unit Based Summary Daily Monthly O Weekly Yearly Fig 15 33 Expenses Summary Parameters Select the Summary option Expenses or Unit Based Select parameter option Monthly for Expenses Summary Click Preview This displays the Summary Report Sunday July 20 2014 Expenses Summary Report For July Date Ref Number Amount Paid Balance 7 11 2014 1 500 00 500 00 0 00 2 300 00 300 00 0 00 Total 800 00 Grand Total 800 00 Fig 15 34 Expenses Summary Report Expenses Summary For The Month Of July 2014 2 800 00 3 item s Fig 15 35 Expenses Item Summary Report PayRoll Summary Report The PayRoll Summary Report is used to display a summary of all salaries paid on the month in review Previewing PayRoll Summary Report To preview PayRoll Summary Report Select PayRoll Summary Report Set From date Select a date for the month that you want to preview Click Preview to display a preview of the report 99 Page 99 Page 100 Tuesday July 22 2014 PayRoll Summary Report For December 2012 RefNo Name Acct No Basic Salary Type Amount 1 Asiri Festus 0000000 50 000 00 Accomodation Allowance 2 500 00 Tax Deduction 1 000 00 Loan Deduction 500 00 Gross Salary 52 500 00 Net Salary 51 000 00 Total Net Salary 51 000 00 Fig 15 36 PayRoll Summary Report Cash Flow Cash Flow is one of the Summaries in CyberShop that allows you to view the actual cash expected in your cash drawer It displays
24. You Want To Update This Record No Fig 4 5 Update Alert Click Yes to save or No to cancel saving the Updates Note the report on the Application Explorer Status Deleting a Product To Delete a Product Select an Item from the Product ID list and press Enter on the keyboard or Double Click on an Item to display the product details To search for an Item type the first few letters of the Item until it becomes visible and then select it 1 44 Make sure that only the Product Number appears on the Product ID as shown in Figure 4 4 2 Click Delete on the dialog Toolbar The DELETE ALERT message box is displayed EE DELETE ALERT 2 Are You Sure That You Want To Delete This Record No Fig 4 6 Delete Alert 3 Click Yes to delete or No to cancel deleting the record Note the report on the Application Explorer Status Previewing Product Stock List To preview the Product Stock list Press F10 on the keyboard Product Current Stock Details As At Monday July 28 2014 Ret Number pasos Cmetainey mizoga oo f omo f ow fa OATES fe Dentrooe water Bc m Meedes FIG proweedes mo wm w or mas poose o o j o r Aa a E 0m 00 Teme peTIL Tkeyetopewer w f o j o m o poma o o j o o po oo j o y o o A a ew 0m oo oar po perom f o j o O o 5 e S E E i A S S S a E E S E Fig 4 7 Product Stock List Printing Product Stock List To print the Product list click the Print button on the report Toolb
25. a distribution of cash in various transactions including Sales Purchase Expenses and calculated totals such as Total Sales Total Expenses etc Previewing Cash Flow To preview Cash Flow 1 Select Cash Flow Fig 15 37 Date Range 2 Select the parameter Daily Monthly Weekly Yearly or Specify 3 Set From date Select a date for the month week or year that you want to preview Note that the Specify option in step 2 allows you to set a date range as shown in Fig 15 6 4 Click Preview to display a preview of the report 100 Cash Flow For July 2014 Monday July 27 2014 Date Day Details Sales Purchase Expenses SubNet O noma Tuesday J owo f oo f ow owo ranma Wednesday owo owo oo oo ranma thursday owo owo owo oo ranma Friday f owo f oo f owo oo soma saway owo f owo owo oo eama sunday owo ow ow oo mma Monday owo owo owo owo menma Tuesday owo owo owo oo ranma Wednesday S owo owo owo o0 O nona thursday f owo f owo owo oo iaoa Friday ee owo owo f sowo soo CS Exp maaa saway ow ow owo om 713 2014 Sales 3 400 00 000 3400 00 7 14 2014 onday THERON 000 7 17 2014 Thursday Sales 1 400 00 eama Wedresdey om ow om 1400 00 THERON oo oo 719 2014 Saturday a ae p00 Sales Ce tl c Saes l 712012014 Sales Pur 7i2112014 Monday Exp 712212014 Tuesda
26. field and dash for an alphanumeric field Deleting All Stocks To delete all stocks 1 Start CyberShop 2 Login 3 Click Products on the Application Toolbar 11 Page 12 CyberShop 2 1 File View Accounts Utilities Reports Window Help gt 9 2 2 2 a Sales Customers Products Suppliers Purchases Expenses Summaries Calculator Fig 2 0 Application Toolbar This displays the Products Stock dialog PRODUCTS STOCK l x New Product ID Cimetidine inj 200mg 2ml Tagapine 04 9806 a 10 Dextrose water 04 0343 21G Needles Needles 21G 23G Needles Needle 23G 30 Days Beauty Secret 30Days ear Te m e See Init Of Measurement EEE Delete One Use Expiry Discontinued O Fig 2 1 Products Stock dialog 4 Click Delete drop button on the dialog Toolbar and select Delete All as shown in Fig 2 1 above to delete all the items in stock Note For the purpose of security to your stock you will be asked to provide the Administrator s password to complete the process Importing the Stock File To import the stock file 1 Click Import Stock on the dialog Toolbar as shown in Fig 2 1 above This displays the SELECT STOCK TO IMPORT dialog SELECT STOCK TO IMPORT Look in Does e ec ea My Recent Documents File name Stock v My Network Files of type Stock xls x Cancel Places Open as read only Fig 2 2 Select Stock To Import dialog
27. the report on the Application Explorer Status Editing an Existing Supplier To edit an existing Supplier Select a Supplier name from the Supplier ID list and press Enter on the keyboard or Double Click on a Supplier 1 name to display the Supplier s detail Make sure that only the Supplier s number appears on the Supplier ID as shown in Fig 3 10 SUPPLIERS Supplier ID 13 lt Anonymous gt 2 20 2008 1 FRIDAY 671672014 3 New GREAT 6 13 2014 2 FRIDAY FRIDAY 6 71672014 m Contact Telephone 08033667378 friday4real yahoo com Fig 3 13 Suppliers dialog Make or enter the necessary changes Click Save on the dialog Toolbar The UPDATE PROMPT message is displayed E UPDATE PROMPT This Record Already Exists Are You Sure That You Want To Update It All Specified Changes Would Be Saved Yes No Fig 3 14 Update Prompt Click Yes to save or No to cancel saving the changes Note the report on the Application Explorer Status Deleting a Supplier To Delete a Supplier record Select a Supplier name from the Supplier ID list and press Enter on the keyboard or Double Click on a Supplier 1 name to display the Supplier s detail Make sure that only the Supplier s number appears on the Supplier ID as shown above in Fig 3 13 Click Delete on the dialog Toolbar The DELETE PROMPT message box is displayed 25 Page 25 3 EE DELETE PROMPT o 7 re You Sure That You Want To Delete The
28. the tab surface to display a context menu and select Save Percentages as shown in Fig 10 6 above The UPDATE ALERT message is displayed MS UPDATE ALERT j 2 J This Record Already Exists Are You Sure That You Want To Save Changes No Fig 10 7 Update Alert Message box 4 Click Yes to save or No to cancel saving the Updates Note the report on the Application Explorer Status Deleting Allowances and Deductions To Delete Allowances and Deductions 1 Click on the item to highlight it on Allowances Deduction Detail spreadsheet 2 Press Del or Delete on the keyboard or click the Delete dropdown on the dialog Toolbar and select Delete Percentages Or right click the item row on the spreadsheet or the tab surface to display a context menu and select Delete Percentages The DELETE PROMPT message is displayed E DELETE PROMPT wr 4re You Sure That You Want To Delete The Selected Record Fig 10 8 Delete Prompt 3 Click Yes to delete or No to cancel deleting the record Creating a Loan To create a Loan 1 Click Loan Ded Tab 74 Page 75 _Loan Amount Repayment Amount Ra 1274 2012 10000 5 Department Loan Ded Allow Ded 127 4 72012 moo Repayment Amount Per Month 500 pcne Delete Loan so sevecsessseessscssesessessssessesscees Le SeeeseceD reeescenees Mberetaeeseeesens Fig 10 9 PayRoll dialog Set Date if necessary Enter Loan Amount Enter Repayment Amount Per Mon
29. to cancel saving the changes Note the report on the Application Explorer Status Deleting a Bank To Delete a Bank 1 Navigate to the Bank that you want to delete through the Navigation Bar as shown in Fig 3 54 2 Click Delete on the dialog Toolbar The DELETE ALERT message is displayed MS DELETE ALERT an 7 Are You Sure That You Want To Delete This Record No Fig 3 56 Delete Alert 3 Click Yes to delete or No to cancel deleting the record Note the report on the Application Explorer Status Percent Names The Percent Names dialog is used to store the names of Payroll Percent Allowances and Deductions To process a Percent Name 1 Click the Accounts menu Utilities Reports Window Help Sales Orders Ctrl F1 Purchase Orders Local Purchase Orders LPO Banks Bank Transactions Staff PayRoll Percent Names Expenses List Expenses Ctrl F4 Profit Evaluation Summaries Fig 3 57 Accounts Menu 2 Select Percent Names This displays the Percent Names dialog as shown below in Fig 3 58 38 Page 38 ae eration 1 of 13 Records C e fae h Fig 3 58 Percent Names dialog Creating a New Percent Name To create a new Percent Name 1 Click New on the dialog Toolbar to reset the entry field PERCENT NAMES 1 of 13 Records C ee efef Fig 3 59 Percent Names dialog Page 39 The Save button is displayed as shown in Fig 3 59 Note the buttons that are disabled C
30. 0 Net N 3 400 00 Disct 0 00 Paid N 4 000 00 Balance N 0 00 Change N 600 00 Sales Rep ADMINISTRATOR Endeavour To Confirm Your Items Before Leaving Thanks For four Patronage Please Call Again Fig 5 11 Sales Invoice 13 Click Print on the report Toolbar to print the Invoice E Zoom hox l Fig 5 12 Report Toolbar 49 Editing an Existing Sales Order To edit an existing Sales Order Select an order from the Order ID list and press Enter on the keyboard or Double Click on an order to display the order details To search for an order type the first few letters of the order until it becomes visible and then select 1 4 it to display the details of the order Make sure that only the order ID appears on the Order ID as shown in Fig 5 13 SALES ORDERS1 Order ID 1 Shopping Details Item Name Selling Price_ Quantity Sub Total 7 Keys to power 200 00 2 30 Days Beauty Secret 1 000 00 3 Delete Sales Details E 6 13 2014 1 OBED 2 z 671372014 400 00 3 000 00 Unit Number Of Packs 0 ID Product Quantity 30 Days Beauty Secret X taa m X Selling Price 1 000 00 Active Stock P Reserved Stock 0 Fig 5 13 Sales Orders dialog Make the necessary changes C Issued Page 50 Note that you can only make changes to Customer and Date ona sales order But you can remove or add items to Sales Details and Payment Details Click Save on the dialog
31. 2 Browse to the Stock xls file and select it 3 Click Open to initiate the Stock import 4 On completion a message is displayed to indicate a successful Stock import 12 Page 13 Bank Account Management CyberShop can help manage your business account offline by the use of its new Bank Transactions module This actually involves the judicious entry of all bank lodgements and cheque payments With this CyberShop can assist you in monitoring the balances on those accounts This process may include the following All Accounts Bank lodgements Cheque payments To Process Bank Account 1 Click the Accounts menu Utilities Reports Window Help Sales Orders Ctrl F1 Purchase Orders Local Purchase Orders LPO Banks Bank Transactions Staff PayRoll Percent Names Expenses List Expenses Ctrl F4 Profit Evaluation Summaries Fig 2 3 Accounts Menu 2 Select Bank Transactions The Bank Transactions dialog is displayed BANK TRANSACTIONS Date Company Name Mode Of Payment 173 2011 Godslight CHEQUE OCEANIC 1274 2012 ADE CHEQUE FIRST BA Bank Lodgemenis Credit Credit Payments Debit New Print Option None Save C Use Date C Use Bank i Preview Delete Total Credit 11 013 000 00 t Total Debit 150 000 00 Close 963 000 00 671772014 z a Mode Of Payment i FIRST BANK PLC z Fig 2 4 Bank Transactions dialog Creating a New Tra
32. 4 9803 10 Dextrose water 0 0 00 04 0343 res 21G Needles 0 200 00 Needles 21G 23G Needles 0 0 00 Needle 23G 4 3 D saline 0 0 00 0337 5 Fluorouracil inj 0 0 00 04 7427 Cimetidine inj 200mg 2ml T agapine Delete id Quantity Cost Price_ Total Price Fig 8 1 Local Purchase Order dialog Creating a new LPO To create a new LPO 1 If an Order is selected click New on the dialog Toolbar to clear or reset all entry fields else go to step 2 below Important LPO ID is system or auto generated so do not enter it 2 Select Supplier if necessary Set Date if necessary 4 Select an item on the Re Order List Note that the Re Order List displays all items that have their quantities on or below their Reorder Levels m 64 Check All Items to display all items in stock on the Re Order List Enter Qty Request the quantity you are placing an order for Enter Unit Cost Price Enter Remark if necessary If the cursor is on Remark press Enter on the keyboard Or click the Save dropdown on the dialog Toolbar and then click Save Details as shown below This adds the item and its detail to the LPO Product List soreadsheet oS a i LOCAL PURCHASE ORDER oa x 2 GREAT 12 5 2012 2 GREAT 12 5 2012 1 GREAT 2 x 27572012 Z Re Order List 10 Dextrose water 0 0 00 04 0343 O All Items Cimetidine inj 200mg 2ml T agapine 0 0 00 04 980 Save LPO 10 D
33. ALUATION The amount generated is equal to the physical cash counted or amount submitted recommended SHORTAGE EVALUATION The amount generated by the system is more than the physical cash counted or amount submitted This means that all the amounts generated by the system was not submitted not recommended EXCESS EVALUATION The amount generated is less than the physical cash counted or amount presented This means that there is the possibility that all sales invoices were not paid for not recommended To avoid this make sure that all sales invoices are promptly paid on the system However giving discounts on sales invoices may also result in differences between cash generated and submitted To process a Profit Evaluation 1 Click the Accounts menu Peete Utilities Reports Window Help Sales Orders Ctrl F1 Purchase Orders Local Purchase Orders LPO Banks Bank Transactions Staff PayRoll Percent Names Expenses List Expenses Ctrl F4 Profit Evaluation Summaries Fig 9 0 Accounts Menu 2 Select Profit Evaluation This displays PROFIT EVALUATION dialog PROFIT EVALUATION Evaluated Income List Date Cash Generated Cash Submitted Cash Generated id O Range 771372014 lt Fig 9 1 Profit Evaluation dialog Creating a new Profit Evaluation To create a new Profit Evaluation 1 Check Range for a date period 68 a Page 69 Set Begin date if necessary Set
34. Application Explorer Status Removing Items from LPO Details To remove an item from LPO Details 66 3 LOCAL PURCHASE ORDER New Delete Delete LPO POW j GREAT 127572012 2 GREAT 1275 2012 1 GREAT 2 J 127572012 z Re Order List _ Cimetidine inj 200mg 2ml Tagapine 0 0 00 04 9806 O All Items Cimetidine inj 200mg 2ml Tagapine 0 0 00 04 S80R 10 Dextrose water 0 0 00 04 0343 23G Needles 0 0 00 Needle 23G 4 3 D saline 0 0 00 0337 5 Fluorouracil inj 0 0 00 04 7427 7 keys to power 0 0 00 04 7501L a ea LPO Product List Cost Price Total Price 30 Days Beauty Secret 5 0 10 Dextrose water 10 0 23G Needles 15 0 lt Fig 8 7 LPO dialog Select an item on the LPO Product List spreadsheet to highlight it Page 67 Press Del or Delete on the keyboard click the Delete dropdown on the dialog Toolbar and then select Delete Details This displays a DELETE PROMPT message E DELETE PROMPT YD 4re You Sure That You Want To Delete The Selected Record Fig 8 8 Delete Prompt Click Yes to delete or No to cancel deleting the record Note the report on the Application Explorer Status 67 Page 68 Chapter 9 Profit Evaluation Profit Evaluation allows you to compare the physical cash from sales with the amount generated by the system from sales and purchases and then reports a Balance Shortage or Excess evaluation BALANCE EV
35. COZAR MICROSYSTEMS Help Documentation Cosmas Page 2 Copyright 2014 by Cozar MycroSystems 44 46 Adegbola Pavilion Hotel Complex Anifowoshe Ikeja Lagos Nigeria All rights reserved mportant licensing information Please read This book is available for free on CyberShop CD or download from www cozappz com This book is licensed for reading as a user manual only if obtained from the specified sources This book is licensed strictly for personal educational use Redistribution in any form is prohibited The authors and copyright holders provide absolutely no warranty for any information provided The authors and copyright holders shall not be liable for any claim damages or any other liability arising from out of or in connection with the information in this book Please do not use this book if the listed terms are unacceptable Use shall constitute acceptance of the terms listed dited by This publication was edited by Cosmas Arumala product manager Cozar MicroSystems Contents ata Glance ETE TOC CEI IN toc engi vasa een ass Sao visa a Gi nse Gaede ded ks eet aR Chapter 1 Chapter 2 Chapter 3 Chapter 4 Chapter 5 Chapter 6 Chapter 7 Chapter 8 Chapter 9 OM pierce etic testcase te sensed no adres E AS E EAEE S OTET AE AT IEE A AEE Installation What s new in Cybershop soricina AE EAUS NANTE EAER Saa AA EN ENAA Getting started With Cybershop anerian ennn a i a
36. Cash Generated Cash Submitted FAR PANE 3400 3400 7 13 2014 0 Delete Delete Selection Cash Generated O Range 7713 2014 Z ora paca Fig 9 4 Profit Evaluation dialog The DELETE ALERT message is displayed MS DELETE ALERT j Are You Sure That You Want To Delete All The Records Yes No Fig 9 5 Delete Alert 4 Click Yes to delete or No to cancel deleting all the records Note the report on the Application Explorer Status 70 Page 71 Chapter 10 PayRoll The PayRoll module is used to manage all staff payroll information and transactions in the areas of the following i Department ii Payroll iii Loan lt Allowances Deductions To process PayRoll 1 Click the Accounts menu ae Utilities Reports Window Help i Sales Orders Ctrl F 1 Purchase Orders Local Purchase Orders LPO Banks Bank Transactions Staff PayRoll Percent Names Expenses List Expenses Ctrl F4 Profit Evaluation Summaries Fig 10 0 Accounts Menu 2 Select Staff PayRoll This displays PAYROLL dialog i Festus 0001 Department Details Date Dept Name Rank Basic Salary PAYROLL i New Department _ PayRoll Loan Ded 7 72272014 eq Accounts o Position Rank Accountant x FR Status O Fig 10 1 PayRoll Dialog 3 Select an Employee from the Employee list and press Enter on the keyboard or Double Click on an Employee to display
37. CyberShop 2 1 a6 view Accounts Utilities Reports Customers Products Ctrl F2 Suppliers Ctrl F6 Employees Departments Positions Product Group Names Ctrl F7 States Countries Exit Alt Bksp Fig 3 6 File Menu 2 Select Customers Or Click Customers on the Application Toolbar This displays the Customers dialog CUSTOMERS lt Anonymous gt 1 OBED 2 Compan Wame Geese A as Pacorenh 171m0 i mae e Fig 3 7 Customers dialog Creating a New Customer To create a new Customer 1 Ifa customer record is already selected then click New on the dialog Toolbar to reset the fields 2 Customer ID is generated by the system therefore do not enter a value 3 Enter Company Name to set the customer s name This can be the name of an individual or organization Enter Contact Name especially if Company Name in step 3 is an organization Enter the Job Title of the contact Enter the Address Set Date of Birth for the Customer in order to have the customer s name displayed on the Customer Date of Birth alert list on that day o a 22 Page 23 What is important on the Date of Birth are the Day and Month 8 Select the State and Country 9 Enter Telephone and Email 10 Click Save on the dialog Toolbar to save the record If entries are made correctly the record is saved Note the report on the Application Explorer Status Editing an Existing Customer T
38. ERT message box is displayed EE EDIT ALERT J Are You Sure That You Want To Apply Specified Changes uS Yes No Fig 3 67 Edit Alert 4 Click Yes to save or No to cancel saving the changes Note the report on the Application Explorer Status Deleting an Expenses List Item To Delete an Expenses List Item 1 Navigate to the Expenses List that you want to delete through the Navigation Bar as shown in Fig 3 66 2 Click Delete on the dialog Toolbar The DELETE ALERT message is displayed MS DELETE ALERT 2 P Are You Sure That You Want To Delete This Record g Fig 3 68 Delete Alert 3 Click Yes to delete or No to cancel deleting the record Note the report on the Application Explorer Status 41 Chapter 4 Stocking Stocking is the process of collating the details of your stocks and loading them into CyberShop with important details such as the Name Retail Price Wholesale Price if necessary Quantity Cost Price etc There are two types of stocking Electronic Stocking Manual Stocking Electronic Stocking Refer to Importing Stocks from External Sources in Chapter 2 Manual Stocking With manual stocking commonly used Product stocks are entered directly into CyberShop The processes involved in manual stocking include the following Creating a new Product Editing an existing Product Deleting a Product To process a product Click the File menu CyberShop2 1 a6 View Accounts Utilities Rep
39. End date if Range is checked Enter Cash Submitted Observe Balance and Status While the cursor is on Cash Submitted press Enter on the keyboard Or click Save on the dialog Toolbar This adds the detail to the Evaluated Income List spreadsheet Editing an Existing Profit Evaluation To edit an existing Profit Evaluation 1 Select an item on the Evaluated Income List to display its details PROFIT EVALUATION Evaluated Income List Date _ Cash Generated Cash Submitted 7713 2014 3400 3400 7 13 2014 0 Cash Generated O Range 71372014 7 Bator Baan Fig 9 2 Profit Evaluation dialog Make or enter the necessary changes While the cursor is on Cash Submitted press Enter on the keyboard Or click Save on the dialog Toolbar This adds the update to the Evaluated Income List spreadsheet Deleting a Profit Evaluation To Delete a Profit Evaluation 1 Select an item on the Evaluated Income List to display its details Press Del or Delete on the keyboard or click the Delete dropdown on application Toolbar and select Delete Selection as shown in Fig 9 4 below The DELETE PROMPT message is displayed EE DELETE PROMPT ik A Are You Sure That You Want To Delete The Selected Record Fig 9 3 Delete Prompt Click Yes to delete or No to cancel deleting the record To delete all the records click the drop button of Delete and then select Delete all 69 Page 70 PROFIT EVALUATION Eg Evaluated Income List
40. Group Name 10 item s Page 92 Click the Print button on the report Toolbar to print the report as shown in Fig 15 6 Product History With this Summary you can monitor the Purchase history of your products Previewing Product History To preview Product History 1 2 4 Select Product History Select Name parameter Product Info 7 Keys to power 8 7 Fig 15 14 Product Info Names Click Preview This displays the Product History Report Product History Report For 7 Keys to power Ref Number Batch Number Unit Selling Price 0056654 GREAT 632M4 6 13 2015 10 00 180 00 200 00 Fig 15 15 Product History Report Click the Print button on the report Toolbar to print the report as shown in Fig 15 6 Monthly Sales Chart This tool is used for sales analysis and projection It displays payments made on invoices calculated on a monthly basis in the form of graphical columnar or bar charts ranging from January through December Please note that the bars are arranged in alphabetical and not monthly order but with each month of the year accounted for Previewing Monthly Sales Chart To preview Monthly Sales Chart 1 2 Select Monthly Sales Chart Click Preview This displays the Monthly Sales Chart 92 Page 93 SALES INFORMATION July MONTHS Fig 15 16 Monthly Sales Chart Out Of Stock Product Report This report displays all Products that are out of stock It s a handy tool for p
41. NE OA E EAEAN KAEA ON E EANA RER a Allowance Deduction Detail 00 000sneeeneeeneneeeenneesresssseesrsssrsssrtraeiststtanttetetttsstt ttrt rer eee ESEAS EEE ee ene aate eneee eneee Creating a new Allowance Deduction Detail sssivisscssniisdssasisncdinsssilevasesoevcacdesovassaseanseeeasnedsansevdsiuesasduianadavievacsdancusauaaenalsedasesonsvaeso sntanabnes Editing an Allowance Dedaction Detail csecicasccsncicasecovvasceaashasescussasonsend nren inie ronie Aoa NENE EEEE ANTEE E R ii Deleting an Allowance Deduction Detail cccccccssccsecsscessesssecsecsssessessecsecessessessseceesesesssssaecessesuesssecaecesesaseeeecesceesesseecaeceeteagsesees Loan 9 B Cepen ee meee ne tere re ene ner en Rn ne nee ee ee ee oe eee eee eee cee ee nent err tSr cena eer ee are eer creer omae OEY E srreccusratvo ce A E E corsets selena ce vssaee cae ages doi oeuasanaciestst ale velanssse ance AE EE Editing a Loan PS A eateecgearanspcsc cn ca noe ctetsabepanccnqanetese se E EAEE E EI RE E E EEE Deleting a Loan Detall isiantisesnnessnpaiecsvatadnasisancxsvanves AENEA EA E EA EESE EERE OESE EAO EEE O R Pay OUT ANUS cares ccs gegen A E E E T E T TA teas ca E E Creanne a TON P YRO EIN eE EE TE EE T Peene a Pa ea a N EET E A EE E ATEEN mag 14a o gt Pay E T ETEN AET AO E E AET EEO Editing a PayRoll Detail beesies ana aN ee eee eee ee eee Delene a Pay ROWE AU aenn T E E AN T chon er T DEEE ONION ciann a aa arer niaaa Executing D lete Options en an
42. NERATOR Hd Fig 7 2 Expenses dialog Creating a new Expenses Order To create a new Expenses Order If an Expenses Order is selected click New on the dialog Toolbar to clear all entry fields else go to step 2 below 1 If you click New an Input Prompt message is displayed 59 Page 59 Page 60 E input Prompt 2 Do You Want To Create 4 New Expenses Record No Fig 7 3 Input Prompt Click Yes to clear or reset the fields for a new Expenses entry Important You must enter the Expenses ID which must be unique does not allow duplicates ia 8 Select Supplier if necessary Set Date if necessary Select Item from the Item dropdown list on the Details tab Click the Item button ellipsis to enter a new item and then select it Select Employee Click the Employee button ellipsis to enter new employee information and then select it Enter Cost While the cursor is on Cost press Enter on the keyboard Or right click on the tab surface to display a context menu and select Save Details as shown in Fig 7 4 below The details should appear on the Shopping Details spreadsheet EXPENSES i Expenses ID 2 New lt Anonymous gt 7 11 2014 2 GREAT 12 75 2012 1 lt Anonymous gt 1 771172014 Shopping Details 300 00 Delete A Details Save Expenses Breakfast Save Details Delete Details EPRE l Employee lAsiri Festus Delete Expenses F mm E
43. NEW EXPENSES OTOCI nisrani n EE EO Previewing an Expenses INVOICE ccssssscscccescsssssssanccceceecescesensesssueasecsecescesessueeaueseeseeceeses ensues aneseecaseceecsesesessueeaneaeeseeses sensananeneeeaeceees PinUng ESS INVOICE ndrin roc cipaeassteee E ap uate cnnes ue ung E anions ann EE tele memes E ueeanesseaGud bandera tanacontees Edine AN EDEN o OOS I tires cccacaccteusesannacecusesdectanassnes sande stacasetecayendsnnss serned onnacen saanearanseussensetaapand E E Deleting AN EXPENSES Order ee nena T E A Removing a SOI HIS DETAN ssrin a AE E E aA Page 5 36 37 37 38 38 39 39 39 40 40 41 41 42 42 42 42 42 42 42 43 44 44 45 45 46 46 47 49 49 90 50 51 ol Jo 53 93 95 56 56 o7 57 58 59 59 59 61 61 61 62 62 Contents Removing a Payment Detail seisine kina Saen ai EnA A ERAEN EANA OERE EE TO ONAR EN ONENEAN EN E Chapter 8 Local Purchase Orders LPO ates secs ceicec ciate case ctcarpuhsaidananecdatenteaatnncedonecn5adauaveetiinaamonaulustadiane E A Local Purchase Orders scccnicsaceasecececessenanschessseesssarntagonenesadnaseceensqueevaswvonsaesssuesienaseanneuseuoussa oauasssinuansbandeuaanstadesnsotasveneteapasoweimerenneneseesherdesl Creating a new Local Purchase order cccesscecessssccecssneseecessecescssseecessuecescnusuecescssseeceseauseecessaesescesaeesesscasaeeescauseseeseuaeesessaeseseaeaeeess Previewing a Local Purchase Order INVOICE arerinniaiacmiin
44. OCKE E E E E E E A T A E E Se E a EAE EEE A OE AEA E E E E A EEEE as A AEEA EEA AE TETE PT AE E T oe etre E AAEE TE A Bs E E EE E NS AE E A A EE E T A E E A T TE E TE Local PUCA SE Or n E T en eee eee ee eee eee POC ESUO oniani AE A EE E E E A E E E Chapter 10 Chapter 11 Chapter 12 Chapter 13 Chapter 14 Chapter 15 Appendix A Miscellaneous Routines cccccsccessssscecessseseecesssecescssseecessuecescusessessaesessesssesescauaeesessaesescesasasaeecesuueeessesaaeeessssaeseeseaeaeees FeV OM Messe ees ever a spre ces esac AE ctu E EEE E PSO ONS acca cactus ees sce ase E E cectad ean E E A FE Vd PONG a E cae n exe E A E saint E E O AA Pa A R COVEN aa E E E A T Password and Perissi ONE vecinccrs eras a E E E E Repor UNES aran E A E A E S aenmoutenamuanenoream Page 3 11 18 42 46 53 59 64 68 71 79 80 82 85 88 103 104 Contents Introduction eee Chapter 1 Installation Installing erko Installation eane installing CyberShop on a Local Machine seisan a a a choper 2 What e new in yD NO arinina aaaea erinan n ienai niniin Changing Cybershop background imagE iccccateeevscazacccsasexcvesesecavsaceesane a VEn N NENEN A NAE EEA importing Stock from external SOUrCES sssuciratiaeasonaionreinns anean aae a aea Caa EOE AN AARE Ra AEA OEA TEENAA TAREE EAEE aa Bank Account Management ccesscscsssessssseecsecescseseecesseecesseecesseecesssecessuecessuecessaeeessaeseseseseeeceseeecessuscesscossescen
45. Positions Product Group Names Ctrl F States Countries Exit Alt Bksp Fig 3 27 File Menu Select Positions This displays the Positions dialog as shown below in Fig 3 27 POSITIONS Fig 3 28 Positions dialog Creating a New Position To create a new Position 1 Click New on the dialog Toolbar to reset the entry field Delete g 1 of 4 Records disi ip amp Close Fig 3 29 Positions dialog The Save button is displayed as shown in Fig 3 29 Note the buttons that are disabled Clicking Save re enables them Enter Position This must be unique it does not allow duplicates Click Save on the dialog Toolbar to save the record Note that the New button is displayed as shown in Fig 3 28 If entries are made correctly the record is saved Note the report on the Application Explorer Status Editing an Existing Position To edit an existing Position 1 Navigate to the Position that you want to edit through the Navigation Bar For further information on this go to Appendix A 30 Page 31 1 of 5 Records aad gt Fig 3 30 Navigation Bar 2 Enter the necessary changes 3 Click Edit on the dialog Toolbar The EDIT ALERT message is displayed MS EDIT ALERT ie 4 Are You Sure That You Want To Apply Specified Changes Yes No Fig 3 31 Edit Alert 4 Click Yes to save or No to cancel saving the changes Note the report on the Application Explorer Status Deleting a Position To D
46. SCS 500 00 Fig 7 13 Payment Details Spreadsheet 2 Select an item on the Payment Details spreadsheet to highlight it 3 Press Del or Delete on the keyboard or right click the item to display a context menu and then select Delete Payment as shown in Fig 7 13 This displays a DELETE ALERT message as shown in Fig 7 14 EE DELETE ALERT Fig 7 14 Delete Alert Message 4 Click Yes to delete or No to cancel deleting the record Note the report on the Application Explorer Status 63 Page 64 Chapter 8 Local Purchase Order LPO Local Purchase Orders are orders that are placed for further supplies to restock items By default CyberShop allows you restock through the Reorder List However you can also access a list of all items in stock To process an LPO 1 Click the Accounts menu sa e Utilities Reports Window Helg Sales Orders Ctrl F1 Purchase Orders Local Purchase Order LPO Banks Bank Transactions Staff PayRoll Percent Names Expenses List Expenses Ctrl F4 Profit Evaluation Summaries Fig 8 0 Accounts Menu 2 Select Local Purchase Order LPO This displays LOCAL PURCHASE ORDER dialog LOCAL PURCHASE ORDER LPO ID GREAT 12 5 2012 2 New GREAT 12 5 2012 1 lt Anonymous gt 1 x 671672014 Re Order List_ Cimetidine inj 200mg 2ml Tagapine 0 0 00 04 9806 O All Items Cimetidine inj 200me apine 0 0 00 0
47. Scrolling Banner to display the Company Name on a scrolling banner at the status part of the Application Explorer 7 Check Set Expiry to make CyberShop to monitor the Expiry Date of all registered products 8 Enter a number greater than zero on Cost Price to set price mark up for Unit Cost Price on Purchases 9 Enter a number greater than zero on Selling Price to set price mark up for Selling Price Retail on Products 10 Enter State for the home state 11 Enter Country for the home country 12 Select Receipt to print sales invoices with the POS Receipt Printer as shown in Fig 3 2 19 OPTIONS Company Defaults Set Values Entity Display Settings Genel Dafa Department Acct Officer oO View Sales Summary By Product Grouping Set Expiry CJ Auto Print Invoice Display Scrolling Banner Sales Output Option fos Invoice SelingPice 0 si Fig 3 3 Options dialog Set Values tab with Invoice 13 Select Invoice to print sales invoices with the A4 size printer 14 Click OK to save changes and close the dialog 15 Click Apply if you still need to make additional changes on other tabs Generally clicking Apply saves changes without closing the dialog Entity To Customize Entity 1 Click the Utilities menu as shown in Fig 3 0 2 Select Options The Options dialog is displayed 3 Click the Entity tab Company Defaults Set Values Entity Display Settings Expiry Date Birth Days Allow Alert Allow Customer Alert Gener
48. TE E RERAN E EATE eds aestantmedeaneide EARE a elo C en e E E E A E E eer ences DEOS Ar ENE NINE maa E A T E I TOIT EE T EA ee ene S E T E E E Creatine a New Expenses NaMe senripare E E E ET OEE E E ECHEINS mE Den es NaN E erine A AEE E E EAE E E Deleting an Expenses Name ccccsssesessssscecesssecescesscecesesuseecessseseecesseeceseuseecessueseecesaeeseseuseecesnsauaeeceseaeaeecessueeescesaeeceseaeaeeessaeeseseaeaeess e aS a EEA E OAA EE O T A OETAN EA Electone TOC CKINE oaa N E E O AE E E E E NE E EEE T SVS 5 TE a EA E E E O RUES TO UPO nE e STOC O e a E E E S E E E Deleting all stock ITENS nriinisrnasiann a iaaa a r i UMS ELV SEO I GS aa A N E E S E A A Manual STOCKINE romeren ar a EE E EE E E A E ES Beea E a Le E E E E A T E E E A ee ee A A EE ee E E E A EdEME AA wey Ue ea fe 6 OCT ara E AA eae ee ee eee rere ee Bye Fei alg foe lg ge E eeaeeenneren neers Bene E ite crt rene let creer ener ne nei AT ttre te meee eterna eee EAA O eee ee ree eee ee eee eer Previewing the Stock list goss capes cca pe en nan es casa cece tg cs a eas oa ea ae we enema nde eesti Printinge the Stock DSt pcs oss sce ssc cn crest tem ceca E E choses ance me ected cen een VME 2 ANS aara E R a E tatieatoneteasunt ptsatoisstiees EAE Gnade estat oseae emeaseateroned aera cesenseceiec Sales Order S ara eo oe me en ee ee E fe an er ee ee ee Oe ee ee er een ee ee ene ee Creatine a NEW o Uer ONO sesar ienee E E E E E E EA ES Previewing a Sales INVOICE
49. Utilities Reports Window Help Sales Orders Ctrl F1 Purchase Orders Local Purchase Orders LPO Banks Bank Transactions Staff PayRoll Percent Names Expenses List Expenses Ctrl F4 Profit Evaluation Summaries Fig 3 51 Accounts Menu 2 Select Banks This displays the Banks dialog as shown below in Fig 3 52 OCEANIC BANK PLC Fig 3 52 Banks dialog Creating a New Bank To create a new Bank 1 Click New on the dialog Toolbar to reset the entry field Fig 3 53 Banks dialog Page 37 The Save button is displayed as shown in Fig 3 49 Note the buttons that are disabled Clicking Save re enables them 2 Enter Name This must be unique it does not allow duplicates 3 Click Save on the dialog Toolbar to save the record Note that the New button is displayed as shown in Fig 3 52 If entries are made correctly the record is saved Note the report on the Application Explorer Status Editing an Existing Bank To edit an existing Bank 1 Navigate to the Bank that you want to edit through the Navigation Bar For further information on this go to Appendix A 1 of 5 Records aad gt Fig 3 54 Navigation Bar 37 2 Enter the necessary changes 3 Click Edit on the dialog Toolbar The EDIT ALERT message is displayed EE EDIT ALERT 2 Are You Sure That You Want To Apply Specified Changes No Fig 3 55 Edit Alert 4 Click Yes to save or No
50. Want To Back Up Your Data Store To C ShopBackUp Shop15 07 2014_1 Yes No Fig 13 2 Backup Alert Message box 82 3 Click Yes to backup or No to cancel backup Note the Status report BACKUP DATA STORAGE e a FE T ip F Backup Path Gf v F ShopBackUp Shop15 07 2014_1 O Restore Initiating Data Backup Disconnecting data Data disconnected Creating necessary folders Folder Created Data Backup to F ShopBackUp Shop15 07 2014_ 1 Started Please wait Backup Completed Successfully Reconnecting Data Reconnection Completed Fig 13 3 Backup Data Store dialog To process Data Recovery 1 Click the Utilities menu and select Security Passwords Ctrl J Calculator Shift F 1 Backup Data Store Recover Data Store Delete Options Options Shift F9 Fig 13 4 Utilities Menu 2 Select Recover Data Store This displays the Restore Data Store dialog RES TORE DATA STORAGE Bt Fig 13 5 Restore Data Storage dialog 83 Page 83 Page 84 Restoring a Backup To restore a backup 1 Set Restore Path by clicking the search button 2 This allows you to search for the backup file Shops mdb from which you want to restore your data 2 Click Restore Note the Status report RESTORE DATA STORAGE Restore Status Initiating Data Restore Disconnecting data Data Disconnected Restoring CyberShop Data From F ShopBackUp Shop15 07
51. Wholesale outlets is spreading very fast For proper monitoring and active support every copy of CyberShop now comes with a 14 digit Life Activation Key This means that whatever source from which you acquired CyberShop CD or online download you must call for an Activation Key to activate your copy Note that if not activated CyberShop would run for about 65 days after which it must be activated Activating CyberShop To Activate CyberShop 1 Click the Help menu Cozar Cybershop Application Activation Stock Upload Format About Cozar Cybershop Fig 2 10 Help Menu Select Application Activation The Application Activation dialog is displayed APPLICATION ACTIVATION mw id Key Is Case Sensitive Fig 2 11 Application Activation Enter the 14 digit key correctly The key is case sensitive Click the Activate button when it becomes active The ACTIVATION SUCCESS ALERT message is displayed 16 Page 16 Page 17 ACTIVATION SUCCESS ALERT pom e ee eoa a e e Fig 2 12 Activation Success Alert To check if the Application is activated 1 Click the Help menu as shown in Fig 2 10 2 Select About CyberShop About CyberShop oon e ESN r ail support ozapp Fig 2 13 About CyberShop dialog 17 Page 18 Chapter 3 Getting Started with CyberShop It is assumed that you have installed one of the versions of CyberShop This book was actually designed for the Pro ed
52. a gt Fig 16 0 Record Navigation Bar ii Page Navigation Bar found on reports Pages Hla E ALi Fig 16 1 Page Navigation Bar Navigation Buttons M Navigate to the first record page Navigate to the previous record page Navigate to the Last record page d Navigate to the Next record page ld 103 Page 104 Index 104 Page 105 Contacts Tel 234 0 8033667378 234 0 8121710802 Email support cozappz com Updated 2 August 2014 105
53. al Period Data Store Backup Delai Dive Default Name Shop Use Date C Negative Stocks Fig 3 4 Options dialog Entity tab Set the values for the following Expiry Date i Check Allow Alert to display the Expiry Alert list at log in ii Enter Alert Period to set the number in days of the Expiry Alert iii Enter General Period to set the number in days of the Product Expiry Summary list 20 Page 20 Page 21 Birth Days i Check Allow Customer Alert to display the Birth Days Alert list at log in Data Store Backup i Enter Default Drive to set the default drive letter for data backup storage Be sure to confirm the default drive letter preferably a removable drive ii Enter Default Name to set the default name for the backup It can be any name iii Check Use Date to append the current date to the backup name 4 Check Negative Stocks to allow negative quantities in stock Generally items cannot be sold without quantities However if Negative Stocks is checked CyberShop allows you to sell items and automatically update the stocks later when the item purchases are entered 5 Click OK to save changes and close the dialog 6 Click Apply if you still need to make additional changes on other tabs Clicking Apply saves changes without closing the dialog Display Settings To Customize Display Settings 1 Click the Utilities menu as shown in Fig 3 0 2 Select Options The Options dialog is displayed OPTIONS Company Defaul
54. ales Orders Summary Report This is a preview of all Sales Orders Invoices displayed either on a monthly or yearly basis Previewing Sales Orders Summary Report To preview Sales Orders Summary Reports 1 Select Sales Orders Summary Reports Daily Monthly Weekly Yearly Fig 15 28 Date Parameter 2 Select parameter option Monthly or Yearly 3 Set From date Select a date for the month or year that you want to preview 4 Click Preview This displays Sales Orders Summary Report sunday July 20 2074 Sales Summary Report For July Date Ref Number Amount Paid Balance 7 13 2014 2 3 400 00 3 400 00 0 00 Total 3 400 00 7 17 2014 z 1 400 00 1 400 00 0 00 Total 1 400 00 Grand Total 4 800 00 Fig 15 29 Sales Summary Report Sales Summary By Staff Report One of the Tools in CyberShop with which you can determine the actual physical cash realised from your business transactions is the Sales Summary by Staff Report Another is the Cash Flow This report can be viewed on a monthly or periodic basis and totals are arranged by staff names Previewing Sales Summary by Staff Report To preview Sales Summary by Staff Reports 1 Select Sales Summary By Staff Report Daily O Monthly Weekly Yearly Specify Fig 15 30 Date Parameter 97 Page 98 2 Select parameter option Daily or Specify 3 Set From date Note that the Specify option in step 2 allows you to set a date range as shown in Fig 15
55. ar E Zoom f100 Print Fig 4 8 Report Toolbar 45 Page 45 Page 46 Chapter 5 Sales CyberShop offers very simple and user friendly processes with which you can carry out sales transactions These transactions generate Sales Invoices and Receipts after payments are entered Units of items sold are automatically removed from stock Active Stock That way CyberShop maintains an active status of the current stock of each item To process a Sales Order 1 Click Accounts menu Utilities Reports Window Help Sales Orders Ctrl F1 Purchase Orders Local Purchase Order LPO Banks Bank Transactions Staff PayRoll Percent Names Expenses List Expenses Ctrl F4 Profit Evaluation Summaries Fig 5 0 Accounts Menu 2 Select Sales Orders Or press Ctrl F1 or click Sales on the Application Toolbar CyberShop2 1 File view Accounts Utilities Reports Window Help gt 0 9j N Bw a Sales Customers Products Suppliers Purchases Expenses Summaries Calculator Fig 5 1 Application Toolbar This displays the SALES ORDERS dialog SALES ORDERS1 OBED 671372014 1 lt Anonymous gt 1 x 7777 2014 Shopping Details Sales Details Payment Details Unit Number Of Packs 0 R five Stock ieseiwed se E CO Issued Fig 5 2 Sales Orders dialog Important To attend to multiple Customers at the same time repeat step 2 as many times as shown
56. ay a context menu and select Delete Payment This displays a DELETE PROMPT message E DELETE PROMPT 2 j Sre You Sure That You Want To Delete The Selected Record Fig 5 19 Delete Prompt Click Yes to delete or No to cancel deleting the record You must remove all Payment Details in order to add or remove items from the Sales Order Note the report on the Application Explorer Status 52 Chapter 6 Purchase Just as Sales transactions remove items from stocks Active Stock Purchase transactions are used to add items to stocks Active or Reserved Stock as case may be and also to store purchase invoices To process a Purchase Order 1 2 Click the Accounts menu este Utilities Reports Window Help Sales Orders Ctrl F 1 Purchase Orders Local Purchase Order LPO Banks Bank Transactions Staff PayRoll Percent Names Expenses List Expenses Ctrl F4 Profit Evaluation Summaries Fig 6 0 Accounts Menu Select Purchase Orders Or click Purchases on the Application Toolbar to display the PURCHASE ORDERS dialog CyberShop2 1 File View Accounts Utilities Reports Window Help gt D H BI Sales invoice Customers Products Suppliers Purchases Expenses Summaries Fig 6 1 Application Toolbar Creating a New Purchase Order To create a new Purchase Order Calculator Page 53 1 Ifa Purchase Order or Invoice is selected click New on the dialog T
57. cates 3 Click Save on the dialog Toolbar to save the record Note that the New button is displayed as shown in Fig 3 47 If entries are made correctly the record is saved Note the report on the Application Explorer Status 35 Page 36 Editing an Existing Country To edit an existing Country 1 Navigate to the Country that you want to edit through the Navigation Bar For further information on this go to Appendix A 1 of 5 Records aad gt Fig 3 48 Navigation Bar 2 Enter the necessary changes 3 Click Edit on the dialog Toolbar The EDIT ALERT message is displayed EE EDIT ALERT se J Are You Sure That You Want To Apply Specified Changes No Fig 3 49 Edit Alert 4 Click Yes to save or No to cancel saving the changes Note the report on the Application Explorer Status Deleting a Country To Delete a Country 1 Navigate to the Country that you want to delete through the Navigation Bar as shown in fig 3 48 For further information on this go to Appendix A 2 Click Delete on the dialog Toolbar The DELETE ALERT message is displayed MS DELETE ALERT lt P Are You Sure That You Want To Delete This Record Fig 3 50 Delete Alert 3 Click Yes to delete or No to cancel deleting the record Note the report on the Application Explorer Status Banks The Banks dialog is used to store and manage the names of Banks in CyberShop To process a Bank 1 Click the Accounts menu 36 timate
58. e Images folder of the CyberShop directory or folder The CyberShop image directory or folder is on the path C Program Files CyberShop Images 4 Run the CyberShop application The application would display the new image Importing Stock from external sources To facilitate stock input CyberShop now provides a process by which product stocks can be imported by way of an external file This is also referred to as Electronic Stocking The processes involved in importing stocks into CyberShop includes the following i Creating a stock file ii Rules for updating the stock file iii Deleting All stocks iv Importing the stock file Creating a Stock File To create a Stock file 1 Goto the Docs folder of the CyberShop directory or folder You would find it on the path C Program Files CyberShop Docs 2 Locate an MS Excel file called Stock xls You would find an existing product stock 3 To enter your own stock i Modify the content of the file according to the file headings and content format or ii Delete or clear the file contents leaving the headings and then enter your stock according to the headings and content format 4 Save the file Rules for Updating the Stock File The rules for updating the stock file are as follows i The ltem_ID column must be UNIQUE This field does not allow duplicate IDs ii The ltem_Name column must be UNIQUE This field does not allow duplicate names iii No field must be left blank Enter zero 0 fora numeric
59. e That You Want To Delete This Record No Fig 3 20 Delete Alert Click Yes to delete or No to cancel deleting the record Note the report on the Application Explorer Status 27 Page 27 Page 28 Department Names The Department Names dialog is used to store the names of Employee Departments Examples include Sales Accounts Marketing and Personnel etc To process a Department Name 1 Click the File menu K CyberShop2 1 sie view Accounts Utilities Reports Customers Products Ctrl F2 Suppliers Ctrl F6 Employees Departments Positions Product Group Names Ctrl F7 States Countries Exit Alt Bksp Fig 3 21 File Menu 2 Select Departments This displays the Department Names dialog as shown below in Fig 3 22 DEPARTMENT NAMES Accounts Fig 3 22 Department Names dialog Creating a New Department Name To create a new Department Name 1 Click New on the dialog Toolbar to reset the field DEPARTMENT NAMES Fig 3 23 Department Names dialog The Save button is displayed as shown in Fig 3 23 Note the buttons that are disabled Clicking Save re enables them 2 Enter Name This must be unique it does not allow duplicates 3 Click Save on the dialog Toolbar to save the record 28 Page 29 Note that the New button is displayed as shown in Fig 3 22 If entries are made correctly the record is saved Note the report on the Application Explorer Stat
60. ecord Note that the New button is displayed as shown in Fig 3 34 If entries are made correctly the record is saved Note the report on the Application Explorer Status Editing an Existing Group Name To edit an existing Group Name Navigate to the Group Name that you want to edit through the Navigation Bar For further information on this go 1 to Appendix A 1 of 5 Records aa gt Fig 3 36 Navigation Bar Enter the necessary changes Click Edit on the dialog Toolbar The EDIT ALERT message is displayed EE EDIT ALERT k 7 Are You Sure That You Want To Apply Specified Changes Yes No Fig 3 37 Edit Alert Click Yes to save or No to cancel saving the changes Note the report on the Application Explorer Status 32 Deleting a Group Name To Delete a Group name Page 33 1 Navigate to the Group name that you want to delete through the Navigation Bar as shown in Fig 3 36 For further information on this go to Appendix A 2 Click Delete on the dialog Toolbar The DELETE ALERT message is displayed MS DELETE ALERT j amp re You Sure That You Want To Delete This Record No Fig 3 38 Delete Alert 3 Click Yes to delete or No to cancel deleting the record Note the report on the Application Explorer Status States The States dialog is used to store and manage the names of States in CyberShop To process a State 1 Click the File menu CyberShop2 1 a6 view Accounts Utilities Reports
61. elete a Position 1 Navigate to the Position that you want to delete through the Navigation Bar as shown in Fig 3 30 For further information on this go to Appendix A 2 Click Delete on the dialog Toolbar The DELETE ALERT message is displayed MS DELETE ALERT ai 7 Are You Sure That You Want To Delete This Record No Fig 3 32 Delete Alert 3 Click Yes to delete or No to cancel deleting the record Note the report on the Application Explorer Status Product Group Names The Group Names dialog is used to store the names of Product groupings or categories To process a Group Name 1 Click the File menu CyberShop2 1 a6 view Accounts Utilities Reports Customers Products Ctrl F2 Suppliers Ctrl F6 Employees Departments Positions Product Group Names Ctrl F States Countries Exit Alt Bksp Fig 3 33 File Menu 2 Select Product Group Names This displays the Group Names dialog as shown below in Fig 3 34 31 GROUP NAMES lt Others gt Fig 3 34 Group Names dialog Creating a New Group Name To create a new Group Name 1 Click New on the dialog Toolbar to reset the entry field GROUP NAMES Fig 3 35 Group Names dialog Page 32 The Save button is displayed as shown in Fig 3 35 Note the buttons that are disabled Clicking Save re enables them Enter Name This must be unique it does not allow duplicates Click Save on the dialog Toolbar to save the r
62. er 1 Select an order from the Expenses ID list and press Enter on the keyboard or Double Click on an order to display the order details To search for an order type the first few letters of the order until it becomes visible and then select it 2 Make the necessary changes 3 Ifthe cursor is on Cost press Enter on the keyboard Or right click on the tab surface to display a context menu and select Save Details as shown in Fig 7 4 The UPDATE PROMPT message is displayed 61 Page 62 E UPDATE PROMPT This Details Record Already Exists Are You Sure That You Want To Update It E 7 All Changes Shall Be Saved Fig 7 9 Update Prompt 4 Click Yes to save or No to cancel saving the Updates Note the report on the Application Explorer Status Deleting an Expenses Order To Delete an Expenses Order 1 3 Select an order from the Expenses ID list and press Enter on the keyboard or Double Click on an order to display the order details To search for an order type the first few letters of the order until it becomes visible and then select it Make sure that only the Expenses ID or number appears on the Expenses ID as shown in Fig 7 4 Click Delete on the dialog Toolbar or right click the Expenses dialog to display a context menu and then select Delete Expenses The DELETE PROMPT message is displayed E DELETE PROMPT re Sure That You Want To Delete This Record Deleting This Record Will Also Delete All Its Shoppi
63. er 180 00 200 00 60 108000 1 200 00 120 00 11 6 680 00 s2000 15000 m 800 00 Fig 15 5 Monthly Income Statements 5 Click the Print button on the report Toolbar to print the report E Zoom fox Print Fig 15 6 Report Toolbar Current Stock Report The Current Stock Report displays information about the current stock of each item and the totals i Total Items the total quantity of all items in stock ii Total Cost Value the total cost price of all items iii Total Sales Value the total selling price of all items iv Expected Profit and vV Records Total number of products as at the time of display 89 Page 90 Previewing Current Stock Report To preview Current Stock Report 1 Select Current Stock Report 2 Click Preview to display a preview of the report Product Stock Report As At Thursday July 17 2014 isi fosDeatove water S S E pemes 0 amor a ee c pa e S e o a SC S E S E m moema o y oo o f o S oo peoe fam 0 o pms o y o o o Total Items 39 Total Cost Value 10 520 00 Total Sales Value 16 600 00 Expected Profit 6 080 00 1793 record s Fig 15 7 Current Stock Report 3 Click the Print button on the report Toolbar to print the report as shown in Fig 15 6 Debtors List Managing a debtors list is one of the key functionalities of CyberShop Any named Customer that owes on an invoice gets his her name automatically registered on the debtors list on
64. er Information In CyberShop all Suppliers must be registered This is necessary to create and store Purchase Invoices and also to monitor and track Creditors and their accounts on the Creditors List To process a supplier 1 Click the File menu Cybe rShop2 1 aG view Accounts Utilities Reports Customers Products Ctrl F2 Suppliers Ctrl F6 Employees Departments Positions Product Group Names Ctrl F States Countries Exit Alt Bksp Fig 3 11 File Menu 2 Select Suppliers Or Click Suppliers on the Application Toolbar This displays the Customers dialog as shown below in Fig 3 12 SUPPLIERS Supplier ID lt Anonymous gt 2 20 2008 1 FRIDAY 6 16 2014 3 GREAT 671372014 2 Company Name Representative es ee 6 16 2014 i Contact Telephone ee Fig 3 12 Supplier dialog Creating a New Supplier To create a new Supplier 1 Ifa Supplier record is already selected then click New on the dialog Toolbar to reset the fields 2 Supplier ID is generated by the system therefore do not enter a value 3 Enter Company Name to set the Supplier s name This can be the name of an individual or organization 24 2 a Enter Representative especially if Company Name is an organization Enter the Address Select the State and Country Enter Contact Telephone and Email Click Save on the dialog Toolbar to save the record If entries are made correctly the record is saved Note
65. eseressreesreesseresroesseseeesseresesesseersesessenesroesseneseeestsreseseeeseoesesreseseneseeeno Recovering Data from an external storage media ccsssecesssecssssecesssecessceceseeccaeecesseecesseecesseecessuecessuecessuecessuecessaesessaeseseeeeseeeeees Chapter 14 Password and Permi SONS aimes a OEE Page 6 63 64 64 64 65 65 66 66 66 68 68 68 69 69 71 72 72 72 72 73 73 73 74 14 14 74 75 75 76 76 76 77 77 17 19 79 80 80 80 81 81 81 82 82 82 82 84 84 84 85 Contents User ae ici 0 2 an eee nen nee ee ee ee eee ee eee Creatine a User age S210 0 eee eet ee ee nn en ee eee eee on a eee ee eee Assigning Permissions toa USED si0cx cannsanecaennnsctveaniedeseagacwncnwbesieesssme EENEN NEEN O EAREN EIE EENE EN EE E EEE ENARA ENAS Editing a User PassWord ugesin ER E ER EE eee VETS OT B55 OG ensar A E A E choper oy ce NINO iaaiiai a aa rera aA aaa aai Previewing and Printing Summary Reports cccccseseceecssssecescesseecessseceecessuecseecessaesescesaeeceseaeseeesssaesescesusecescuaeecesuaesescesseeeeseaes PECON E A S a T E E E E E S C rrent Stock REDO asrniniansiiin aea aaa i i aina a Oi AEE niai DEDO SE E E E E A E E A E E E AEE E ee Cedar L aA EEE R E A ANEA EEE Product Summary by Group NAMES ccesssessecesessseceeceseseeeeceecesseeaeecescessueeensaeeseeececcseuneaeecesesssueeeeceseeeeueeeeceseeeeeecensesnaeaeeseeessgqeees sees POI r A
66. extrose water 0 0 00 04 0343 ma Save Details 23G Needles 0 0 00 Needle 23G 4 3 D saline 0 0 00 0337 5 Fluorouracil inj 0 0 00 04 7427 77keys to power 0 0 00 04 7501L Pome SSSC diR Reet OO Delete LPO Product List Quantity Cost Price_ Total Price _ 30 D ays Beauty Secret 10 Dextrose water 5 Fluorouracil inj 23G Needles Fig 8 2 LPO dialog To add more items repeat steps 4 through to 8 9 Click Invoice on Application Toolbar to preview the LPO Or Click Reports menu and select Invoice or press F6 button on the keyboard CYBERSHOP SALES OUTLET Ikeja 234 0 8033667378 234 0 08121710802 yourmail domain com LOCAL PURCHASE ORDER Name GREAT Order No 2 Address LAGOS Telephone Su Total EALS 30 Days Beauty Secret 550 00 2 750 00 OoOo 2 10 10 Dextrose water 800 00 8 000 00 r SY Le e 5 Fluorouracil inj 550 00 2 750 00 a Amount In Words Thirteen Thousand Five Hundred And Seventy Five Naira Only Be Healed amp Prosper in Jesus Name Amen Rom 3 7 Fig 8 3 Expenses Invoice 10 Click Print on the report Toolbar to print the Invoice E Zoom 100 Fig 8 4 Report Toolbar 65 Page 65 Page 66 Editing an Existing LPO To edit an existing LPO 1 Select an order from the LPO ID list and press Enter on the keyboard or Double Click on an order to display the order details To search for an order type the first few le
67. ge is displayed E DELETE PROMPT E J 4re You Sure That You Want To Delete The Selected Record Fig 10 5 Delete Prompt 3 Click Yes to delete or No to cancel deleting the record Creating Allowances and Deductions Allowances and Deductions are required for a detailed breakdown of an employee Salary To create Allowances and Deductions 1 Click Allow Ded Tab Allowances Deductions Details Name i Type Percentage Ski Accomodation Allowance 5 0 Loan Ded Deduction Save Percentages Percentage 2 0 Delete Percentages Fig 10 6 PayRoll dialog 2 Select Name Click the Name button ellipsis to add anew Name 73 Page 74 3 Select Type 4 Check Skip Skip is used to skip paying an Allowance or Deduction on the current employee payslip 5 Enter Percentage This is a percentage of the Basic Salary 6 While the cursor is on Percentage press Enter on the keyboard Or right click on the tab surface to display a context menu and select Save Percentages as shown in Fig 10 6 above The details should appear on the Allowances Deductions Details spreadsheet Editing Allowances and Deductions To edit Allowances and Deductions 1 Click on the item to highlight it on Allowances Deduction Detail spreadsheet This displays the details on the entry fields 2 Make the necessary changes 3 Ifthe cursor is on Percentage press Enter on the keyboard Otherwise right click the item row on the spreadsheet or
68. he Reports menu eee Window Help Product History Customer BirthDays Expiry Alert Expired Products Profit Margin Summaries Fig 12 0 Reports Menu 2 Select Expired Products This displays the Expired Products dialog EXPIRED PRODUCTS Batch Number _ Expiry Date 6 10 2014 21G Needles 8776555 1 9 2013 1 5 2013 6 10 2014 Abidec drop Fig 12 1 Expired Products dialog 3 Select All option to view all expired products and their details 4 Select Date option and set a date to view the expired products for the specified date 80 Deleting Expired Products To Delete Expired Products 1 Select an item on the spreadsheet 2 Press Del or Delete on the keyboard or click the Delete button The DELETE PROMPT message is displayed E DELETE PROMPT E 4re You Sure That You Want To Delete The Selected Record Fig 12 2 Delete Prompt 3 Click Yes to delete or No to cancel deleting the record 4 Todelete all the records click Delete all The DELETE ALERT message is displayed MS DELETE ALERT 2 Are You Sure That You Want To Delete All The Records No Fig 12 3 Delete Alert 5 Click Yes to delete or No to cancel deleting all the records Note the report on the Application Explorer Status Previewing Expired Products To Preview Expired Products click the Preview button as shown in Fig 12 1 ALL EXPIRED PRODUCTS Saturday August 02 2014 Name Batch No Expiny Date Quanti
69. iew This displays the Product Expiry Summary Report Product Expiry Summary Report As Sunday July 20 2014 ProductID Product Name Expiry Date No Of Days Status 30Days 30 Days Beauty Secret 7 25 2014 5 ABOUT TO EXPIRE 1980L T Keys to power 8120 2014 31 ABOUT TO EXPIRE Fig 15 18 Product Expiry Report Click the Print button on the report Toolbar to print the report as shown in Fig 15 6 Product Sales Rating CyberShop offers the facility by which product sales are rated based on the following i Frequency The number of times that each product is sold Frequency rating reports are displayed either by figures All products sold or graphically Column charts first seven products Quantity The number of units of each product sold Quantity rating reports are displayed either by figures All products sold or graphically Column charts first seven products Previewing Product Sales Rating To preview the Product Sales Rating 1 ae Select Product Sales Rating Daily Monthly Weekly Yearly Fig 15 19 Product Sales Rating Parameters Select the Rating Type Frequency or Quantity Check the chart box to preview the chart Select the Rating Period Daily Monthly etc Set From date For Monthly Rating Period select a date for the month that you want to preview Click Preview This displays the Product Sales Rating Report Product Sales Rating By Quantity For July 2014 Product ID Product Name
70. in Fig 5 3 46 Page 47 SALES ORDERS1 brder 10 lt Anonymous gt lt Anonymous gt OBED 771372 kAnonymous Shopping Details lt Anonymous gt 7 17 2014 3 lt Anonymous gt 7 13 2014 2 OBED 7 13 2014 1 item Name lt Anonymous gt 1 E 7 72872014 Shopping Details ItemName Selling Price_ Quantity Sub Total Une Selling Price Sales Details Payment Details Unit Number Of Packs o Ss a C e Fig 5 3 Multiple Sales Points Creating a New Sales Order To create a new Sales Order 1 Ifa Sales Order or Invoice is selected click New on the dialog Toolbar else go to step 2 below If you click New an Input Prompt message is displayed amp input Prompt N J Do You Want To Create 4 New Sales Order No Fig 5 4 Input Prompt Click Yes to clear or reset all the entry fields for a new Sales Order entry Important Order ID Invoice Number is system or auto generated so do not enter it 2 Select Customer if it s an order for a named customer Using Barcode Scanner 3 Be sure that the cursor is on ID on the Sales Details tab then scan the product This fetches the product details such as Product Name and Selling Price Using Product Name 4 Select a product from the Product list of the Sales Details tab This fetches the product details such as Product ID and Selling Price as well 5 Select Qty to enter the quantity units
71. information and they are the details that are displayed on invoices 4 Check Item Collection Date This is used in outlets where Customers are to pick up their Items at a later date where the user is made to specify a collection date 5 Set Days To Collect 18 Page 19 If you want the System to set the Collection Date automatically i e regular collection date you must set the Days To Collect in order to minimize error entries 6 Click OK to save changes and close the dialog 7 Click Apply if you still need to make additional changes on other tabs Clicking Apply saves changes without closing the dialog Set Values To Customize Set Values 1 Click the Utilities menu as shown in Fig 3 0 2 Select Options The Options dialog is displayed 3 Click the Set Values tab _ OPTIONS x DER Set Value General Defaut Accounts Acct Officer O View Sales Summary By Product Grouping Set Expiry C Auto Print Invoice J Di z Display Scrolling Banner Sales Output Option piap J invoice FSeingrice 7 Fig 3 2 Options dialog Set Values tab with Receipt 4 Check View Sales Summary By Product Grouping to view Income Statement summary by Group Names or categories These are your Company s information and these are the details that will displayed on your invoices that are printed for Customers 5 Check Auto Print Invoice to instantly send a Sales Invoice to a Printer as soon as Payment entries are saved 6 Check Display
72. invoice basis Multiple payments can be made on each invoice and CyberShop monitors the balances However as soon the final balance payment is made for a particular invoice that invoice is instantly de registered or taken out of the list Previewing Debtors List To preview debtors list 1 Select Debtors List 2 Select Name parameter Customers lt ALL gt Fig 15 8 Customer list The lt ALL gt item displays all debtors names by invoice numbers Selecting a particular name displays all debts owed by that debtor by invoice numbers 3 Click Preview This displays the debtor s list 90 4 Page 91 Customer Debtors Account Sunday July 20 2014 Invoice No Name Date Amount Credit Balance 1 OBED 201 4 07 20 3 400 00 2 000 00 1 400 00 Balance N 1 400 00 Total Balance N 1 400 00 1 record s Fig 15 9 Debtors List Click the Print button on the report Toolbar to print the report as shown in Fig 15 6 Creditors List Creditors List displays all debts owed to creditors Suppliers by invoice numbers This can track balances based on multiple payments Creditors List is based on credits on both Purchases and Expenses Previewing Creditors List To preview creditors list 1 2 Select Creditors List Specify parameter option Purchases or Expenses Purchase Orders Account Expenses Account Suppliers lt ALL gt i Fig 15 10 Creditors List Parameters
73. ition CyberShopPro but just about everything explained in this book applies to the Ent edition CyberShopEnt Some of the features of the Ent edition that are not supported by the Pro Edition concern item Location tools which will be discussed in the next edition of this book Customizing the Work Environment CyberShop work environment also called the Application Explorer describes the view of your screen after a successful login Customizing the Application Explorer involves configuring certain display and functional settings required for the operational convenience of the application depending on your choices These include setting for the Company Name Backup sales mark up prices etc Company Defaults To Customize Company Defaults 1 Click the Utilities menu Utilities Reports Window Help Security gt Calculator Shift F1 Options Shift F9 Fig 3 0 Utilities Menu 2 Select Options or press Shift F9 on the keyboard The Options dialog is displayed with the Company Defaults tab selected OPTIONS Compa Dolan Sa Vaes CYBERSHOP SALES OUTLET Address Ikeja 234 0 9033667378 234 0 081 21710802 mails otto Be Healed amp Prosper In Jesus Name Amen Rom 13 7 Receipt Title Information CYBERSHOP OUTLET Telephone s 234 0 8033667378 C Item Collection Date Fig 3 1 Options dialog Company Defaults tab 3 Enter Name Address Phones Emails and Moto These are your Company s
74. iy Cost Price _Abidescrop O O S o 8 S oo 468000 _ Oras __ ee ee Fig 12 4 Expired Products 81 Page 81 Page 82 Chapter 13 Backup and Recovery Data backup and recovery are an integral part of a business especially a computer based business outfit Stocks and accounts information need to be backed up and kept safely so on occasion of a system failure these information can be recovered or restored back to their original state for easy and proper running of the business That way business information is secured and within reach when needed Backups can done on the local drive C but preferably on a removable or external drive To process Data Backup 1 Click the Utilities menu and select Security Reports Window Help Security Passwords Cr Calculator Shift F1 Backup Data Store Recover Data Store Delete Options Options Shift F9 Fig 13 0 Utilities Menu 2 Select Backup Data Store This displays the Backup Data Store dialog BACKUP DATA STORAGE Backup Path Bc v C ShopBackUp Shop15 07 2014_1 Backup Restore Fig 13 1 Backup dialog Creating a Backup To create a backup 1 Set Backup Path by selecting a drive letter To create a backup on an external or removable drive attach the drive Note the letter assigned to the drive and select it 2 Click Backup The BACK UP ALERT message is displayed BACK UP ALERT J re You Sure That You
75. lacing orders for purchases on items that are out stock Previewing Out Of Stock Product Report To preview Out Of Stock Product Report 1 Select Out Of Stock Product Report 2 Click Preview This displays the Out Of Stock Product Report Out Of Stock Product Report As At Sunday July 20 2014 Number Product Name Quantity 04 9806 Cimetidine inj 200maq 2ml Tagapine 0 00 04 0343 10 Dextrose water 0 00 Needle 23G 236G Needles 0 00 0337 4 3 Disaline 0 00 04 7427 5 Fluorouracil inj 0 00 04 7501L keys to power 0 00 4196 A to ZED cap 0 00 1837 Abactal inj 0 00 04 1637 Abaktal peflacine inj 0 00 7788 ABF cream 0 00 04 2155 Abidec drop 0 00 1514 Abitren tab 100 0 00 5773 Aboniki balm 0 00 ACE SELENIUM 0 00 44 0704 Acepol Paracetamol susp 0 00 44 1186 ACER Levofloxacin 500mg 0 00 04 1934 Acetazolamide tab 250mg 0 00 04 9605 Acidom Omeprazole 0 00 44 0769 ACIXX FENNEL ANTACID 0 00 04 4762L ACNEAVVAY CREAM 0 00 1985 Actifed syrup 0 00 1954 Actifed tab 0 00 Fig 15 17 Out Of Stock Report 3 Click the Print button on the report Toolbar to print the report as shown in Fig 15 6 Product Expiry Summary Report This is a report of all Products that are expired This is actually operational for Sales Outlets that track Expiry Dates of items It basically offer some details Previewing Product Expiry Summary Report To preview Product Expiry Summary Report 1 Select Product Expiry Summary Report 93 3 Page 94 Click Prev
76. leting a State To Delete a State 1 Navigate to the State that you want to delete through the Navigation Bar as shown in fig 3 42 For further information on this go to Appendix A 2 Click Delete on the dialog Toolbar The DELETE ALERT message is displayed E DELETE ALERT e P Are You Sure That You Want To Delete This Record No Fig 3 44 Delete Alert 34 Page 35 3 Click Yes to delete or No to cancel deleting the record Note the report on the Application Explorer Status Countries The Countries dialog is used to store and manage the names of Countries in CyberShop To process a Country 1 Click the File menu CyberShop2 1 a6 view Accounts Utilities Reports Customers Products Ctrlt F2 Suppliers Ctrl F6 Employees Departments Positions Product Group Names Ctrl F States Countries Exit Alt Bksp Fig 3 45 File Menu 2 Select Countries This displays the Countries dialog as shown below in Fig 3 46 x Delete p 1 of 2 Records lt 7 J Close Fig 3 46 Countries dialog Creating a New Country To create a new Country 1 Click New on the dialog Toolbar to reset the entry field COUNTRIES z Save Edit x p 1 of 2 Records ula Close Fig 3 47 Countries dialog The Save button is displayed as shown in Fig 3 47 Note the buttons that are disabled Clicking Save re enables them 2 Enter Name This must be unique it does not allow dupli
77. licking Save re enables them Enter Name This must be unique it does not allow duplicates Click Save on the dialog Toolbar to save the record Note that the New button is displayed as shown in Fig 3 58 If entries are made correctly the record is saved Note the report on the Application Explorer Status Editing an Existing Percent Name To edit an existing Percent Name Navigate to the Percent Name that you want to edit through the Navigation Bar For further information on this 1 4 go to Appendix A 1 of 5 Records aad gt Fig 3 60 Navigation Bar Enter the necessary changes Click Edit on the dialog Toolbar The EDIT ALERT message box is displayed EE FDIT ALERT 2 Are You Sure That You Want To Apply Specified Changes No Fig 3 61 Edit Alert Click Yes to save or No to cancel saving the changes Note the report on the Application Explorer Status 39 Page 40 Deleting a Percent Name To Delete a Percent name 1 Navigate to the Percent name that you want to delete through the Navigation Bar as shown in fig 3 61 2 Click Delete on the dialog Toolbar The DELETE ALERT message is displayed EE DELETE ALERT j amp re You Sure That You Want To Delete This Record Yes No Fig 3 62 Delete Alert 3 Click Yes to delete or No to cancel deleting the record Note the report on the Application Explorer Status Expenses List The Expenses List dialog is used to store and manage a list of e
78. ment 1 4 Click on the department to highlight it on Department Details spreadsheet This displays the details on the entry fields as shown in Fig 10 2 above Make the necessary changes If the cursor is on Basic Salary press Enter on the keyboard Otherwise right click the department row on the spreadsheet or the tab surface to display a context menu and select Save Department as shown in Fig 10 2 The UPDATE ALERT message is displayed EE UPDATE ALERT 2 This Record Already Exists Are You Sure That You Want To Save Changes No Fig 10 3 Update Alert Click Yes to save or No to cancel saving the Updates 72 Page 73 Note the report on the Application Explorer Status Deleting a Department To Delete a Department 1 Click on the department to highlight it on Department Details spreadsheet This displays the details on the entry fields as shown in Fig 10 2 2 Press Del or Delete on the keyboard or click the Delete dropdown on the dialog Toolbar and select Delete Department Or right click the department row on the spreadsheet or the tab surface to display a context menu and select Delete Department as shown in Fig 10 2 If there are payroll entries for the Department the following message is displayed cancelling the Delete operation ERROR ALERT PayRoll Records Exist For Accounts Department nd Therefore Cannot Be Deleted Delete Operation Aborted Fig 10 4 Error Alert Otherwise the DELETE PROMPT messa
79. n n AAN N Printing a Local Purchase Order INVOICE cscscceesssssecessseseecesesecescesseecesssecescessuecescessuecescauaeecesesecesecessaecessausasecescuaeeseseaeaesessaeesessseaees Edine Local PUC E OTOCI garnar N E ET E EE ee Deleting a Local Purchase Order sorsun ONARE A eee en ne eee ene RN Removing a Detail ariin aii E R a ETETE AAi Ca E POE E N EE E E E EE cesseasnaiiaciee uiaeetaaeaans Pront Evaluation scnoraerniseinna eeii EEEE EEEE ENEE EATE AO EEEE NEONET R Creating a New Profit Evaluation 0 0 ccccsccsssecesssecesssecesssecescsesescossescossescssescesaeeceaasaecessaecessaeceseaeeescaeses causes causes cusescesaescesaeecesaescesaeess Edine I OE Evaa OiT irinenn E E Deletune a Pront Evaluadores ano E a R OE EE EEA AE E ESN Saem a 6 i csc E E EEE EE INSE EREE AA A E E E E E EA E EE N EN AA A E SPRO E E E E eee ee ee ENE Department Details jac cccssscsscissnvicdnvnedstagcisedcamu cen ciavanzuniarserksswsneteiepeaevapeneayoninntaccanensamsentandeoncise ce srttsestn esesta tanta tsore ese aren lasers Creating a New Department Detail wiseccssciedcsvascscexaseddveescunsvesvondeasussutcedessncovneshebsecxnsedenacueayacensdesancdedee secvsbnanoandvanavssieebleedestuaenanricestevteens Editing a Department Detail ccccaccocisurencnssseserenctasasaietdeleetcnanecsunsavecdverecereantysoaispsegeceaadpecapenenceanteeadiouvenneeseacsaveansesasosoiunssaundeinnsespeibstsangvouertezs Deleting a Department Detall sererai ieena na aia an EAR EAE EE
80. nates sonic atime cxcseeenesb ants evennpuedonsancndeasn ante ots stuts testot estesse raoses etessen estuen see rsrnes terese srneoeee Creating a NEW EMPlOVe ccscsccssssseecesssecescssseecessuseecessaesescesaseceseseseecessaeeescesaeesesceuaeesessseaseeceseauaeeseseaeseecesaseaaeecescesaeeeeseaeaeesesaaeeees FANE AN UMD SC T ects arain ca gneiss acu E E E share anteatenues E E DELINEA EEDI EE a a E et srt ee E em eevee ent E ne ne ene eee ee eee eee Cee A cee ener DEPI UNED oasis rece crecch ee sate nec octet EE E eee va alesse nave ascents pee are natssan scree saan dene ave ER E A AOE eae oee eE NW Bia eye lagi g eereerre tee ttrrerer se errr er sre ar ict Ne ne renee tetera toa a eee te ee ener eee eee ee ee ere Tener Faune a DEDINE arraie nena eee enc een one no nee re eer ae ee E eee eee eee eee TVS eh Dena NEN eserves tesa eccecesntc a A E E A POIO eaa ie evan bese eee E E E EA E E EEE E A EAE E OTE EN eE ANEN PO I e E E E cbues G eakanytemeee eco esnnemeeta eam EONO el FOS ICU e a E ETE E E A E T E O E NA Deleting a POSITION carci cecceanosserescessczanesweoeesanee E a aar aiio i a Product Group Names Categories sicsseiciisccscavsrusicssassavanadcuawnncictecaseins caipievoosadisuenaiieas aa snstaustosenacaussesoueteasandl oesacsuangnswvasctaneeiasocenanneaveeeedanniedan Creatine a new Group Nanie cccscnmanevceccstsatancetcnccumntapeansasysecsheapenweneusaagieerssmepeasengeinncanscdorenquisnncnad E EO ANEN Editing a Group Narine me
81. ne eee aiian AE EE R T ee eee T ye ea E a E a A A N O Displaying All Expired Products Displaying Expired Products for a Specific Date siccccariessascecnsnessuanaciascearayaanedetssvessesaaluicesonusvedecioesnievsebesiodabepaunsvshe wsanadseundasaaweainenmentsais Deleting Expired ProdUCtS es pecgaesctaeenetesead qaguanssouucessancacemmteavey NaNe EENAA rE EES AINNE EE ENO aE ETRETANT Previewing Expired Product cccsscscesssscecesssecescssseecessseseecessaeseecessuecescouaeeceseaeseesceseasaeecessaesescesaeeseseaesescessaesescauaeecessausesessaeesesesnanes PENCE Ez MOTT CP eC gece pctowe racers centre E on shes cay eee E at sane saecs an otauoest satiees sonics A seas pan eect cscs E E E N esses Chapter 13 Backup And Recovery essesssessesesrseesesersseoessereseoessoeesrorssoetssseststeseeeststestttststotsstt stststtttst sontet ote ses csore seese tesstesesoeesrorsseseseeeee Creatine a Data DACKUD senunni a TR T O Backing Up Data to th LOCal Syster sisri a aaa Ea AAN RAE NEEE A a RTAS Backing up Data to an external storage media sesssssensesesesrsessseesesessreressesesesesseeressestsrrenseeeseoesseeesroesseessroesseneseeesesrenssentsreesseeesre Restoring Data from Backup senesnessessenesseeeseressressesessrersesesesrrseesresesrsseressestsrreosesttessrs esteen srttst oes stetsr oes stetseoes senesnes est eessretseees senesne Recovering Data from a local Backup ssesssessesssssenessesesssesseeesesess
82. ng Details And Payment Details Do You Want To Continue No Fig 7 10 Delete Prompt Click Yes to delete the Order and all its details and payments or No to cancel deleting the Order Note the report on the Application Explorer Status Removing Items from Shopping Details To remove an item from Shopping Details 1 Select an item on the Shopping Details spreadsheet to highlight it Shopping Details 6 5K YA COZILY GENERATOR Asiri Festus 200 00 Camry car eee 300 00 Save Expenses Save Details Delete Expenses b Delete Details Details Camry car Asiri Festus 0001 Fig 7 11 Shopping Details Spreadsheet 2 Press Del or Delete on the keyboard or right click the item to display a context menu and select Delete Details as shown in 6 11 This displays a DELETE ALERT message 62 Page 63 EE DELETE ALERT Fig 7 12 Delete Alert 3 Click Yes to delete or No to cancel deleting the record You must remove all Payment Details on the Order in order remove items from Shopping Details Note the report on the Application Explorer Status Removing Items from Payment Details To remove an item from Payment Details 1 Click the Payment Details tab to select it Payment Details Date Mode Of Payment Credit Debit__ Balance _ 7 11 2014 aeea 500 00 0 00 Save Expenses Save Payment Delete Expenses Delete Payment Payments 771172014 z Mode Of Payment Cash w s
83. nsaction To create a new transaction 1 Ifa transaction is selected Click New on the dialog Toolbar This would reset the entry fields 2 Select Bank Lodgements Credit to make bank lodgements Credit Payments Debit to make payments cheque cash etc 3 Set Date if necessary 4 Select Company Name Your Company Name is displayed when making bank lodgements 5 Select Mode Of Payment 6 Enter the Number for the mode of payment selected in step 4 if necessary Note CASH doesn t require a number 7 Select Bank Name 13 Page 14 If the bank name does not exist Click the Bank Name button ellipsis to display the Bank Names dialog Enter the new bank name and save it Click Close to close the dialog Click the Bank Name dropdown Select the name you just entered 8 Enter Amount 9 Click Save on the dialog Toolbar The transaction appears on the spreadsheet Note the report on the Application Explorer Status Editing a Transaction To edit an existing transaction 1 Click on the transaction on the spreadsheet to select it This highlights the transaction and displays its details on the entry fields Date Company Name Mode Of Payment Bank Name All 173 2011 Godslight CHEQUE OCEANIC 12 4 2012 ADE CHEQUE FIRST BA Bank Lodgements Credit 6 27 2014 CYBERSHOPS TELLER FIRST BA Credit Paymenis Debit Print Option None C Use Date C Use Bank Preview Total Credit 1 038
84. o edit an existing Customer 1 Select a customer name from the Customer ID list and press Enter on the keyboard or Double Click on a customer name to display the customer s detail Make sure that only the Customer s number appears on the Customer ID as shown in Fig 3 8 CUSTOMERS 2 lt Anonymous gt 1 OBED 2 OBED OED eS a Manso o o oo fenv24 S a Lagos Nigeria 7 Fig 3 8 Customers dialog 2 Make or enter the necessary changes 3 Click Save on the dialog Toolbar The UPDATE PROMPT message is displayed UPDATE PROMPT This Record Already Exists Are You Sure That You Want To Update It x7 All Specified Changes Would Be Saved No Fig 3 9 Update Prompt 4 Click Yes to save or No to cancel saving the changes Note the report on the Application Explorer Status Deleting a Customer To Delete a Customer record 1 Select a customer name from the Customer ID list and press Enter on the keyboard or Double Click on a customer name to display the customer s detail Make sure that only the Customer s number appears on the Customer ID as shown above in Fig 3 8 2 Click Delete on the dialog Toolbar The DELETE PROMPT message is displayed 23 Page 24 EE DELETE PROMPT Mle Are You Sure That You Want To Delete The Selected Record Fig 3 10 Delete Prompt 3 Click Yes to delete or No to cancel deleting the record Note the report on the Application Explorer Status Suppli
85. o your local drive Note Depending on the configuration of your current system you may receive a Version Conflict message asking you to keep your existing files If this happens click Yes and continue with the installation A file being copied is older than the file currently on your system It is recommended that you keep your existing file File name C Program Files x86 CyberShop Stock xls Description Your version Do you want to keep this file No to All Fig 1 0 Version Conflict 6 On completion you will receive the success message as shown below Page 10 CyberShopPro Setup was completed successfully Fig 1 1 Success Message 10 Page 11 Chapter 2 What is new in CyberShop The use of CyberShop in sales outlets for Effective and Efficient Information Inventory Sales Accounts Security etc management has been very well established in users CyberShop now offers new features and enhancements This chapter introduces these features and enhancements Changing the Background Image Picture of CyberShop To leverage the use of CyberShop in various Sales environments CyberShop now offers users the opportunity to change the background picture of the application to properly reflect their products To change the background picture 1 Geta background image or picture in JPEG jog format 2 Name the image backgroundimage The name would then be backgroundimage jpg 3 Save the image to th
86. oolbar to clear all fields else go to step 2 below PURCHASE ORDERS Order ID GREAT 671372014 0056654 lt Anonymous gt 1 zj 7797 2014 Z Shopping Details Products Expiry Date Cost Price Quantity Delete t aa e 77972015 S o Apply Current Prices To Stock Fig 6 2 Purchase Orders dialog 53 Page 54 If you click New an Input Prompt message is displayed E input Prompt J Do You Want To Create A New Purchase Order No Fig 6 3 Input Prompt Click Yes to clear or reset all entry fields for a new Purchase Order entry Important You must enter the Order ID which is the Invoice Number on your Purchase Invoice Select Supplier Set Date if necessary Select Product Enter Batch Number Set Expiry Date which is set to the date a year from the current system date Enter Quantity Enter Total Quantity Price Notice that this displays the Unit Cost Price which you may choose to keep or modify Enter Unit Cost Price if necessary 10 Enter Unit Selling Price 11 Uncheck Apply Current Prices To Stock if you do not want the new prices to be used to overwrite the old stock prices in Active Stock 12 If the cursor is on Unit Selling Price press Enter on the keyboard Or right click on the tab surface to display a context menu and select Save Details as shown in Fig 6 9 below The details should appear on the Shopping Details spreadsheet as shown in Fig 6 4 below 2S ee so
87. or Reserve Stock If there are available stocks in reserve it moves them to the Active Stock and continues selling from there without displaying the alert Note This stock movement is done internally and in batches For example if Active Stock for Item A is 2 and Reserve Stock is 15 and you want to sell 4 units of this item you must sell the 2 Active Stock first then proceed to sell the additional 2 In an attempt to make further sales CyberShop will move the 15 Reserve Stock to Active Stock and continue selling from there To view Active Stock and Reserve Stock 1 Click Sales on the Application Toolbar CyberShop2 1 File view Accounts Utilities Reports Window Help 9 W m w A Sales Customers Products Suppliers Purchases Expenses Summaries Calculator Fig 2 8 Application Toolbar 15 2 This display the SALES ORDERS dialog as shown in Fig 2 9 Select a product from Products dropdown Note the Active Stocks and Reserved Stocks values SALES ORDERS1 i N lt Anonymous gt 7 17 2014 3 lt Anonymous gt 7 13 2014 2 OBED 7 13 2014 1 ew m lt Anonymous gt 1 x 7 72472014 7 Shopping Details Save Sales Details Payment Details Unit v Number Of Packs o ID Product Quantity 7 Keys to power X es 0 00 z Selling Price 200 00 k Reserved Stock CO Issued Fig 2 9 Sales Orders dialog Application Activation CyberShop has become a brand name Its use in Retail and
88. orts Customers Products Ctrl F2 Suppliers Ctrl F6 Employees Departments Positions Product Group Names Ctrl F States Countries Exit Alt Bksp Fig 4 0 File Menu Select Products Page 42 Or press Ctrl F2 on the keyboard or click Products on the Application Toolbar to display the PRODUCTS STOCK dialog as shown in Fig 4 2 CyberShop2 1 File View Accounts Utilities Reports Window Help v 8 8 Sales Customers Products Suppliers Fig 4 1 Application Toolbar ag Purchases Expenses Summaries Calculator 42 Page 43 PRODUCTS S TOCK Cimetidine inj 200mg 2ml Tagapine 04 9806 a 10 Dextrose water 04 0343 21G Needles Needles 21G 23G Needles Needle 23G 30 Days Beauty Secret 30Days he g Woes SSS Batch Number o 671672014 Use Expiry Discontinued J Fig 4 2 Products Stock dialog Creating a new Product To create a new Product 1 Ifa product is selected click New on the dialog Toolbar otherwise go to step 2 below If you click New the Input Prompt message is displayed E input Prompt 7 Do You Want To Register 4 New Product Yes No Fig 4 3 Input Prompt Click Yes to register a new product 2 Enter the Product ID The Product ID is a unique number used to identify each product It can be a Barcode NAFDAC number or any series of uniquely generated numbers It can also be alohanumeric Please avoid the use of s
89. p locally from your product distribution media Installation Requirements Minimum Installation Requirements Windows XP SP3 Operating Systems Windows 2003 Server Windows 7 Computer Processor 133MHz or Higher Pentium CPU Memory At least 512 megabytes MB 1 gigabyte GB is recommended 4 GB maximum Disk Space 1 gigabyte CD ROM or DVD Drive Table 1 0 Installation requirements Installing CyberShop on a Local Machine If you are installing CyberShop on a computer running any of the supported operating systems see Minimum installation requirements above you must have Administrator privileges The installation process creates registry entries and may update some system files that require Administrator rights Close all currently running programs before installing CyberShop Go to the Installation CD to install Windows XP Service Pack 3 SP3 if it is necessary To Install CyberShop on a Local Machine 1 Unless Autoplay is enabled for your CD ROM drive run setup exe from the CyberShopPro or CyberShopHome Installer directory of your product distribution depending on your choice 2 Click Ok 3 Click Change Directory if you want to install CyberShop to a directory different from the default location The default directory is C Program Files CyberShop or C Program Files x86 CyberShop for 64 bit systems 4 Click the installation button The Start Installation dialog box appears 5 Click Continue to begin copying files t
90. pe Cheaue 4mount To Pay 800 00 1 000 00 Fig 6 14 Payment Details Spreadsheet 3 Press Del or Delete on the keyboard or right click the item to display a context menu as shown above in Fig 6 14 and select Delete Payment This displays a DELETE PROMPT message as shown in Fig 6 15 E DELETE PROMPT j amp re You Sure That You Want To Delete The Selected Record Fig 6 15 Delete Prompt 4 Click Yes to delete or No to cancel deleting the record Note the report on the Application Explorer Status 58 Chapter 7 Expenses Expenses are made on a daily basis CyberShop offers utilities with which you can enter and manage all your expenses To process an Expenses Order 1 Click the Accounts menu Treeline Utilities Reports Window Help Sales Orders Ctrl F1 Purchase Orders Local Purchase Order LPO Banks Bank Transactions Staff PayRoll Percent Names Expenses List Expenses Ctrl F4 Profit Evaluation Summaries Fig 7 0 Accounts Menu Select Expenses Or click Expenses on the Application Toolbar to display the EXPENSES dialog CyberShop2 1 File View Accounts Utilities Reports Window Help ay D tH A Sales Invoice Customers Products Suppliers Purchases Expenses Summaries Calculator Fig 7 1 Application Toolbar i 127572012 1 lt Anonymous gt 1 Hd 6716 2014 gt Payment Details EXPENSES Payments 6 5KVA COZILY GE
91. pecial characters such as these etc 3 Enter the Product Name The Product Name must be unique and should not be too long especially if you are using the POS printer The Product Name is important for Product Tracking in terms of which Customer bought an item and which Supplier supplied the item 4 Select a Group Name Group Names are used to categorize the products E g Antibiotics Antacids Analgesics etc 5 Enter Batch Number The Batch Number is very important for Product Tracking in terms of which Customer bought an item and which Supplier supplied the item 6 Set Expiry Date It s very important to set the Expiry Date accurately for stocks that could expire That way CyberShop is able to track and promptly alert users of the expiry dates of their stocks 7 Enter the Unit of Measurement This is optional 8 Enter Selling Price and Cost Price These are important entries for CyberShop to display the marginal Profit in the Income Statement Summary reports 9 Enter Quantity by the smallest unit of sales Click the Quantity button ellipsis to reset the quantities of all products in stock to zero This may be necessary when recounting Stocks which is generally done at regular intervals 10 Select Sales Type 43 Page 44 The default Sales Type is Unit Select Pack for stocks that are sold both in units and packs 11 Enter Quantity Per Pack if Sales Type selected in step 10 is Pack 12 Enter Reorder Level The Reo
92. r the necessary changes 3 Click Edit on the dialog Toolbar The EDIT ALERT message is displayed EE EDIT ALERT E A Are You Sure That You Want To Apply Specified Changes No Fig 14 5 Edit Alert 4 Click Yes to save or No to cancel saving the changes Note the report on the Application Explorer Status Deleting a User To Delete a User 1 Ifthe User is not displayed navigate to it through the Navigation Bar As shown in fig 14 2 2 Click Delete on the dialog Toolbar The following message is displayed Sure you want to Delete this Record With All Its lt 7 Permit Information Fig 14 6 Delete Alert 3 Click Yes to delete or No to cancel deleting the user Note the report on the Application Explorer Status Note The Administrator s permissions are fixed and cannot be modified or deleted 8 Page 87 Page 88 Chapter 15 Summaries and Reports CyberShop offers utilities that present business information in the form of Summaries and Reports for qualitative and quantitative analysis of your business With these you can determine the financial worth of you business track products monitor sales and expenses make projections etc To process Summaries 1 Click Reports menu Reports Invoice Profit Margin Product History Customer BirthDays Expiry Alert Expired Products Print Chart summaries Fig 15 0 Reports menu 2 Select Summaries Or click Summaries on the Application Toolbar
93. r to save the record If entries are made correctly the record is saved Note the report on the Application Explorer Status Editing an Existing Employee To edit an existing Employee Select an Employee name from the Employee ID list and press Enter on the keyboard or Double Click on an 1 Employee name to display the Employee s detail Make sure that only the Employee s number appears on the Employee ID as shown in Fig 3 18 EMPLOYEES i Employee ID 0001 New E Asin 0001 IM 8 722 1990 Lagos a Nigerian l esl Date Emploved 11 30 2012 Erone 00090458787 0000000 Fig 3 18 Employee dialog Make or enter the necessary changes Click Save on the dialog Toolbar The UPDATE PROMPT message box is displayed EE UPDATE ALERT Pd This Record Already Exists Sure You Want To Update It nad You May Loose Some Important Information Yes No Fig 3 19 Update Alert Click Yes to save or No to cancel saving the changes Note the report on the Application Explorer Status Deleting an Employee To Delete an Employee record Select an Employee name from the Employee ID list and press Enter on the keyboard or Double Click on an 1 2 3 Employee name to display the Employee s detail Make sure that only the Employee s number appears on the Employee ID as shown above in Fig 3 18 Click Delete on the dialog Toolbar The DELETE ALERT message is displayed EE DELETE ALERT k J Are You Sur
94. rder Level is used to determine the Quantity the stock gets to for a Reorder Alert to be displayed to the user 13 Check or uncheck User Expiry to determine whether CyberShop should look up the expiry date of the product or not 14 Check Discontinued for a product that is no longer available for sale That way the Product is not available on Sales Orders and Purchase Orders 15 Click Save on the dialog Toolbar to save the record If all entries are made correctly the record is saved and its name appears in the Product ID list Note the report on the Application Explorer Status Editing an Existing Product To edit an existing Product i 4 Select an Item from the Product ID list and press Enter on the keyboard or Double Click on an Item to display the product details To search for an Item type the first few letters of the Item until it becomes visible and then select it Make sure that only the Product Number appears on the Product ID as shown in Fig 4 4 PRODUCTS S TOCK 19801 4 3 D saline 0337 5 Fluorouracil inj 04 7427 7 keys to power 04 7501L 7 Keys to power 1980L A to ZED cap 4196 v 7 Keys to power O Batch Number 1930909 Expiry Date 87 972016 z Ruani 80 M Use Expiry Discontinued J Figure 4 4 Product Stock dialog Make or enter the necessary changes Click Save on the dialog Toolbar The UPDATE ALERT message is displayed MS UPDATE ALERT 2 re You Sure That
95. record 78 Chapter 11 Delete Options Page 79 After using CyberShop for some time you may need to do a cleanup in order for the application to operate optimally or more efficiently To do this you need to run the Delete Options commands To process a Delete Options 1 2 Click the Utilities menu Utilities Reports Window Help Security Calculator Shift F 1 Delete Options Options Shift F9 Fig 11 0 Utilities Menu Select Delete Options This displays the Delete Options dialog DELETE OPTIONS Select Area s To Delete O Sales Orders C Purchase Orders C Expenses Orders specify Date Period 6 17 2014 6 17 2014 Fig 11 2 Delete Options dialog Check any or all of the Select Area s To Delete options Set the Start Date and End Date Click OK Note the success report 79 Chapter 12 Expired Products Page 80 CyberShop offers very effective tools to manage sales outlets especially outlets that have items that a capable of expiring One of those tools includes Expired Products by which CyberShop i Runs through your stock and pulls out all expired items ii Collates them iii Values and displays them Note that CyberShop would not sell any item that is expired Important It s advisable to run this utility at certain intervals to take out all expired items in your stock To process Expired Products 1 Click t
96. sescesaesesseeeeeseaeeesesesessaees invoice Management Permis SiOI crsssacossamacticoudaessnesnvasisdive donne da eerestqueswaansueaisan O NETE NEE NE E NEEE Purchases Processing Application Activation Chapter 3 Getting Started with Gbera P EEEE PE ag E aa E AAEE PE AA AA A AE PAE AE AN EE S AET T E Customizing the work environment ccccesscccssssecessssseecessesescesseeceseeseecessaesescessaesescesaeeces cess ceuaeeeseecssueseseseaeecssaesaeeeeseaeaeeeesaas COMP DSCNS a E ET E E EET E nia ae eaneee tess SN E E A A T E E AA E E E A EEEE T T T OA O DYES 6 NES ag e A EE ISA EE AA E ET E E E A EA A A ET EET N Customer Information so cpecreosacecisevectivavessessencnanooncece uarcontgnsencacescnaceunanetaceanouspaseues suatasuesatasasensacuanctasneni dren useeneienenseunnetsanasiceasontorsaniniaeenoetent SV eS CIS ascertain aoe ce ers va ease E E A ym nec cae emnp ene E ateiana pana es aeaetiovaeaae acs EdE A 91 2 ay gener nM me Oe PR ne rm ere vee ee eee ee Cee Pee ere eee eee aero DELENE UBS OC gcc crag eases AEA A E oss ve ng OEA E ee envoy gn vse cinco A neste nance ean T AN Supplier Informatio aise 5 escapes cs ns chsh ceca ca ncaa cect vate ce ec A sa lec vicina stints Fae sate eee ea ronne eS SUNS eter a A ce crphen n T sens omen csve Peaster eee acetates aceon sees Edinge a SC OM sianie a Ea aiaiai DeUe T NO T a E E E E E E EEEE A E AA A ee Employee Information sat ca bcnsa ssecerece Sep ecrtc eesteos sateec sanicapeee
97. ssies ni AA E EATEN A AAEE Dole NV a sO UHI INT UN oa T cat N E E T E senssae ns aeeniens ESE E e E ent A E A E AI E A EE ee E E A E EE E A A E E E OS LN VW a es cease ceases nace cea dearacaracesenucisaonnensendenenevonnasy seme en neconereotuneaneses an eee nae nate eeeeece amen ere Sekala ae EEIE ner ree E E E ee E eer ne eee E ee ee ee ee ee eee ee ee DAE Dea a iren AT EE A AOA E gous A EE AEA A A COUNTE a E E E EA E E E E T E E Ceatec anew COUNIENY scnsiusccecedsnconsseascacnanevtessansaaunenndecesmmeacan ea peaesuesannuswsvagadsd sananeaaiensheed sanatansadanetananedusesasdnanags oanduse aqiasuigaandedereniastaraeevenes e Lay 24e 0 16 a a ene ene ne or ee E eee eee ee ee ee ee eee eee Delene a Oey a deic ts cescee cet E E E E E E E E A Page 4 Contents BANKS pss cca tesco cross secgeeks cv eet E ce cc ca ee aren svg vnc E ee serene eon tenet ees eM SV EAN acssectcceiaceev sacs N E S N scence dea ta seca me E E ne E Editing a Bank eeganenenqenesuaces anoteanessntenoneneeseadseseacapsansiieeaenensacyaariensmntoesnadeantnesstoreuseuneanseaeseusnet auenacsiqionenee sansa vagneeeaennvoneraeaanesassoaeaeneesapeeseues DEEE eat UPN ators a AE cee arenes os etm cece sa cos ve cans np vested rcs toca E A eee ete sen aac PCG INS cona E teat cles ccn ec pecs sae pee sea tnae A ence eee dcote E ene uevgetee ees Creating a New Percent Name csvesscsssascancuanscssaesivasnsienneninvnaisneseaicanalensinharetiainen a EDEP EPERERA ENEE E TONENE EEEE EK ONENE E
98. th Enter Percent Rate Check Skip Payment Skip is used to skip paying a loan on the current employee payslip 7 Ifthe cursor is on Percent Rate press Enter on the keyboard Or right click on the tab surface to display a context menu and select Save Loan as shown in Fig 10 9 above The details should appear on the Loan Details spreadsheet oo a a a Editing an Existing Loan To edit an Existing Loan 1 Click on the item to highlight it on Loan Details spreadsheet This displays the details on the entry fields 2 Make the necessary changes 3 Ifthe cursor is on Percent Rate press Enter on the keyboard Otherwise right click the item row on the spreadsheet or the tab surface to display a context menu and select Save Loan as shown in Fig 10 9 The UPDATE ALERT message box is displayed MS UPDATE ALERT 2 This Record Already Exists Are You Sure That You Want To Save Changes No Fig 10 10 Update Alert 4 Click Yes to save or No to cancel saving the Updates Note the report on the Application Explorer Status Deleting A Loan To Delete A Loan 1 Click on the item to highlight it on Loan Details spreadsheet as shown in Fig 10 9 2 Press Del or Delete on the keyboard or click the Delete dropdown on the dialog Toolbar and select Delete Loan Or right click the item row on the spreadsheet or the tab surface to display a context menu and select Delete Loan as shown in Fig 10 9 Note If payment had begun on the loan and not completed
99. the Employee details To search for an Employee type the first few letters of the Employee s name until it becomes visible and then select it Be sure that only the employee s number is displayed on Employee 71 Page 72 Creating a New Department To create a New Department 1 2 On the Department tab Set Date Select Dept Department Name Click the Dept Name button ellipsis to add a new Department If it s not on the dropdown list and select it Select Position Rank Click the Position Rank button ellipsis to add a new Position If it s not on the dropdown list and select it Check Status to make the Department active Note that the Active Department is the one used to pay the Employee Salary and also that an Employee can be moved to another department when that department is registered for the Employee and made Active Enter Basic Salary While the cursor is on Basic Salary press Enter on the keyboard Or right click on the tab surface to display a context menu and select Save Department as shown in Fig 10 2 below The details should appear on the Department spreadsheet PAYROLL For Asiri Festus 0001 i Festus 0001 Department Details TETT 1274 2012 Department Loan Ded Date pas fara Dept Name Accounts Save Department Postion Hank Accountant Delete Department Status E 50 000 00 a Fig 10 2 PayRoll dialog Editing an Existing Department To edit an existing Depart
100. to power 200 00 400 00 30 Days Beauty Secret 1 000 04 ne 100 00 Invoice Save Order Save Details Fil Delete Order Sales Details Delete Details je aaa tive Stock _ eserwed Stock J CO Issued Fig 5 16 shopping Details Spreadsheet 1 Select an item on the Shopping Details spreadsheet to highlight it 2 Press Del or Delete on the keyboard or right click the item to display a context menu and select Delete Details This displays a DELETE PROMPT message E DELETE PROMPT Me 7 4re You Sure That You Want To Delete The Selected Record Fig 5 17 Delete Prompt 3 Click Yes to delete or No to cancel deleting the record You must remove all Payment Details on the Order in order to remove items from the Shopping Details Note the report on the Application Explorer Status Important Any item that is removed from Shopping Details is automatically returned to its Stock Removing Items from Payment Details To remove an item from Payment Details 51 Page 52 Payment Details Date Cost__ Paid _ Change _ Balance _ Invoice Save Order Save Payment gt Delete Order Delete Payment i Payment Details 77972014 z Mode OF Payment_ Cash z C Issued Fig 5 18 Payment Details spreadsheet Click the Payment Details tab to select it Select an item on the Payment Details spreadsheet to highlight it Press Del or Delete on the keyboard or right click the item to displ
101. ts Set Values Entity Pole Display Initial Information e id Receipt Advert Information Figure 3 5 Options dialog Display Settings tab Pole Display Initial Information i Enter First Line to set the initial information displayed on the first line of the Customer Pole Display ii Enter Second Line to set the initial information displayed on the second line This initial information your company s scrolling advert is displayed when sales are not ongoing During Sales the running total of current invoice is displayed on the Pole Display Receipt Advert i Enter Information to set any information that you may want to display as an advert on the Sales Receipt 3 Click OK to save changes and close the dialog 4 Click Apply if you still need to make additional changes on other tabs Clicking Apply saves changes without closing the dialog 21 Page 22 Customer Information CyberShop maintains two types of Customers Anonymous Customers These are unregistered customers that patronize the sales outlet on and off basis Note that anonymous customers lack the capability for credit purchases This means that Anonymous Customers cannot owe Named Customers Named Customers are registered customers that have regular patronage at the sales outlet and have pre defined credit facility CyberShop allows these Customers to owe and the debts can be monitored on the Debtors List To process a customer 1 Click the File menu
102. tters of the order until it becomes visible and then select it as shown in Fig 8 2 2 Make the necessary changes to Supplier and Date 3 Click Save on the dialog Toolbar The UPDATE PROMPT message box is displayed E UPDATE PROMPT 2 This Details Record Already Exists Are You Sure That You Want To Update It All Changes Shall Be Saved Fig 8 5 Update Prompt 4 Click Yes to save or No to cancel saving the Updates 5 Repeat steps 4 through to 8 of Adding A New LPO section in order to add more items to the LPO Product List spreadsheet Note the report on the Application Explorer Status Deleting an LPO To Delete an LPO 1 Select an order from the LPO ID list and press Enter on the keyboard or Double Click on an order to display the order details To search for an order type the first few letters of the order until it becomes visible and then select it as shown in Fig 8 7 Make sure that only the LPO ID appears on the LPO ID as shown in Fig 8 7 2 Click Delete on the dialog Toolbar Or click the Delete dropdown on the dialog Toolbar and then select Delete LPO as shown in Fig 8 7 below The DELETE PROMPT message is displayed E DELETE PROMPT re Sure That You Want To Delete This Record Deleting This Record Will Also Delete All Its LPO Details Do You Want To Continue Yes No Fig 8 6 Delete Prompt 3 Click Yes to delete the Order and all its details or No to cancel deleting the Order Note the report on the
103. uct 7 Keys to power Sunday July 20 2014 Batch No Fig 15 23 Product Tracking Report Sales Ledgers The Sales Ledgers option allows you to preview Customer Ledgers for Sales transactions that are grouped together by Invoice Numbers Previewing Sales Ledgers To preview Sales Ledgers 1 Select Sales Ledgers Customers OBED 2 Fig 15 24 Customer Names List Select Name to specify a Customer Name Click Preview This displays selected Customer s Sales Ledger Sunday July 20 204 4 Sales Ledger For OBED Ref Number Details Quantity Unit Cost Sub Total TARM SS 7 Keys to power 2 00 200 00 400 00 30 Days Beauty Secret 3 00 4 000 00 3 000 00 Total 3 400 00 Grand Total 3 400 00 Fig 15 25 Sales Ledger Purchase Ledgers The Purchase Ledgers option allows you to preview Supplier Ledgers for Purchase transactions group together by Invoice Numbers Previewing Purchase Ledgers To preview Purchase Ledgers 1 Select Purchase Ledgers Suppliers ee onea Fig 15 26 Supplier Names List Select Name to specify a Supplier Name Click Preview This displays selected Supplier s Purchase Ledger 96 Page 96 Page 97 Sunday July 20 207 4 Purchase Ledger For GREAT Ref Number Details Quantity Unit Cost Sub Total 613 2014 005665400 oS SS 7 Keys to power 10 00 180 00 1 300 00 Abidec drop 10 00 120 00 1 200 00 Total 3 000 00 Grand Total 3 000 00 Fig 15 27 Purchase Ledger S
104. us Editing an Existing Department Name To edit an existing Department 1 Navigate to the department that you want to edit through the Navigation Bar For further information go to Appendix A 1 of 5 Records ated gt Fig 3 24 Navigation Bar 2 Enter the necessary changes 3 Click Edit on the dialog Toolbar The EDIT ALERT message is displayed EE EDIT ALERT Are You Sure That You Want To Apply Specified Changes s Fig 3 25 Edit Alert 4 Click Yes to save or No to cancel saving the changes Note the report on the Application Explorer Status Deleting an Department Name To Delete a Department 1 Navigate to the department that you want to delete through the Navigation Bar As shown in Fig 3 24 For further information on this go to Appendix A 2 Click Delete on the dialog Toolbar The DELETE ALERT message box is displayed EE DELETE ALERT s J Are You Sure That You Want To Delete This Record No Fig 3 26 Delete Alert 3 Click Yes to delete or No to cancel deleting the record Note the report on the Application Explorer Status Positions The Positions dialog is used to store the names of Employee Positions Examples include Sales Rep Accountant Manager Director etc To process a Position 1 Click the File menu 29 2 Page 30 CyberShop 2 1 sie view Accounts Utilities Reports Customers Products Ctrl F2 Suppliers Ctrl F6 Employees Departments
105. xpenses items in CyberShop To process a Expenses List 1 Click the Accounts menu Teele Utilities Reports Window Help Sales Orders Ctrl F1 Purchase Orders Local Purchase Orders LPO Banks Bank Transactions Staff PayRoll Percent Names Expenses List Expenses Ctrl F4 Profit Evaluation Summaries Fig 3 63 Accounts Menu 2 Select Percent Names This displays the Percent Names dialog as shown below in Fig 3 64 Fig 3 64 Expenses List dialog Creating a New Expenses List Item To create a new Expenses List Item 1 Click New on the dialog Toolbar to reset the entry field 40 Page 41 EXPENSES LIST Fig 3 65 Expenses List dialog The Save button is displayed as shown in Fig 3 65 Note the buttons that are disabled Clicking Save re enables them 2 Enter Item This must be unique it does not allow duplicates 3 Click Save on the dialog Toolbar to save the record Note that the New button is displayed as shown in Fig 3 64 If entries are made correctly the record is saved Note the report on the Application Explorer Status Editing an Existing Expenses List Item To edit an existing Expenses List Item 1 Navigate to the Item that you want to edit through the Navigation Bar For further information on this go to Appendix A 1 of 5 Records aa gt Fig 3 66 Navigation Bar 2 Enter the necessary changes 3 Click Edit on the dialog Toolbar The EDIT AL
106. y 7 23 2014 Wednesday 712412014 Thursday 712512014 Friday S aoao 7 26 2014 Saturday E 7 27 2014 raano Monday 7 29 2014 750204 Wednesday ed 7 31 2014 Thursday TOTAL 6 800 00 3 000 00 2 800 00 NET CASH H 1 000 00 CR Fig 15 38 Cash Flow Report Cash Evaluation Summary Report The result from Profit Evaluation transactions can be viewed on Cash Evaluation Summary Report Previewing Cash Evaluation Summary Report To preview Cash Evaluation Summary Reports 1 Select Cash Evaluation Summary Reports oe BALANCES z Fig 15 39 Option Names 2 Select Name 3 Click Preview This displays the Cash Evaluation Summary Report Cash Generated Cash Submitted 13 7 2014 3 400 00 3 400 00 a ae BALANCED 1 item s Fig 15 40 Cash Evaluation Summary Report 101 Page 101 Page 102 Customer Patronage Customer Patronage is a tool that displays a list of Named customers according to their patronage with respect to the amount they spent on visits calculated cumulatively on a monthly basis The customer names are arranged in descending order according to the amount that they spent Certain rewards can be offered to these customers as encouragement Previewing Customer Patronage To preview Customer Patronage 1 Select Customer Patronage 2 Select parameter option Monthly or Yearly as shown in Fig 15 28 3 Set From date Select the date for the month or
107. year that you want to preview 4 Click Preview This displays the Customer Patronage List CUSTOMER PATRONAGE FOR JULY 2014 _ OBED 2000 Fig 15 42 Customer Patronage Current Financial Statement Current Financial Statement is used to display the total financial activities of your business for the period specified It offers at a glance the health status of your business with the various fiscal parameters Previewing Current Financial Statement To preview Current Financial Statement 1 Select Current Financial Statement Daily Statement Aggregate Statement Fig 15 43 Date Range 2 Select the Statement Type 3 Set From date For Aggregate Statement set a date period as shown in Fig 15 3 4 Click Preview This displays the Current Financial Statement Report Cwrent Financial Report For Friday July 11 2014 Tuesday July 22 2014 DESCRIPTION INCOME Total Amount Receivable T aw l 500 00 w oo e S a e a S S mom o o NETINCOME Fig 15 44 Current Financial Statement Report 102 Page 103 Appendix A Page Navigation Page navigation allows you to move from one page to another on a multi page report or from one record row to another on a form dialog You will repeatedly come across navigation bars with buttons that when clicked displays a new page or record that is if it s available There are two types of navigation bars i Record Navigation Bar found on dialogs 1 of 5 Records a
108. yees can initiate sales orders add and remove items from such orders until payment is made after which only administrative users with the right permissions can delete such orders It is very important to note that at this instance the user is permitted to delete only those entries he she made since CyberShop monitors every entry made by each user SALES AND INVOICING PERMISSIONS Operation Administrator Admin_User_ User __ Table 2 0 Sales and Invoicing Permissions Note An Admin_User is the name given to a lower level Administrator To create an Admin_User append the word ADMIN_ to the User Name when creating Login credentials for a user Purchase Processing CyberShop maintains two types of stocks Active Stock The stock affected when sales are made Reserve Stock The stock affected when purchases are entered Making sales depletes or reduces the Active stock To replenish or add more stocks purchases are entered If the Active stock is not exhausted Purchases are stored on Reserve Stock in batches according to entries otherwise they are sent to Active Stock By this distinction CyberShop maintains multiple batches of stock by expiry dates especially for stocks that can expire CyberShop has an internal mechanism by which it moves Reserve Stock to Active Stock While making sales and CyberShop detects that there are no stocks to complete the transaction and before displaying a no stock alert it would do a check f

CyberShop End User Manual

Contents

Download Pdf Manuals

Related Search

Related Contents